Query         psy4350
Match_columns 107
No_of_seqs    115 out of 1072
Neff          9.2 
Searched_HMMs 46136
Date          Fri Aug 16 23:20:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4350.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4350hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.8 7.4E-21 1.6E-25  134.4  -0.6   91    9-104   267-359 (468)
  2 PF00412 LIM:  LIM domain;  Int  99.6 1.5E-15 3.2E-20   81.8   4.6   56   19-75      1-58  (58)
  3 KOG1044|consensus               99.6 5.2E-16 1.1E-20  113.4   2.4   85   14-103   131-216 (670)
  4 KOG1701|consensus               99.6 1.9E-16 4.2E-21  112.2  -1.2   86   13-102   331-424 (468)
  5 KOG4577|consensus               99.5 9.5E-16 2.1E-20  104.3  -2.6   83   15-102    32-117 (383)
  6 KOG2272|consensus               99.5   1E-14 2.2E-19   97.9   0.5   86   15-104    11-98  (332)
  7 KOG2272|consensus               99.5 8.1E-15 1.8E-19   98.3  -0.1   84   15-103   194-278 (332)
  8 KOG1703|consensus               99.3 9.9E-13 2.2E-17   96.7   2.6   85   14-103   361-448 (479)
  9 KOG1703|consensus               99.1 1.3E-10 2.9E-15   85.6   6.0   87   14-104   301-388 (479)
 10 smart00132 LIM Zinc-binding do  98.8 3.7E-09   8E-14   51.9   3.0   37   18-54      1-38  (39)
 11 KOG1044|consensus               98.7 1.2E-08 2.6E-13   75.5   3.3   80    9-103     9-89  (670)
 12 KOG4577|consensus               98.5 2.8E-08   6E-13   68.3   1.1   64   16-80     92-158 (383)
 13 KOG1700|consensus               98.2 3.7E-07   8E-12   60.5   0.7   65   12-77      3-68  (200)
 14 KOG1700|consensus               98.1 6.2E-07 1.3E-11   59.5  -0.6   64   10-74    102-165 (200)
 15 KOG1702|consensus               97.9 7.1E-07 1.5E-11   58.9  -2.8   59   17-76      5-64  (264)
 16 KOG0490|consensus               95.5  0.0067 1.5E-07   40.5   1.2   76   22-100     2-82  (235)
 17 PF00412 LIM:  LIM domain;  Int  90.0    0.13 2.9E-06   26.7   0.7   47   46-100     1-48  (58)
 18 PF14446 Prok-RING_1:  Prokaryo  88.2    0.52 1.1E-05   24.8   2.1   29   16-44      5-36  (54)
 19 PF08394 Arc_trans_TRASH:  Arch  87.2    0.47   1E-05   23.0   1.5   25   19-43      1-26  (37)
 20 PF09943 DUF2175:  Uncharacteri  77.7       1 2.2E-05   26.8   0.6   32   17-48      3-35  (101)
 21 COG2191 Formylmethanofuran deh  76.4       1 2.2E-05   30.1   0.4   30   44-74    173-202 (206)
 22 KOG3579|consensus               75.6     2.4 5.2E-05   29.9   2.1   51   12-68    264-314 (352)
 23 PF14471 DUF4428:  Domain of un  73.6     3.7   8E-05   21.2   2.0   29   45-74      1-29  (51)
 24 PF14835 zf-RING_6:  zf-RING of  73.3     2.7 5.8E-05   22.9   1.5   43   44-90      8-51  (65)
 25 PF13240 zinc_ribbon_2:  zinc-r  73.2     2.3   5E-05   18.2   1.0    9   19-27      2-10  (23)
 26 smart00504 Ubox Modified RING   72.8     9.8 0.00021   19.7   3.7   43   44-90      2-46  (63)
 27 PF04810 zf-Sec23_Sec24:  Sec23  72.5     3.1 6.8E-05   20.2   1.5   31   16-51      2-32  (40)
 28 PF13920 zf-C3HC4_3:  Zinc fing  70.9      10 0.00022   19.0   3.4   43   45-91      4-49  (50)
 29 PF10367 Vps39_2:  Vacuolar sor  70.6       3 6.4E-05   24.2   1.4   30   15-44     77-107 (109)
 30 KOG0320|consensus               66.0     5.9 0.00013   26.1   2.2   50   40-91    128-179 (187)
 31 PF07754 DUF1610:  Domain of un  65.9     5.1 0.00011   17.4   1.3   12   19-30      1-12  (24)
 32 PF10235 Cript:  Microtubule-as  63.9     5.4 0.00012   23.2   1.6   44   37-91     38-81  (90)
 33 PF13248 zf-ribbon_3:  zinc-rib  63.3     5.9 0.00013   17.3   1.3    9   18-26      4-12  (26)
 34 PF01258 zf-dskA_traR:  Prokary  62.9     1.4   3E-05   20.9  -0.9   27   46-73      6-32  (36)
 35 COG4357 Zinc finger domain con  59.6    0.81 1.7E-05   26.9  -2.4   36   19-54     38-73  (105)
 36 PF11781 RRN7:  RNA polymerase   59.4       6 0.00013   18.9   1.0   22   45-71     10-31  (36)
 37 PF00645 zf-PARP:  Poly(ADP-rib  59.0     6.7 0.00015   21.9   1.4   16   15-30      6-21  (82)
 38 KOG1813|consensus               57.8     6.6 0.00014   27.9   1.4   46   43-92    241-288 (313)
 39 PRK14890 putative Zn-ribbon RN  57.3      16 0.00034   19.6   2.5   29   15-52      6-34  (59)
 40 COG1645 Uncharacterized Zn-fin  57.0     5.3 0.00011   24.9   0.8   21   45-71     30-50  (131)
 41 COG5152 Uncharacterized conser  55.8       5 0.00011   26.9   0.6   47   42-92    195-243 (259)
 42 PF02069 Metallothio_Pro:  Prok  55.3     7.4 0.00016   20.3   1.0   28   45-73      9-37  (52)
 43 PF06677 Auto_anti-p27:  Sjogre  55.2     5.6 0.00012   19.6   0.5   21   45-70     19-39  (41)
 44 cd02336 ZZ_RSC8 Zinc finger, Z  53.2      16 0.00034   18.4   2.0   29   45-74      2-32  (45)
 45 PF13834 DUF4193:  Domain of un  53.0     3.6 7.8E-05   24.4  -0.4   28   44-71     71-98  (99)
 46 smart00291 ZnF_ZZ Zinc-binding  51.0      20 0.00042   17.6   2.2    9   66-74     28-36  (44)
 47 PF05502 Dynactin_p62:  Dynacti  50.4     9.1  0.0002   29.0   1.2   40   15-55     25-64  (483)
 48 cd02249 ZZ Zinc finger, ZZ typ  48.8      20 0.00043   17.7   2.0    8   67-74     25-32  (46)
 49 COG4847 Uncharacterized protei  48.4     7.3 0.00016   22.9   0.4   36   17-52      7-43  (103)
 50 PF04570 DUF581:  Protein of un  45.6      15 0.00033   19.5   1.3   25   45-69     18-43  (58)
 51 PF07503 zf-HYPF:  HypF finger;  45.2     7.2 0.00016   18.5   0.0   30   19-53      2-31  (35)
 52 PF06689 zf-C4_ClpX:  ClpX C4-t  44.7      39 0.00085   16.4   2.7   30   45-74      3-33  (41)
 53 PF00130 C1_1:  Phorbol esters/  43.8      16 0.00035   18.3   1.3   13   14-26      9-21  (53)
 54 PF14255 Cys_rich_CPXG:  Cystei  43.5     9.7 0.00021   19.8   0.4   29   18-46      2-30  (52)
 55 COG2888 Predicted Zn-ribbon RN  42.0      30 0.00064   18.6   2.1   28   16-52      9-36  (61)
 56 KOG0978|consensus               41.6      11 0.00024   29.9   0.6   43   44-90    644-689 (698)
 57 PF10886 DUF2685:  Protein of u  40.9      28 0.00061   18.3   1.8   26   17-42      2-27  (54)
 58 PF08746 zf-RING-like:  RING-li  40.7      11 0.00024   18.6   0.3   11   19-29      1-11  (43)
 59 cd02335 ZZ_ADA2 Zinc finger, Z  40.6      32  0.0007   17.3   2.1    8   67-74     26-33  (49)
 60 PRK08359 transcription factor;  39.7      30 0.00064   22.7   2.2   31   45-76      8-41  (176)
 61 PF12674 Zn_ribbon_2:  Putative  38.6      19  0.0004   20.5   1.1   30   45-74      2-35  (81)
 62 PLN03208 E3 ubiquitin-protein   38.3      57  0.0012   21.8   3.4   12   78-91     69-80  (193)
 63 PF01286 XPA_N:  XPA protein N-  37.6     9.8 0.00021   18.0  -0.2   15   16-30      3-17  (34)
 64 PRK00420 hypothetical protein;  37.4      16 0.00034   22.2   0.6   20   44-68     24-43  (112)
 65 TIGR00270 conserved hypothetic  37.0      33 0.00072   21.9   2.1   30   46-76      3-34  (154)
 66 PRK00019 rpmE 50S ribosomal pr  36.8      18 0.00039   20.1   0.8    8  100-107    40-47  (72)
 67 PF10083 DUF2321:  Uncharacteri  35.9      22 0.00048   22.9   1.2   10   79-90     70-79  (158)
 68 PF14634 zf-RING_5:  zinc-RING   35.5      58  0.0012   15.7   3.0   39   46-86      2-43  (44)
 69 COG1885 Uncharacterized protei  34.8      22 0.00048   21.3   1.0   29    2-30     35-63  (115)
 70 KOG4739|consensus               34.0      28  0.0006   24.0   1.5   31   58-91     18-49  (233)
 71 cd00162 RING RING-finger (Real  33.4      55  0.0012   14.9   2.4   24   63-88     18-44  (45)
 72 PF00569 ZZ:  Zinc finger, ZZ t  33.3      35 0.00075   16.9   1.5    9   66-74     29-37  (46)
 73 PF10764 Gin:  Inhibitor of sig  33.2      46   0.001   16.7   1.9   10   64-73     17-26  (46)
 74 KOG3002|consensus               33.0      48   0.001   23.6   2.6   46   43-92     48-93  (299)
 75 PF10080 DUF2318:  Predicted me  32.9      22 0.00048   21.1   0.8   33   37-74     29-61  (102)
 76 PF14569 zf-UDP:  Zinc-binding   32.8      64  0.0014   18.3   2.6   23   65-89     36-61  (80)
 77 PF13923 zf-C3HC4_2:  Zinc fing  32.2      62  0.0013   15.0   2.7   27   47-74      2-28  (39)
 78 PF06750 DiS_P_DiS:  Bacterial   31.5      22 0.00047   20.6   0.6   12   78-91     59-70  (92)
 79 PRK01397 50S ribosomal protein  31.3      25 0.00054   19.9   0.8    9   99-107    38-46  (78)
 80 PRK03922 hypothetical protein;  31.1      32  0.0007   20.8   1.3   29    2-30     35-63  (113)
 81 PRK01678 rpmE2 50S ribosomal p  31.1      25 0.00053   20.4   0.7   15   39-53      9-23  (87)
 82 PF00628 PHD:  PHD-finger;  Int  30.8      33 0.00071   17.0   1.1   26   19-44      2-29  (51)
 83 KOG2893|consensus               29.9      13 0.00028   25.8  -0.6   38   16-56     10-47  (341)
 84 PF11077 DUF2616:  Protein of u  29.8      22 0.00048   23.3   0.5   34   40-74    136-169 (173)
 85 PF01927 Mut7-C:  Mut7-C RNAse   29.7      33 0.00071   21.5   1.2   36   16-51     91-132 (147)
 86 CHL00136 rpl31 ribosomal prote  28.4      26 0.00057   19.2   0.5    7  101-107    41-47  (68)
 87 smart00249 PHD PHD zinc finger  28.4      42 0.00091   15.6   1.3   26   19-44      2-29  (47)
 88 cd02341 ZZ_ZZZ3 Zinc finger, Z  28.3      68  0.0015   16.2   2.0    8   67-74     28-35  (48)
 89 PLN02195 cellulose synthase A   28.3      55  0.0012   27.3   2.5   53   14-90      4-59  (977)
 90 COG0254 RpmE Ribosomal protein  27.7      31 0.00068   19.4   0.8   10   98-107    40-49  (75)
 91 PF12773 DZR:  Double zinc ribb  27.5      85  0.0018   15.4   2.4   13   15-27     11-23  (50)
 92 PF14149 YhfH:  YhfH-like prote  27.2      16 0.00035   17.6  -0.4   20   71-92      6-26  (37)
 93 PF08792 A2L_zn_ribbon:  A2L zi  26.3      41 0.00089   15.6   0.9    7   62-68     18-24  (33)
 94 PF04475 DUF555:  Protein of un  25.4      39 0.00084   20.1   0.9   25    6-30     37-61  (102)
 95 PLN00162 transport protein sec  24.7 1.2E+02  0.0027   24.5   3.8   34   13-51     50-83  (761)
 96 PF01194 RNA_pol_N:  RNA polyme  24.7      43 0.00094   18.0   0.9   13   16-28      4-16  (60)
 97 PRK14559 putative protein seri  24.4      56  0.0012   25.9   1.9    9   18-26      3-11  (645)
 98 PF08271 TF_Zn_Ribbon:  TFIIB z  24.4      37  0.0008   16.5   0.6    9   45-53     21-29  (43)
 99 PLN02915 cellulose synthase A   24.3 1.1E+02  0.0023   25.9   3.4   21   15-39     14-34  (1044)
100 TIGR00105 L31 ribosomal protei  24.1      34 0.00074   18.7   0.5    9   99-107    39-47  (68)
101 PF01197 Ribosomal_L31:  Riboso  23.2      40 0.00086   18.4   0.7    7  101-107    42-48  (69)
102 COG1813 Predicted transcriptio  23.1      76  0.0017   20.6   2.0   30   46-76      6-36  (165)
103 PRK00807 50S ribosomal protein  23.0      53  0.0012   16.9   1.1   24   17-40      2-28  (52)
104 PF06827 zf-FPG_IleRS:  Zinc fi  22.3      23  0.0005   15.7  -0.3   12   17-28      2-13  (30)
105 PRK00398 rpoP DNA-directed RNA  21.9      46   0.001   16.3   0.7    9   18-26      5-13  (46)
106 PF02591 DUF164:  Putative zinc  21.9      13 0.00029   19.2  -1.4   10   45-54     24-33  (56)
107 PLN02638 cellulose synthase A   21.7 1.4E+02  0.0031   25.3   3.6   15   12-26     13-27  (1079)
108 PF06906 DUF1272:  Protein of u  20.8 1.5E+02  0.0033   15.7   3.1   42   46-90      8-52  (57)
109 KOG3497|consensus               20.6      32  0.0007   18.5  -0.0   12   17-28      5-16  (69)
110 PRK14873 primosome assembly pr  20.4      68  0.0015   25.5   1.6   27   59-88    404-431 (665)
111 COG1644 RPB10 DNA-directed RNA  20.1      41 0.00088   18.2   0.3   13   16-28      4-16  (63)

No 1  
>KOG1701|consensus
Probab=99.79  E-value=7.4e-21  Score=134.37  Aligned_cols=91  Identities=19%  Similarity=0.436  Sum_probs=83.3

Q ss_pred             CCCCCCCCCccccccccccCceE-EeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCC
Q psy4350           9 SSPCPEEKSSCGGCGQPIIDRFY-LLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIP   86 (107)
Q Consensus         9 ~~~~~~~~~~C~~C~~~i~~~~~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~   86 (107)
                      ++..+..+..|.+|+|.|+.... +.++++.||..||+|..|++.|.++ .||..++++||+.||.. ..  +|..  |+
T Consensus       267 ~~p~~~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq-~FY~v~~k~~CE~cyq~tle--kC~~--Cg  341 (468)
T KOG1701|consen  267 AEPVEDYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQ-SFYQVDGKPYCEGCYQDTLE--KCNK--CG  341 (468)
T ss_pred             CChhhhhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccc-cccccCCcccchHHHHHHHH--HHhh--hh
Confidence            45566677799999999987654 6999999999999999999999998 89999999999999999 77  8999  99


Q ss_pred             CcchhhhhhhccccCCCC
Q psy4350          87 KTLVSFLYDKQGAASEPL  104 (107)
Q Consensus        87 ~~i~~~~~~~~g~~~~p~  104 (107)
                      ++|+++++++.|++|||.
T Consensus       342 ~~I~d~iLrA~GkayHp~  359 (468)
T KOG1701|consen  342 EPIMDRILRALGKAYHPG  359 (468)
T ss_pred             hHHHHHHHHhcccccCCC
Confidence            999999999999999995


No 2  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.60  E-value=1.5e-15  Score=81.77  Aligned_cols=56  Identities=30%  Similarity=0.894  Sum_probs=51.2

Q ss_pred             cccccccccCceEE-eecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-h
Q psy4350          19 CGGCGQPIIDRFYL-LAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-Y   75 (107)
Q Consensus        19 C~~C~~~i~~~~~~-~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~   75 (107)
                      |.+|+++|.+.+.+ .+.++.||+.||+|..|+++|.+. .++..++++||+.||.+ |
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDG-DFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTS-SEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCC-eeEeECCEEECHHHHhhhC
Confidence            78999999987765 699999999999999999999988 58999999999999987 5


No 3  
>KOG1044|consensus
Probab=99.58  E-value=5.2e-16  Score=113.42  Aligned_cols=85  Identities=27%  Similarity=0.665  Sum_probs=79.7

Q ss_pred             CCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchhh
Q psy4350          14 EEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVSF   92 (107)
Q Consensus        14 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~~   92 (107)
                      .++..|++|++.|..+..+.++++.||..||+|..|+..|.+  .+..+++.+||+.||.. |++ +|..  |.+.|+|.
T Consensus       131 ~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~g--ey~skdg~pyce~dy~~~fgv-kc~~--c~~fisgk  205 (670)
T KOG1044|consen  131 YGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLNG--EYMSKDGVPYCEKDYQAKFGV-KCEE--CEKFISGK  205 (670)
T ss_pred             cCCccccchhhhhhccceeeeeccceeeeeeehhhhcccccc--eeeccCCCcchhhhhhhhcCe-ehHH--hhhhhhhh
Confidence            467789999999998888899999999999999999999987  48899999999999999 995 9999  99999999


Q ss_pred             hhhhccccCCC
Q psy4350          93 LYDKQGAASEP  103 (107)
Q Consensus        93 ~~~~~g~~~~p  103 (107)
                      ++.+.|+-|||
T Consensus       206 vLqag~kh~HP  216 (670)
T KOG1044|consen  206 VLQAGDKHFHP  216 (670)
T ss_pred             hhhccCcccCc
Confidence            99999999999


No 4  
>KOG1701|consensus
Probab=99.57  E-value=1.9e-16  Score=112.24  Aligned_cols=86  Identities=24%  Similarity=0.551  Sum_probs=72.3

Q ss_pred             CCCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchh
Q psy4350          13 PEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVS   91 (107)
Q Consensus        13 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~   91 (107)
                      +....+|..|++.|.+.. +.++|+.||+.||+|..|.+.|.+..+....++++||..||++ |+ ++|+.  |+++|+.
T Consensus       331 q~tlekC~~Cg~~I~d~i-LrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfA-PrCs~--C~~PI~P  406 (468)
T KOG1701|consen  331 QDTLEKCNKCGEPIMDRI-LRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFA-PRCSV--CGNPILP  406 (468)
T ss_pred             HHHHHHHhhhhhHHHHHH-HHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcC-cchhh--ccCCccC
Confidence            345678999999999984 8999999999999999999999988334677899999999999 99 79999  9999974


Q ss_pred             h-------hhhhccccCC
Q psy4350          92 F-------LYDKQGAASE  102 (107)
Q Consensus        92 ~-------~~~~~g~~~~  102 (107)
                      .       -+.++++.||
T Consensus       407 ~~G~~etvRvvamdr~fH  424 (468)
T KOG1701|consen  407 RDGKDETVRVVAMDRDFH  424 (468)
T ss_pred             CCCCcceEEEEEcccccc
Confidence            2       2334566666


No 5  
>KOG4577|consensus
Probab=99.49  E-value=9.5e-16  Score=104.34  Aligned_cols=83  Identities=39%  Similarity=0.903  Sum_probs=73.8

Q ss_pred             CCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchh--
Q psy4350          15 EKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVS--   91 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~--   91 (107)
                      ..++|+.|.+.|.+++++.++++.||..|++|+.|..+|..  .++.+++.+||+.+|++ || .+|..  |+..|..  
T Consensus        32 eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~d--rCFsR~~s~yCkedFfKrfG-TKCsa--C~~GIpPtq  106 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLAD--RCFSREGSVYCKEDFFKRFG-TKCSA--CQEGIPPTQ  106 (383)
T ss_pred             ccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHH--HHhhcCCceeehHHHHHHhC-Ccchh--hcCCCChHH
Confidence            56789999999999998899999999999999999999988  57899999999999999 99 59999  9999964  


Q ss_pred             hhhhhccccCC
Q psy4350          92 FLYDKQGAASE  102 (107)
Q Consensus        92 ~~~~~~g~~~~  102 (107)
                      .+-+++...||
T Consensus       107 VVRkAqd~VYH  117 (383)
T KOG4577|consen  107 VVRKAQDFVYH  117 (383)
T ss_pred             HHHHhhcceee
Confidence            55566666666


No 6  
>KOG2272|consensus
Probab=99.46  E-value=1e-14  Score=97.86  Aligned_cols=86  Identities=17%  Similarity=0.426  Sum_probs=77.8

Q ss_pred             CCCccccccccccCceE-EeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchhh
Q psy4350          15 EKSSCGGCGQPIIDRFY-LLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVSF   92 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~~   92 (107)
                      ....|.+|.....+.+. +...+..||..||.|..|-.++.++ .|++-+|+.||+.+|.. |+ |-|+.  |++.|.|.
T Consensus        11 ~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g-~~~efEgRkYCEhDF~~Lfa-PcC~k--C~EFiiGr   86 (332)
T KOG2272|consen   11 ANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDG-IFYEFEGRKYCEHDFHVLFA-PCCGK--CGEFIIGR   86 (332)
T ss_pred             HHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCc-eeEEecCcccccccchhhhc-hhhcc--cccchhhH
Confidence            34569999988876665 4677889999999999999999988 89999999999999999 99 79999  99999999


Q ss_pred             hhhhccccCCCC
Q psy4350          93 LYDKQGAASEPL  104 (107)
Q Consensus        93 ~~~~~g~~~~p~  104 (107)
                      ++.++.++|||-
T Consensus        87 VikamnnSwHp~   98 (332)
T KOG2272|consen   87 VIKAMNNSWHPA   98 (332)
T ss_pred             HHHhhccccCcc
Confidence            999999999994


No 7  
>KOG2272|consensus
Probab=99.46  E-value=8.1e-15  Score=98.29  Aligned_cols=84  Identities=20%  Similarity=0.515  Sum_probs=77.5

Q ss_pred             CCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchhhh
Q psy4350          15 EKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVSFL   93 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~~~   93 (107)
                      +.++|..|.++|.++ ++.++|+.||...|+|+.|.++.-+- ..|++.|..||+.+|.+ || ..|..  |+..|-|.+
T Consensus       194 gipiCgaC~rpIeer-vi~amgKhWHveHFvCa~CekPFlGH-rHYEkkGlaYCe~h~~qLfG-~~CF~--C~~~i~G~v  268 (332)
T KOG2272|consen  194 GIPICGACRRPIEER-VIFAMGKHWHVEHFVCAKCEKPFLGH-RHYEKKGLAYCETHYHQLFG-NLCFI--CNRVIGGDV  268 (332)
T ss_pred             CCcccccccCchHHH-HHHHhccccchhheeehhcCCcccch-hhhhhcCchhHHHHHHHHhh-hhhee--cCCccCccH
Confidence            567899999999876 48999999999999999999998776 78999999999999999 99 69999  999999999


Q ss_pred             hhhccccCCC
Q psy4350          94 YDKQGAASEP  103 (107)
Q Consensus        94 ~~~~g~~~~p  103 (107)
                      +.+.++||-|
T Consensus       269 v~al~KawCv  278 (332)
T KOG2272|consen  269 VSALNKAWCV  278 (332)
T ss_pred             HHHhhhhhcc
Confidence            9999999876


No 8  
>KOG1703|consensus
Probab=99.30  E-value=9.9e-13  Score=96.75  Aligned_cols=85  Identities=26%  Similarity=0.592  Sum_probs=76.8

Q ss_pred             CCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcch--
Q psy4350          14 EEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLV--   90 (107)
Q Consensus        14 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~--   90 (107)
                      ...+.|.+|.+.|.+.. |.+.+..||+.||+|..|.+.+... .|+..++.+||+.||.+ +. ++|..  |..++.  
T Consensus       361 ~~~p~C~~C~~~i~~~~-v~a~~~~wH~~cf~C~~C~~~~~~~-~~~~~~~~pyce~~~~~~~~-~~~~~--~~~p~~~~  435 (479)
T KOG1703|consen  361 PFRPNCKRCLLPILEEG-VCALGRLWHPECFVCADCGKPLKNS-SFFESDGEPYCEDHYKKLFT-TKCDY--CKKPVEFG  435 (479)
T ss_pred             hhCccccccCCchHHhH-hhhccCeechhceeeecccCCCCCC-cccccCCccchhhhHhhhcc-ccchh--ccchhHhh
Confidence            45788999999998885 7777999999999999999999887 89999999999999999 98 69999  999987  


Q ss_pred             hhhhhhccccCCC
Q psy4350          91 SFLYDKQGAASEP  103 (107)
Q Consensus        91 ~~~~~~~g~~~~p  103 (107)
                      +..+.++|..||+
T Consensus       436 ~~~ie~~~~~~h~  448 (479)
T KOG1703|consen  436 SRQIEADGSPFHG  448 (479)
T ss_pred             hhHhhccCccccc
Confidence            7889999999886


No 9  
>KOG1703|consensus
Probab=99.12  E-value=1.3e-10  Score=85.62  Aligned_cols=87  Identities=17%  Similarity=0.331  Sum_probs=78.8

Q ss_pred             CCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchhh
Q psy4350          14 EEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVSF   92 (107)
Q Consensus        14 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~~   92 (107)
                      ...+.|..|+..|.....+.++++.||+.+|.|..|...+... .+...++++||..||.. +. +.|..  |+++|.+.
T Consensus       301 ~~~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~~~-~~~~~~g~~~c~~~~~~~~~-p~C~~--C~~~i~~~  376 (479)
T KOG1703|consen  301 VTRPLCLSCNQKIRSVKVIVALGKEWHPEHFSCEVCAIVILDG-GPRELDGKILCHECFHAPFR-PNCKR--CLLPILEE  376 (479)
T ss_pred             cccccccccccCcccceeEeeccccccccceeeccccccccCC-CccccCCCccHHHHHHHhhC-ccccc--cCCchHHh
Confidence            3458899999999884468999999999999999999998877 67888999999999999 88 79999  99999999


Q ss_pred             hhhhccccCCCC
Q psy4350          93 LYDKQGAASEPL  104 (107)
Q Consensus        93 ~~~~~g~~~~p~  104 (107)
                      .+.+.+..|||-
T Consensus       377 ~v~a~~~~wH~~  388 (479)
T KOG1703|consen  377 GVCALGRLWHPE  388 (479)
T ss_pred             HhhhccCeechh
Confidence            999999999984


No 10 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.83  E-value=3.7e-09  Score=51.88  Aligned_cols=37  Identities=41%  Similarity=1.068  Sum_probs=32.7

Q ss_pred             ccccccccccCc-eEEeecCcccccccccccccCCCCC
Q psy4350          18 SCGGCGQPIIDR-FYLLAVDRQWHLGCLQCAHCHVPLH   54 (107)
Q Consensus        18 ~C~~C~~~i~~~-~~~~~~~~~~H~~Cf~C~~C~~~l~   54 (107)
                      +|.+|++.|.+. ..+.+.++.||+.||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            488999999886 5578899999999999999999885


No 11 
>KOG1044|consensus
Probab=98.70  E-value=1.2e-08  Score=75.51  Aligned_cols=80  Identities=23%  Similarity=0.458  Sum_probs=64.7

Q ss_pred             CCCCCCCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCC
Q psy4350           9 SSPCPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPK   87 (107)
Q Consensus         9 ~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~   87 (107)
                      +........+|.+|.+.-... ++.+.++.||..||+|..|+..|... .|+.+++.        + ++ +  ..  |..
T Consensus         9 s~~~~~~~i~c~~c~~kc~ge-vlrv~d~~fhi~cf~c~~cg~~la~~-gff~k~~~--------~~yg-t--~~--c~~   73 (670)
T KOG1044|consen    9 SPQTGKQGIKCDKCRKKCSGE-VLRVNDNHFHINCFQCKKCGRNLAEG-GFFTKPEN--------RLYG-T--DD--CRA   73 (670)
T ss_pred             CccccccceehhhhCCccccc-eeEeeccccceeeeeccccCCCcccc-cceecccc--------eeec-c--cc--hhh
Confidence            334445567899999988765 68999999999999999999999887 67666554        3 44 2  44  778


Q ss_pred             cchhhhhhhccccCCC
Q psy4350          88 TLVSFLYDKQGAASEP  103 (107)
Q Consensus        88 ~i~~~~~~~~g~~~~p  103 (107)
                      .|.+.++.+.|++|||
T Consensus        74 ~~~gevvsa~gktyh~   89 (670)
T KOG1044|consen   74 FVEGEVVSTLGKTYHP   89 (670)
T ss_pred             hccceeEecccceecc
Confidence            9999999999999998


No 12 
>KOG4577|consensus
Probab=98.53  E-value=2.8e-08  Score=68.32  Aligned_cols=64  Identities=22%  Similarity=0.449  Sum_probs=53.4

Q ss_pred             CCccccccccccCceEE-eecCcccccccccccccCCCCCCCCce-eccCCeeccHHHHhh-hCCCCC
Q psy4350          16 KSSCGGCGQPIIDRFYL-LAVDRQWHLGCLQCAHCHVPLHSELSC-FSRHGNIYCKQDFFR-YSQARY   80 (107)
Q Consensus        16 ~~~C~~C~~~i~~~~~~-~~~~~~~H~~Cf~C~~C~~~l~~~~~~-~~~~~~~~C~~~y~~-~~~~~C   80 (107)
                      .-+|..|.+.|.+..++ .+.+..||..||.|..|.+.|..+..| ...+.++.|+.+|+. -. +.|
T Consensus        92 GTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~-k~~  158 (383)
T KOG4577|consen   92 GTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQ-KHC  158 (383)
T ss_pred             CCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHh-ccc
Confidence            45799999999988766 788899999999999999999854444 577889999999998 55 455


No 13 
>KOG1700|consensus
Probab=98.21  E-value=3.7e-07  Score=60.52  Aligned_cols=65  Identities=18%  Similarity=0.452  Sum_probs=55.4

Q ss_pred             CCCCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCC
Q psy4350          12 CPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQ   77 (107)
Q Consensus        12 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~   77 (107)
                      .......|..|++.++..+.+...+..||+.||.|..|.+.|... .+..+++.+||+.+|.. +++
T Consensus         3 ~~~~~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~-~~~~~e~~~yc~~~~~~~~~~   68 (200)
T KOG1700|consen    3 FTGTTDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLS-GYSEHEGVPYCKNCHVAQFGP   68 (200)
T ss_pred             cccccchhhhccCcchHHHHHhccCcchhhhHHhccccccccccc-cccccccccccccchHhhhCc
Confidence            344566899999999988777888999999999999999999876 67789999999998777 773


No 14 
>KOG1700|consensus
Probab=98.06  E-value=6.2e-07  Score=59.46  Aligned_cols=64  Identities=23%  Similarity=0.565  Sum_probs=55.0

Q ss_pred             CCCCCCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh
Q psy4350          10 SPCPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        10 ~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~   74 (107)
                      .+.......|..|.+.+++.+.+...+..||..||+|..|+..|... .+....+.++|...+..
T Consensus       102 ~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~-~~~~~~g~l~~~~~~~~  165 (200)
T KOG1700|consen  102 QVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPK-NYAALEGVLYCKHHFAQ  165 (200)
T ss_pred             HhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCc-chhhcCCccccchhhhe
Confidence            34556678899999999998888999999999999999999999987 78888888888776665


No 15 
>KOG1702|consensus
Probab=97.88  E-value=7.1e-07  Score=58.86  Aligned_cols=59  Identities=19%  Similarity=0.536  Sum_probs=52.2

Q ss_pred             CccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hC
Q psy4350          17 SSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YS   76 (107)
Q Consensus        17 ~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~   76 (107)
                      ..|..|++.+++.+.+..+++.||..||+|..|+..|... .+-..+.++||..+|.+ .+
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmK-nyKgy~kkpycn~hYpkq~a   64 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMK-NYKGYDKKPYCNPHYPKQVA   64 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhh-hccccccCCCcCccccccee
Confidence            4578899999998888999999999999999999999877 67778889999999987 54


No 16 
>KOG0490|consensus
Probab=95.46  E-value=0.0067  Score=40.51  Aligned_cols=76  Identities=41%  Similarity=0.848  Sum_probs=56.1

Q ss_pred             ccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh---hCCCCCCCCCCCCcch--hhhhhh
Q psy4350          22 CGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR---YSQARYPDLPIPKTLV--SFLYDK   96 (107)
Q Consensus        22 C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~---~~~~~C~~~~C~~~i~--~~~~~~   96 (107)
                      |+..|.+...+...+..||..|..|..|...+......+..++..||..+|.+   +. .+|..  |...|.  ..+..+
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~-~rr~r--t~~~~~ql~~ler~   78 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKFS-KRCAR--CKFTISQLDELERA   78 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchhhhhcc-ccccC--CCCCcCHHHHHHHh
Confidence            66777777666777899999999999999998722234444999999999985   44 68999  888873  344444


Q ss_pred             cccc
Q psy4350          97 QGAA  100 (107)
Q Consensus        97 ~g~~  100 (107)
                      ..+.
T Consensus        79 f~~~   82 (235)
T KOG0490|consen   79 FEKV   82 (235)
T ss_pred             hcCC
Confidence            4444


No 17 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=90.00  E-value=0.13  Score=26.70  Aligned_cols=47  Identities=23%  Similarity=0.469  Sum_probs=32.1

Q ss_pred             ccccCCCCCCCCceeccCCeeccHHHHhhhCCCCCCCCCCCCcchhh-hhhhcccc
Q psy4350          46 CAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQARYPDLPIPKTLVSF-LYDKQGAA  100 (107)
Q Consensus        46 C~~C~~~l~~~~~~~~~~~~~~C~~~y~~~~~~~C~~~~C~~~i~~~-~~~~~g~~  100 (107)
                      |..|++++.+........++.|...||      .|..  |+.+|.+. .+..+|+.
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf------~C~~--C~~~l~~~~~~~~~~~~   48 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECF------KCSK--CGKPLNDGDFYEKDGKP   48 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTS------BETT--TTCBTTTSSEEEETTEE
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEcccc------ccCC--CCCccCCCeeEeECCEE
Confidence            677888887663444578888887773      5888  99998765 34444543


No 18 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=88.18  E-value=0.52  Score=24.78  Aligned_cols=29  Identities=21%  Similarity=0.524  Sum_probs=20.6

Q ss_pred             CCcccccccccc--CceEE-eecCcccccccc
Q psy4350          16 KSSCGGCGQPII--DRFYL-LAVDRQWHLGCL   44 (107)
Q Consensus        16 ~~~C~~C~~~i~--~~~~~-~~~~~~~H~~Cf   44 (107)
                      ..+|..|++.+.  +..++ ..-+..||++|+
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            457999999995  33222 456788999887


No 19 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=87.21  E-value=0.47  Score=22.97  Aligned_cols=25  Identities=20%  Similarity=0.481  Sum_probs=17.9

Q ss_pred             cccccccccCceE-EeecCccccccc
Q psy4350          19 CGGCGQPIIDRFY-LLAVDRQWHLGC   43 (107)
Q Consensus        19 C~~C~~~i~~~~~-~~~~~~~~H~~C   43 (107)
                      |..|+.+|.+... +...++.|+.-|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC   26 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCC   26 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEEC
Confidence            6778999976654 477788887443


No 20 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=77.75  E-value=1  Score=26.77  Aligned_cols=32  Identities=22%  Similarity=0.423  Sum_probs=23.1

Q ss_pred             CccccccccccCceEEeecC-cccccccccccc
Q psy4350          17 SSCGGCGQPIIDRFYLLAVD-RQWHLGCLQCAH   48 (107)
Q Consensus        17 ~~C~~C~~~i~~~~~~~~~~-~~~H~~Cf~C~~   48 (107)
                      -.|..|++.|+.+++..+.. ..-|..||.=..
T Consensus         3 WkC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~   35 (101)
T PF09943_consen    3 WKCYICGKPIYEGQLFTFTKKGPVHYECFREKA   35 (101)
T ss_pred             eEEEecCCeeeecceEEEecCCcEeHHHHHHHH
Confidence            36888999998888776644 456888886543


No 21 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=76.37  E-value=1  Score=30.10  Aligned_cols=30  Identities=17%  Similarity=0.364  Sum_probs=24.1

Q ss_pred             ccccccCCCCCCCCceeccCCeeccHHHHhh
Q psy4350          44 LQCAHCHVPLHSELSCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        44 f~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~   74 (107)
                      -+|+.|+...... .....+|++.|..||.+
T Consensus       173 v~C~kCGE~~~e~-~~~~~ng~~vC~~C~~~  202 (206)
T COG2191         173 VRCSKCGELFMEP-RAVVLNGKPVCKPCAEK  202 (206)
T ss_pred             eeccccCcccccc-hhhhcCCceeccccccc
Confidence            5788899877655 56778999999999875


No 22 
>KOG3579|consensus
Probab=75.62  E-value=2.4  Score=29.93  Aligned_cols=51  Identities=20%  Similarity=0.525  Sum_probs=35.0

Q ss_pred             CCCCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeecc
Q psy4350          12 CPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYC   68 (107)
Q Consensus        12 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C   68 (107)
                      .+...-.|.-|++.+.+...+..-.-.-|+.||-|+.  ..+-.    ....+++||
T Consensus       264 A~~apLcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSR--esIK~----Qg~sgevYC  314 (352)
T KOG3579|consen  264 APSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSR--ESIKQ----QGASGEVYC  314 (352)
T ss_pred             CCCCceeehhhhhhhccCceeecCCCcccceecccCH--HHHHh----hcCCCceeC
Confidence            3344567899999999887777777788999998763  11211    233457787


No 23 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=73.62  E-value=3.7  Score=21.21  Aligned_cols=29  Identities=21%  Similarity=0.349  Sum_probs=19.5

Q ss_pred             cccccCCCCCCCCceeccCCeeccHHHHhh
Q psy4350          45 QCAHCHVPLHSELSCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~   74 (107)
                      .|..|+..++--..+-..+| ..|.+|+.+
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~K   29 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKK   29 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHH
Confidence            36778877764323556666 579999876


No 24 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=73.33  E-value=2.7  Score=22.95  Aligned_cols=43  Identities=19%  Similarity=0.403  Sum_probs=19.5

Q ss_pred             ccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcch
Q psy4350          44 LQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLV   90 (107)
Q Consensus        44 f~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~   90 (107)
                      ++|+.|...|... .....=..+||..|-.. ++ ..|-.  |+.|-.
T Consensus         8 LrCs~C~~~l~~p-v~l~~CeH~fCs~Ci~~~~~-~~CPv--C~~Paw   51 (65)
T PF14835_consen    8 LRCSICFDILKEP-VCLGGCEHIFCSSCIRDCIG-SECPV--CHTPAW   51 (65)
T ss_dssp             TS-SSS-S--SS--B---SSS--B-TTTGGGGTT-TB-SS--S--B-S
T ss_pred             cCCcHHHHHhcCC-ceeccCccHHHHHHhHHhcC-CCCCC--cCChHH
Confidence            5677777766543 23455567788888877 77 57888  887754


No 25 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=73.23  E-value=2.3  Score=18.16  Aligned_cols=9  Identities=44%  Similarity=1.073  Sum_probs=4.2

Q ss_pred             ccccccccc
Q psy4350          19 CGGCGQPII   27 (107)
Q Consensus        19 C~~C~~~i~   27 (107)
                      |..|+..|.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            444544443


No 26 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=72.76  E-value=9.8  Score=19.72  Aligned_cols=43  Identities=12%  Similarity=0.207  Sum_probs=29.9

Q ss_pred             ccccccCCCCCCCCceeccCCeeccHHHHhh-hC-CCCCCCCCCCCcch
Q psy4350          44 LQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YS-QARYPDLPIPKTLV   90 (107)
Q Consensus        44 f~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~-~~~C~~~~C~~~i~   90 (107)
                      |.|..|...+..  ......|.+||+.+..+ +. ...|-.  |++++.
T Consensus         2 ~~Cpi~~~~~~~--Pv~~~~G~v~~~~~i~~~~~~~~~cP~--~~~~~~   46 (63)
T smart00504        2 FLCPISLEVMKD--PVILPSGQTYERRAIEKWLLSHGTDPV--TGQPLT   46 (63)
T ss_pred             cCCcCCCCcCCC--CEECCCCCEEeHHHHHHHHHHCCCCCC--CcCCCC
Confidence            467777777765  35567789999999887 43 245766  777764


No 27 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=72.49  E-value=3.1  Score=20.20  Aligned_cols=31  Identities=16%  Similarity=0.423  Sum_probs=15.2

Q ss_pred             CCccccccccccCceEEeecCcccccccccccccCC
Q psy4350          16 KSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHV   51 (107)
Q Consensus        16 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~   51 (107)
                      +.+|..|+..|.+-..+...++.|     +|..|+.
T Consensus         2 p~rC~~C~aylNp~~~~~~~~~~w-----~C~~C~~   32 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFCQFDDGGKTW-----ICNFCGT   32 (40)
T ss_dssp             S-B-TTT--BS-TTSEEETTTTEE-----EETTT--
T ss_pred             ccccCCCCCEECCcceEcCCCCEE-----ECcCCCC
Confidence            467888888887654455555555     5555553


No 28 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=70.88  E-value=10  Score=18.98  Aligned_cols=43  Identities=16%  Similarity=0.392  Sum_probs=27.4

Q ss_pred             cccccCCCCCCCCceeccCCee-ccHHHHhh-h-CCCCCCCCCCCCcchh
Q psy4350          45 QCAHCHVPLHSELSCFSRHGNI-YCKQDFFR-Y-SQARYPDLPIPKTLVS   91 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~~~~~~-~C~~~y~~-~-~~~~C~~~~C~~~i~~   91 (107)
                      .|..|......  .....=+.. +|..|..+ + ..+.|-.  |.++|..
T Consensus         4 ~C~iC~~~~~~--~~~~pCgH~~~C~~C~~~~~~~~~~CP~--Cr~~i~~   49 (50)
T PF13920_consen    4 ECPICFENPRD--VVLLPCGHLCFCEECAERLLKRKKKCPI--CRQPIES   49 (50)
T ss_dssp             B-TTTSSSBSS--EEEETTCEEEEEHHHHHHHHHTTSBBTT--TTBB-SE
T ss_pred             CCccCCccCCc--eEEeCCCChHHHHHHhHHhcccCCCCCc--CChhhcC
Confidence            45555555433  345556667 99999987 3 3468999  9988863


No 29 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=70.56  E-value=3  Score=24.24  Aligned_cols=30  Identities=23%  Similarity=0.756  Sum_probs=16.3

Q ss_pred             CCCccccccccccCceEE-eecCcccccccc
Q psy4350          15 EKSSCGGCGQPIIDRFYL-LAVDRQWHLGCL   44 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~~-~~~~~~~H~~Cf   44 (107)
                      ....|..|++.|.....+ -..+..+|..|.
T Consensus        77 ~~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   77 ESTKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCCCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            344577777777554322 333445666554


No 30 
>KOG0320|consensus
Probab=66.02  E-value=5.9  Score=26.08  Aligned_cols=50  Identities=16%  Similarity=0.442  Sum_probs=36.6

Q ss_pred             ccccccccccCCCCCCCCceeccCCeeccHHHHhh-h-CCCCCCCCCCCCcchh
Q psy4350          40 HLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-Y-SQARYPDLPIPKTLVS   91 (107)
Q Consensus        40 H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~-~~~~C~~~~C~~~i~~   91 (107)
                      ...++.|..|-........+.-.-|.+||+.|-.. . .+.+|-.  |++-|+.
T Consensus       128 ~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~--C~kkIt~  179 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPT--CRKKITH  179 (187)
T ss_pred             cccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCC--cccccch
Confidence            34578888887777665445567889999999876 3 2368999  9987763


No 31 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=65.89  E-value=5.1  Score=17.42  Aligned_cols=12  Identities=50%  Similarity=1.146  Sum_probs=6.5

Q ss_pred             cccccccccCce
Q psy4350          19 CGGCGQPIIDRF   30 (107)
Q Consensus        19 C~~C~~~i~~~~   30 (107)
                      |..|+..|.+++
T Consensus         1 C~sC~~~i~~r~   12 (24)
T PF07754_consen    1 CTSCGRPIAPRE   12 (24)
T ss_pred             CccCCCcccCcc
Confidence            455666665543


No 32 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=63.87  E-value=5.4  Score=23.22  Aligned_cols=44  Identities=16%  Similarity=0.377  Sum_probs=29.4

Q ss_pred             cccccccccccccCCCCCCCCceeccCCeeccHHHHhhhCCCCCCCCCCCCcchh
Q psy4350          37 RQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQARYPDLPIPKTLVS   91 (107)
Q Consensus        37 ~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~~~~~~C~~~~C~~~i~~   91 (107)
                      +.|-..--.|..|...+.+       .+.-||..|-++-+  .|+-  |++.|.+
T Consensus        38 nPy~~~~~~C~~CK~~v~q-------~g~~YCq~CAYkkG--iCam--CGKki~d   81 (90)
T PF10235_consen   38 NPYAPYSSKCKICKTKVHQ-------PGAKYCQTCAYKKG--ICAM--CGKKILD   81 (90)
T ss_pred             CcccccCcccccccccccc-------CCCccChhhhcccC--cccc--cCCeecc
Confidence            4454433466777765533       25679999966545  8999  9999854


No 33 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=63.34  E-value=5.9  Score=17.26  Aligned_cols=9  Identities=44%  Similarity=1.069  Sum_probs=4.4

Q ss_pred             ccccccccc
Q psy4350          18 SCGGCGQPI   26 (107)
Q Consensus        18 ~C~~C~~~i   26 (107)
                      .|..|+..|
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            355555543


No 34 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=62.94  E-value=1.4  Score=20.89  Aligned_cols=27  Identities=22%  Similarity=0.459  Sum_probs=11.6

Q ss_pred             ccccCCCCCCCCceeccCCeeccHHHHh
Q psy4350          46 CAHCHVPLHSELSCFSRHGNIYCKQDFF   73 (107)
Q Consensus        46 C~~C~~~l~~~~~~~~~~~~~~C~~~y~   73 (107)
                      |..|+..+... ......+..+|..|..
T Consensus         6 C~~CGe~I~~~-Rl~~~p~~~~C~~C~~   32 (36)
T PF01258_consen    6 CEDCGEPIPEE-RLVAVPGATLCVECQE   32 (36)
T ss_dssp             -TTTSSBEEHH-HHHHCTTECS-HHHHH
T ss_pred             ccccCChHHHH-HHHhCCCcEECHHHhC
Confidence            44555544433 3333445555555543


No 35 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=59.64  E-value=0.81  Score=26.94  Aligned_cols=36  Identities=17%  Similarity=0.326  Sum_probs=18.7

Q ss_pred             cccccccccCceEEeecCcccccccccccccCCCCC
Q psy4350          19 CGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLH   54 (107)
Q Consensus        19 C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   54 (107)
                      |..|+..+.......+.-..+++.+..|..|...|.
T Consensus        38 Cy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT   73 (105)
T COG4357          38 CYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLT   73 (105)
T ss_pred             HHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhh
Confidence            334444444333233334456666666666666664


No 36 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=59.42  E-value=6  Score=18.87  Aligned_cols=22  Identities=27%  Similarity=0.637  Sum_probs=13.8

Q ss_pred             cccccCCCCCCCCceeccCCeeccHHH
Q psy4350          45 QCAHCHVPLHSELSCFSRHGNIYCKQD   71 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~~~~~~~C~~~   71 (107)
                      .|..|+..     .+...+|..||..|
T Consensus        10 ~C~~C~~~-----~~~~~dG~~yC~~c   31 (36)
T PF11781_consen   10 PCPVCGSR-----WFYSDDGFYYCDRC   31 (36)
T ss_pred             cCCCCCCe-----EeEccCCEEEhhhC
Confidence            35556543     35667888888655


No 37 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=58.98  E-value=6.7  Score=21.89  Aligned_cols=16  Identities=25%  Similarity=0.630  Sum_probs=11.5

Q ss_pred             CCCccccccccccCce
Q psy4350          15 EKSSCGGCGQPIIDRF   30 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~   30 (107)
                      +-..|..|++.|...+
T Consensus         6 ~Ra~Ck~C~~~I~kg~   21 (82)
T PF00645_consen    6 GRAKCKGCKKKIAKGE   21 (82)
T ss_dssp             STEBETTTSCBE-TTS
T ss_pred             CCccCcccCCcCCCCC
Confidence            4457999999997555


No 38 
>KOG1813|consensus
Probab=57.76  E-value=6.6  Score=27.87  Aligned_cols=46  Identities=11%  Similarity=0.293  Sum_probs=34.2

Q ss_pred             cccccccCCCCCCCCceeccCCeeccHHHHhh-hCC-CCCCCCCCCCcchhh
Q psy4350          43 CLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQ-ARYPDLPIPKTLVSF   92 (107)
Q Consensus        43 Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~-~~C~~~~C~~~i~~~   92 (107)
                      -|.|..|++.....  ..-.-+.-||+.|..+ |.. +.|..  |++++.|.
T Consensus       241 Pf~c~icr~~f~~p--Vvt~c~h~fc~~ca~~~~qk~~~c~v--C~~~t~g~  288 (313)
T KOG1813|consen  241 PFKCFICRKYFYRP--VVTKCGHYFCEVCALKPYQKGEKCYV--CSQQTHGS  288 (313)
T ss_pred             Cccccccccccccc--hhhcCCceeehhhhccccccCCccee--cccccccc
Confidence            47788888776542  3445567789999988 663 69999  99998763


No 39 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=57.28  E-value=16  Score=19.58  Aligned_cols=29  Identities=28%  Similarity=0.503  Sum_probs=19.3

Q ss_pred             CCCccccccccccCceEEeecCcccccccccccccCCC
Q psy4350          15 EKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVP   52 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~   52 (107)
                      ..+.|..|+..|.+.+.         ---|.|..|+..
T Consensus         6 ~~~~CtSCg~~i~~~~~---------~~~F~CPnCG~~   34 (59)
T PRK14890          6 EPPKCTSCGIEIAPREK---------AVKFLCPNCGEV   34 (59)
T ss_pred             cCccccCCCCcccCCCc---------cCEeeCCCCCCe
Confidence            35679999998876641         122677777765


No 40 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=56.98  E-value=5.3  Score=24.91  Aligned_cols=21  Identities=33%  Similarity=1.064  Sum_probs=14.8

Q ss_pred             cccccCCCCCCCCceeccCCeeccHHH
Q psy4350          45 QCAHCHVPLHSELSCFSRHGNIYCKQD   71 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~~~~~~~C~~~   71 (107)
                      .|..|+.+|      +.++|.+||-.|
T Consensus        30 hCp~Cg~PL------F~KdG~v~CPvC   50 (131)
T COG1645          30 HCPKCGTPL------FRKDGEVFCPVC   50 (131)
T ss_pred             hCcccCCcc------eeeCCeEECCCC
Confidence            577888776      237889999444


No 41 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=55.80  E-value=5  Score=26.93  Aligned_cols=47  Identities=17%  Similarity=0.252  Sum_probs=34.3

Q ss_pred             ccccccccCCCCCCCCceeccCCeeccHHHHhh-hC-CCCCCCCCCCCcchhh
Q psy4350          42 GCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YS-QARYPDLPIPKTLVSF   92 (107)
Q Consensus        42 ~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~-~~~C~~~~C~~~i~~~   92 (107)
                      .-|.|..|.+....  ...-.-|.-||..|+.+ +. .+.|..  |++...|.
T Consensus       195 IPF~C~iCKkdy~s--pvvt~CGH~FC~~Cai~~y~kg~~C~~--Cgk~t~G~  243 (259)
T COG5152         195 IPFLCGICKKDYES--PVVTECGHSFCSLCAIRKYQKGDECGV--CGKATYGR  243 (259)
T ss_pred             Cceeehhchhhccc--hhhhhcchhHHHHHHHHHhccCCccee--cchhhccc
Confidence            35788888887655  23445667899999988 54 369999  99877653


No 42 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=55.28  E-value=7.4  Score=20.29  Aligned_cols=28  Identities=21%  Similarity=0.579  Sum_probs=14.4

Q ss_pred             cccccCCCCCCCCceeccCCeeccH-HHHh
Q psy4350          45 QCAHCHVPLHSELSCFSRHGNIYCK-QDFF   73 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~~~~~~~C~-~~y~   73 (107)
                      .|..|...+... ..+.++|+.||- .|-.
T Consensus         9 aC~~C~C~V~~~-~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen    9 ACPSCSCVVSEE-EAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             SSTT----B-TT-TSEESSS-EESSHHHHH
T ss_pred             cCCCCEeEECch-HhHHhCCEeeecHHHhc
Confidence            466677666644 567889999984 4443


No 43 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=55.19  E-value=5.6  Score=19.61  Aligned_cols=21  Identities=38%  Similarity=1.005  Sum_probs=11.9

Q ss_pred             cccccCCCCCCCCceeccCCeeccHH
Q psy4350          45 QCAHCHVPLHSELSCFSRHGNIYCKQ   70 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~~~~~~~C~~   70 (107)
                      .|..|+.+|-     ..+++++||-.
T Consensus        19 ~Cp~C~~PL~-----~~k~g~~~Cv~   39 (41)
T PF06677_consen   19 HCPDCGTPLM-----RDKDGKIYCVS   39 (41)
T ss_pred             ccCCCCCeeE-----EecCCCEECCC
Confidence            4556665552     23567777743


No 44 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=53.23  E-value=16  Score=18.36  Aligned_cols=29  Identities=10%  Similarity=0.199  Sum_probs=17.3

Q ss_pred             cccccCCCCCCCCcee--ccCCeeccHHHHhh
Q psy4350          45 QCAHCHVPLHSELSCF--SRHGNIYCKQDFFR   74 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~--~~~~~~~C~~~y~~   74 (107)
                      .|..|+..+... .+.  ...+..+|..||.+
T Consensus         2 ~C~~Cg~D~t~v-ryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRV-RYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCce-EEEecCCCccccChHHHhC
Confidence            466677666543 231  12335589999987


No 45 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=52.98  E-value=3.6  Score=24.36  Aligned_cols=28  Identities=18%  Similarity=0.509  Sum_probs=16.1

Q ss_pred             ccccccCCCCCCCCceeccCCeeccHHH
Q psy4350          44 LQCAHCHVPLHSELSCFSRHGNIYCKQD   71 (107)
Q Consensus        44 f~C~~C~~~l~~~~~~~~~~~~~~C~~~   71 (107)
                      |+|+.|-.---.+......++.++|..|
T Consensus        71 FTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   71 FTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             eeeeeeeeEechhhhccccCCCEecccc
Confidence            7777776322111123456788888776


No 46 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=51.01  E-value=20  Score=17.61  Aligned_cols=9  Identities=22%  Similarity=0.504  Sum_probs=6.3

Q ss_pred             eccHHHHhh
Q psy4350          66 IYCKQDFFR   74 (107)
Q Consensus        66 ~~C~~~y~~   74 (107)
                      -+|..||.+
T Consensus        28 dlC~~Cf~~   36 (44)
T smart00291       28 DLCQSCFAK   36 (44)
T ss_pred             cchHHHHhC
Confidence            358888765


No 47 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=50.37  E-value=9.1  Score=29.01  Aligned_cols=40  Identities=18%  Similarity=0.419  Sum_probs=29.2

Q ss_pred             CCCccccccccccCceEEeecCcccccccccccccCCCCCC
Q psy4350          15 EKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHS   55 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~   55 (107)
                      ....|..|-..+...+ +...++.-..+||.|..|...|..
T Consensus        25 ~~~yCp~CL~~~p~~e-~~~~~nrC~r~Cf~CP~C~~~L~~   64 (483)
T PF05502_consen   25 DSYYCPNCLFEVPSSE-ARSEKNRCSRNCFDCPICFSPLSV   64 (483)
T ss_pred             ceeECccccccCChhh-heeccceeccccccCCCCCCccee
Confidence            3455777777665554 555666677799999999999864


No 48 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=48.80  E-value=20  Score=17.73  Aligned_cols=8  Identities=13%  Similarity=0.588  Sum_probs=4.5

Q ss_pred             ccHHHHhh
Q psy4350          67 YCKQDFFR   74 (107)
Q Consensus        67 ~C~~~y~~   74 (107)
                      +|..||..
T Consensus        25 LC~~Cf~~   32 (46)
T cd02249          25 LCSSCYAK   32 (46)
T ss_pred             CHHHHHCc
Confidence            46666554


No 49 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=48.38  E-value=7.3  Score=22.92  Aligned_cols=36  Identities=25%  Similarity=0.392  Sum_probs=23.9

Q ss_pred             CccccccccccCceEEeecC-cccccccccccccCCC
Q psy4350          17 SSCGGCGQPIIDRFYLLAVD-RQWHLGCLQCAHCHVP   52 (107)
Q Consensus        17 ~~C~~C~~~i~~~~~~~~~~-~~~H~~Cf~C~~C~~~   52 (107)
                      -.|..|+++|..++...+-. .+-|-.||.-+.-+++
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~~~k~   43 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAESKRKKP   43 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHHHHhcCc
Confidence            46888888887777665533 3568788766554443


No 50 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=45.63  E-value=15  Score=19.53  Aligned_cols=25  Identities=20%  Similarity=0.456  Sum_probs=16.1

Q ss_pred             cccccCCCCC-CCCceeccCCeeccH
Q psy4350          45 QCAHCHVPLH-SELSCFSRHGNIYCK   69 (107)
Q Consensus        45 ~C~~C~~~l~-~~~~~~~~~~~~~C~   69 (107)
                      .|..|++.|. +...|.-++.+.||.
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS   43 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCS   43 (58)
T ss_pred             HHHccCCCCCCCCCeeeecccccccc
Confidence            4567778887 343555666677774


No 51 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=45.25  E-value=7.2  Score=18.52  Aligned_cols=30  Identities=23%  Similarity=0.698  Sum_probs=15.7

Q ss_pred             cccccccccCceEEeecCcccccccccccccCCCC
Q psy4350          19 CGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPL   53 (107)
Q Consensus        19 C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l   53 (107)
                      |..|.+.+.+.     .++.||-.-..|..|+-.+
T Consensus         2 C~~C~~Ey~~p-----~~RR~~~~~isC~~CGPr~   31 (35)
T PF07503_consen    2 CDDCLKEYFDP-----SNRRFHYQFISCTNCGPRY   31 (35)
T ss_dssp             -HHHHHHHCST-----TSTTTT-TT--BTTCC-SC
T ss_pred             CHHHHHHHcCC-----CCCcccCcCccCCCCCCCE
Confidence            45555544332     3677888888888888655


No 52 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=44.66  E-value=39  Score=16.38  Aligned_cols=30  Identities=20%  Similarity=0.396  Sum_probs=14.1

Q ss_pred             cccccCCCCCCCCceec-cCCeeccHHHHhh
Q psy4350          45 QCAHCHVPLHSELSCFS-RHGNIYCKQDFFR   74 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~~~-~~~~~~C~~~y~~   74 (107)
                      .|+.|+++-........ .++...|..|-..
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            46777776654323332 3355667777554


No 53 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=43.83  E-value=16  Score=18.32  Aligned_cols=13  Identities=31%  Similarity=0.731  Sum_probs=8.9

Q ss_pred             CCCCccccccccc
Q psy4350          14 EEKSSCGGCGQPI   26 (107)
Q Consensus        14 ~~~~~C~~C~~~i   26 (107)
                      ..+..|..|++.|
T Consensus         9 ~~~~~C~~C~~~i   21 (53)
T PF00130_consen    9 SKPTYCDVCGKFI   21 (53)
T ss_dssp             SSTEB-TTSSSBE
T ss_pred             CCCCCCcccCccc
Confidence            3456788898888


No 54 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=43.50  E-value=9.7  Score=19.79  Aligned_cols=29  Identities=31%  Similarity=0.560  Sum_probs=17.6

Q ss_pred             ccccccccccCceEEeecCcccccccccc
Q psy4350          18 SCGGCGQPIIDRFYLLAVDRQWHLGCLQC   46 (107)
Q Consensus        18 ~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C   46 (107)
                      .|+.|++.+.-.--.+..++.|-..|-.|
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiEDC~vC   30 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIEDCQVC   30 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEeehhhc
Confidence            58888887743211344566777777544


No 55 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=42.03  E-value=30  Score=18.59  Aligned_cols=28  Identities=21%  Similarity=0.457  Sum_probs=18.5

Q ss_pred             CCccccccccccCceEEeecCcccccccccccccCCC
Q psy4350          16 KSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVP   52 (107)
Q Consensus        16 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~   52 (107)
                      .+.|..|+..|.+.+.         -.-|.|..|+..
T Consensus         9 ~~~CtSCg~~i~p~e~---------~v~F~CPnCGe~   36 (61)
T COG2888           9 PPVCTSCGREIAPGET---------AVKFPCPNCGEV   36 (61)
T ss_pred             CceeccCCCEeccCCc---------eeEeeCCCCCce
Confidence            6789999998866542         122667777743


No 56 
>KOG0978|consensus
Probab=41.62  E-value=11  Score=29.91  Aligned_cols=43  Identities=19%  Similarity=0.583  Sum_probs=30.9

Q ss_pred             ccccccCCCCCCCCceeccCCeeccHHHHhh-hC--CCCCCCCCCCCcch
Q psy4350          44 LQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YS--QARYPDLPIPKTLV   90 (107)
Q Consensus        44 f~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~--~~~C~~~~C~~~i~   90 (107)
                      ++|+.|...+-+  .....-+.+||..|-.. +.  ..+|-.  |+.+..
T Consensus       644 LkCs~Cn~R~Kd--~vI~kC~H~FC~~Cvq~r~etRqRKCP~--Cn~aFg  689 (698)
T KOG0978|consen  644 LKCSVCNTRWKD--AVITKCGHVFCEECVQTRYETRQRKCPK--CNAAFG  689 (698)
T ss_pred             eeCCCccCchhh--HHHHhcchHHHHHHHHHHHHHhcCCCCC--CCCCCC
Confidence            578888865544  34566677899999876 55  358888  888764


No 57 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=40.93  E-value=28  Score=18.27  Aligned_cols=26  Identities=31%  Similarity=0.436  Sum_probs=16.1

Q ss_pred             CccccccccccCceEEeecCcccccc
Q psy4350          17 SSCGGCGQPIIDRFYLLAVDRQWHLG   42 (107)
Q Consensus        17 ~~C~~C~~~i~~~~~~~~~~~~~H~~   42 (107)
                      .+|..|+.+|.++..+...+..-|+.
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~g   27 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHPG   27 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCcH
Confidence            35778888887764455455555553


No 58 
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=40.75  E-value=11  Score=18.58  Aligned_cols=11  Identities=18%  Similarity=0.700  Sum_probs=4.3

Q ss_pred             cccccccccCc
Q psy4350          19 CGGCGQPIIDR   29 (107)
Q Consensus        19 C~~C~~~i~~~   29 (107)
                      |..|++.+.-+
T Consensus         1 C~~C~~iv~~G   11 (43)
T PF08746_consen    1 CEACKEIVTQG   11 (43)
T ss_dssp             -TTT-SB-SSS
T ss_pred             CcccchhHeee
Confidence            44566655544


No 59 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=40.57  E-value=32  Score=17.26  Aligned_cols=8  Identities=25%  Similarity=0.480  Sum_probs=4.7

Q ss_pred             ccHHHHhh
Q psy4350          67 YCKQDFFR   74 (107)
Q Consensus        67 ~C~~~y~~   74 (107)
                      +|.+||..
T Consensus        26 LC~~Cf~~   33 (49)
T cd02335          26 LCLECFSA   33 (49)
T ss_pred             hhHHhhhC
Confidence            46666654


No 60 
>PRK08359 transcription factor; Validated
Probab=39.75  E-value=30  Score=22.72  Aligned_cols=31  Identities=13%  Similarity=0.468  Sum_probs=18.6

Q ss_pred             cccccCCCCCCCCce-e-ccCCee-ccHHHHhhhC
Q psy4350          45 QCAHCHVPLHSELSC-F-SRHGNI-YCKQDFFRYS   76 (107)
Q Consensus        45 ~C~~C~~~l~~~~~~-~-~~~~~~-~C~~~y~~~~   76 (107)
                      .|..|+..+.+. .+ . ..+..+ .|..|+.+||
T Consensus         8 ~CEiCG~~i~g~-~~~v~ieGael~VC~~Ca~k~G   41 (176)
T PRK08359          8 YCEICGAEIRGP-GHRIRIEGAELLVCDRCYEKYG   41 (176)
T ss_pred             eeecCCCccCCC-CeEEEEcCeEEehHHHHHHHhC
Confidence            377888877654 22 2 223333 5888886666


No 61 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=38.64  E-value=19  Score=20.46  Aligned_cols=30  Identities=20%  Similarity=0.483  Sum_probs=18.5

Q ss_pred             cccccCCCCCCCC----ceeccCCeeccHHHHhh
Q psy4350          45 QCAHCHVPLHSEL----SCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        45 ~C~~C~~~l~~~~----~~~~~~~~~~C~~~y~~   74 (107)
                      .|..|+-+|....    ......+.-||.-||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            3677888876542    11223335689999886


No 62 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=38.31  E-value=57  Score=21.78  Aligned_cols=12  Identities=8%  Similarity=0.185  Sum_probs=7.7

Q ss_pred             CCCCCCCCCCcchh
Q psy4350          78 ARYPDLPIPKTLVS   91 (107)
Q Consensus        78 ~~C~~~~C~~~i~~   91 (107)
                      +.|-.  |...|..
T Consensus        69 ~~CPv--CR~~Is~   80 (193)
T PLN03208         69 PKCPV--CKSDVSE   80 (193)
T ss_pred             CcCCC--CCCcCCh
Confidence            36777  7777643


No 63 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=37.63  E-value=9.8  Score=17.99  Aligned_cols=15  Identities=33%  Similarity=1.099  Sum_probs=6.5

Q ss_pred             CCccccccccccCce
Q psy4350          16 KSSCGGCGQPIIDRF   30 (107)
Q Consensus        16 ~~~C~~C~~~i~~~~   30 (107)
                      .+.|..|+++..+.+
T Consensus         3 ~~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    3 YPKCDECGKPFMDSY   17 (34)
T ss_dssp             -EE-TTT--EES-SS
T ss_pred             CchHhHhCCHHHHHH
Confidence            346777777766654


No 64 
>PRK00420 hypothetical protein; Validated
Probab=37.41  E-value=16  Score=22.20  Aligned_cols=20  Identities=30%  Similarity=0.839  Sum_probs=10.8

Q ss_pred             ccccccCCCCCCCCceeccCCeecc
Q psy4350          44 LQCAHCHVPLHSELSCFSRHGNIYC   68 (107)
Q Consensus        44 f~C~~C~~~l~~~~~~~~~~~~~~C   68 (107)
                      -.|..|+.+|-     ...+|+.||
T Consensus        24 ~~CP~Cg~pLf-----~lk~g~~~C   43 (112)
T PRK00420         24 KHCPVCGLPLF-----ELKDGEVVC   43 (112)
T ss_pred             CCCCCCCCcce-----ecCCCceEC
Confidence            34566665542     225666666


No 65 
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=37.03  E-value=33  Score=21.88  Aligned_cols=30  Identities=13%  Similarity=0.363  Sum_probs=15.2

Q ss_pred             ccccCCCCCCCCceeccCC-ee-ccHHHHhhhC
Q psy4350          46 CAHCHVPLHSELSCFSRHG-NI-YCKQDFFRYS   76 (107)
Q Consensus        46 C~~C~~~l~~~~~~~~~~~-~~-~C~~~y~~~~   76 (107)
                      |..|++.+.+.-.....+| .+ .|..|+ +||
T Consensus         3 CEiCG~~i~~~~~~v~iega~l~vC~~C~-k~G   34 (154)
T TIGR00270         3 CEICGRKIKGKGFKIVIEGSEMTVCGECR-KFG   34 (154)
T ss_pred             cccCCCccCCCCeEEEEcCeEEehhhhHH-hcC
Confidence            6667766655411122222 22 577777 555


No 66 
>PRK00019 rpmE 50S ribosomal protein L31; Reviewed
Probab=36.78  E-value=18  Score=20.11  Aligned_cols=8  Identities=38%  Similarity=0.783  Sum_probs=5.3

Q ss_pred             cCCCCcCC
Q psy4350         100 ASEPLLTG  107 (107)
Q Consensus       100 ~~~p~~~~  107 (107)
                      ..||+.||
T Consensus        40 ~~HPFyTG   47 (72)
T PRK00019         40 KCHPFYTG   47 (72)
T ss_pred             CCCCcCcC
Confidence            46777776


No 67 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=35.90  E-value=22  Score=22.85  Aligned_cols=10  Identities=10%  Similarity=-0.077  Sum_probs=5.1

Q ss_pred             CCCCCCCCCcch
Q psy4350          79 RYPDLPIPKTLV   90 (107)
Q Consensus        79 ~C~~~~C~~~i~   90 (107)
                      -|..  |+++-.
T Consensus        70 YC~~--CGkpyP   79 (158)
T PF10083_consen   70 YCHN--CGKPYP   79 (158)
T ss_pred             hHHh--CCCCCc
Confidence            4555  555543


No 68 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=35.50  E-value=58  Score=15.70  Aligned_cols=39  Identities=15%  Similarity=0.410  Sum_probs=21.3

Q ss_pred             ccccCCCCC-CCCceeccCCeeccHHHHhh-h-CCCCCCCCCCC
Q psy4350          46 CAHCHVPLH-SELSCFSRHGNIYCKQDFFR-Y-SQARYPDLPIP   86 (107)
Q Consensus        46 C~~C~~~l~-~~~~~~~~~~~~~C~~~y~~-~-~~~~C~~~~C~   86 (107)
                      |..|..... ....+...=+.++|..|..+ . ....|-.  |+
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~--C~   43 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPI--CR   43 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcC--CC
Confidence            444555442 11134555667788888777 5 1136665  54


No 69 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=34.84  E-value=22  Score=21.33  Aligned_cols=29  Identities=28%  Similarity=0.496  Sum_probs=17.8

Q ss_pred             CCCCCCCCCCCCCCCCccccccccccCce
Q psy4350           2 LKDRDDSSSPCPEEKSSCGGCGQPIIDRF   30 (107)
Q Consensus         2 ~~~~~~~~~~~~~~~~~C~~C~~~i~~~~   30 (107)
                      |++-+..-.-..-+...|+.|+..+...+
T Consensus        35 Ln~~~LdyV~ie~G~t~CP~Cg~~~e~~f   63 (115)
T COG1885          35 LNKPDLDYVEIEVGSTSCPKCGEPFESAF   63 (115)
T ss_pred             hccCCCCeEEEecccccCCCCCCccceeE
Confidence            33334444444556677999988876654


No 70 
>KOG4739|consensus
Probab=34.01  E-value=28  Score=23.95  Aligned_cols=31  Identities=10%  Similarity=0.164  Sum_probs=23.5

Q ss_pred             ceeccCCeeccHHHHhh-hCCCCCCCCCCCCcchh
Q psy4350          58 SCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLVS   91 (107)
Q Consensus        58 ~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~~   91 (107)
                      .|.-.-..++|..|... .+ ..|..  |+++|..
T Consensus        18 f~LTaC~HvfC~~C~k~~~~-~~C~l--Ckk~ir~   49 (233)
T KOG4739|consen   18 FFLTACRHVFCEPCLKASSP-DVCPL--CKKSIRI   49 (233)
T ss_pred             eeeeechhhhhhhhcccCCc-ccccc--ccceeee
Confidence            44555668899999877 77 58999  9998764


No 71 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=33.43  E-value=55  Score=14.85  Aligned_cols=24  Identities=13%  Similarity=0.383  Sum_probs=12.2

Q ss_pred             CCeeccHHHHhh-hC--CCCCCCCCCCCc
Q psy4350          63 HGNIYCKQDFFR-YS--QARYPDLPIPKT   88 (107)
Q Consensus        63 ~~~~~C~~~y~~-~~--~~~C~~~~C~~~   88 (107)
                      -+..||..|..+ +.  ...|-.  |+..
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~--C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPL--CRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCC--CCCc
Confidence            445566666654 32  134655  5543


No 72 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=33.32  E-value=35  Score=16.90  Aligned_cols=9  Identities=22%  Similarity=0.501  Sum_probs=6.7

Q ss_pred             eccHHHHhh
Q psy4350          66 IYCKQDFFR   74 (107)
Q Consensus        66 ~~C~~~y~~   74 (107)
                      -+|..||.+
T Consensus        29 dLC~~C~~~   37 (46)
T PF00569_consen   29 DLCEDCFSK   37 (46)
T ss_dssp             EEEHHHHHH
T ss_pred             chhhHHHhC
Confidence            458888876


No 73 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=33.19  E-value=46  Score=16.72  Aligned_cols=10  Identities=20%  Similarity=0.328  Sum_probs=4.5

Q ss_pred             CeeccHHHHh
Q psy4350          64 GNIYCKQDFF   73 (107)
Q Consensus        64 ~~~~C~~~y~   73 (107)
                      ++..|..|-.
T Consensus        17 ~~fIC~~CE~   26 (46)
T PF10764_consen   17 GKFICSDCEK   26 (46)
T ss_pred             CeEehHHHHH
Confidence            3444544443


No 74 
>KOG3002|consensus
Probab=32.95  E-value=48  Score=23.62  Aligned_cols=46  Identities=20%  Similarity=0.377  Sum_probs=34.7

Q ss_pred             cccccccCCCCCCCCceeccCCeeccHHHHhhhCCCCCCCCCCCCcchhh
Q psy4350          43 CLQCAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQARYPDLPIPKTLVSF   92 (107)
Q Consensus        43 Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~~~~~~C~~~~C~~~i~~~   92 (107)
                      =+.|..|...|... .+.-.+|.+.|..|-.+.. .+|-.  |..+|...
T Consensus        48 lleCPvC~~~l~~P-i~QC~nGHlaCssC~~~~~-~~CP~--Cr~~~g~~   93 (299)
T KOG3002|consen   48 LLDCPVCFNPLSPP-IFQCDNGHLACSSCRTKVS-NKCPT--CRLPIGNI   93 (299)
T ss_pred             hccCchhhccCccc-ceecCCCcEehhhhhhhhc-ccCCc--cccccccH
Confidence            46777778777765 6777888999999986633 28888  98888753


No 75 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=32.94  E-value=22  Score=21.13  Aligned_cols=33  Identities=15%  Similarity=0.412  Sum_probs=22.9

Q ss_pred             cccccccccccccCCCCCCCCceeccCCeeccHHHHhh
Q psy4350          37 RQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        37 ~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~   74 (107)
                      ..+...-=.|..|    ++. .|++.++.+.|..|-.+
T Consensus        29 g~~~va~daCeiC----~~~-GY~q~g~~lvC~~C~~~   61 (102)
T PF10080_consen   29 GSYRVAFDACEIC----GPK-GYYQEGDQLVCKNCGVR   61 (102)
T ss_pred             CCEEEEEEecccc----CCC-ceEEECCEEEEecCCCE
Confidence            3444444467777    344 78899999999999654


No 76 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=32.79  E-value=64  Score=18.30  Aligned_cols=23  Identities=9%  Similarity=0.086  Sum_probs=10.0

Q ss_pred             eeccHHHHhh---hCCCCCCCCCCCCcc
Q psy4350          65 NIYCKQDFFR---YSQARYPDLPIPKTL   89 (107)
Q Consensus        65 ~~~C~~~y~~---~~~~~C~~~~C~~~i   89 (107)
                      -+.|+.||..   -+.+.|-+  |+..-
T Consensus        36 fPvCr~CyEYErkeg~q~Cpq--Ckt~y   61 (80)
T PF14569_consen   36 FPVCRPCYEYERKEGNQVCPQ--CKTRY   61 (80)
T ss_dssp             ----HHHHHHHHHTS-SB-TT--T--B-
T ss_pred             CccchhHHHHHhhcCcccccc--cCCCc
Confidence            4569999863   45567888  87653


No 77 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=32.22  E-value=62  Score=15.05  Aligned_cols=27  Identities=19%  Similarity=0.389  Sum_probs=16.0

Q ss_pred             cccCCCCCCCCceeccCCeeccHHHHhh
Q psy4350          47 AHCHVPLHSELSCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        47 ~~C~~~l~~~~~~~~~~~~~~C~~~y~~   74 (107)
                      ..|...+... .....=|..||..|..+
T Consensus         2 ~iC~~~~~~~-~~~~~CGH~fC~~C~~~   28 (39)
T PF13923_consen    2 PICLDELRDP-VVVTPCGHSFCKECIEK   28 (39)
T ss_dssp             TTTTSB-SSE-EEECTTSEEEEHHHHHH
T ss_pred             CCCCCcccCc-CEECCCCCchhHHHHHH
Confidence            3444444442 24566778888888776


No 78 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=31.49  E-value=22  Score=20.61  Aligned_cols=12  Identities=8%  Similarity=-0.014  Sum_probs=8.0

Q ss_pred             CCCCCCCCCCcchh
Q psy4350          78 ARYPDLPIPKTLVS   91 (107)
Q Consensus        78 ~~C~~~~C~~~i~~   91 (107)
                      .+|..  |+.+|.-
T Consensus        59 GrCr~--C~~~I~~   70 (92)
T PF06750_consen   59 GRCRY--CGAPIPP   70 (92)
T ss_pred             CCCcc--cCCCCCh
Confidence            37777  7777754


No 79 
>PRK01397 50S ribosomal protein L31; Provisional
Probab=31.33  E-value=25  Score=19.91  Aligned_cols=9  Identities=11%  Similarity=0.102  Sum_probs=5.9

Q ss_pred             ccCCCCcCC
Q psy4350          99 AASEPLLTG  107 (107)
Q Consensus        99 ~~~~p~~~~  107 (107)
                      ...||+.||
T Consensus        38 s~~HPFyTG   46 (78)
T PRK01397         38 FRKHPAWNK   46 (78)
T ss_pred             CCCCCcCcC
Confidence            346777776


No 80 
>PRK03922 hypothetical protein; Provisional
Probab=31.13  E-value=32  Score=20.78  Aligned_cols=29  Identities=24%  Similarity=0.426  Sum_probs=18.8

Q ss_pred             CCCCCCCCCCCCCCCCccccccccccCce
Q psy4350           2 LKDRDDSSSPCPEEKSSCGGCGQPIIDRF   30 (107)
Q Consensus         2 ~~~~~~~~~~~~~~~~~C~~C~~~i~~~~   30 (107)
                      |+..+....-.+-+...|+.|++++.+..
T Consensus        35 Ln~~~l~yVeievG~~~cP~cge~~~~af   63 (113)
T PRK03922         35 LNPEDLDYVEVEVGLTICPKCGEPFDSAF   63 (113)
T ss_pred             cCcccCCeEEEecCcccCCCCCCcCCcEE
Confidence            33434444445567778999999886654


No 81 
>PRK01678 rpmE2 50S ribosomal protein L31 type B; Reviewed
Probab=31.06  E-value=25  Score=20.36  Aligned_cols=15  Identities=0%  Similarity=-0.018  Sum_probs=8.7

Q ss_pred             cccccccccccCCCC
Q psy4350          39 WHLGCLQCAHCHVPL   53 (107)
Q Consensus        39 ~H~~Cf~C~~C~~~l   53 (107)
                      |+.-.|.|..|+..+
T Consensus         9 y~~v~~~~~t~g~~f   23 (87)
T PRK01678          9 YRPVVFHDTSTGFKF   23 (87)
T ss_pred             CEEEEEEECCCCCEE
Confidence            455566666666544


No 82 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=30.79  E-value=33  Score=16.95  Aligned_cols=26  Identities=31%  Similarity=0.599  Sum_probs=14.9

Q ss_pred             cccccccccCceEEe--ecCcccccccc
Q psy4350          19 CGGCGQPIIDRFYLL--AVDRQWHLGCL   44 (107)
Q Consensus        19 C~~C~~~i~~~~~~~--~~~~~~H~~Cf   44 (107)
                      |..|++.-.+..++.  .-++.||..|.
T Consensus         2 C~vC~~~~~~~~~i~C~~C~~~~H~~C~   29 (51)
T PF00628_consen    2 CPVCGQSDDDGDMIQCDSCNRWYHQECV   29 (51)
T ss_dssp             BTTTTSSCTTSSEEEBSTTSCEEETTTS
T ss_pred             CcCCCCcCCCCCeEEcCCCChhhCcccC
Confidence            556666444444443  23467888775


No 83 
>KOG2893|consensus
Probab=29.85  E-value=13  Score=25.77  Aligned_cols=38  Identities=26%  Similarity=0.467  Sum_probs=24.0

Q ss_pred             CCccccccccccCceEEeecCcccccccccccccCCCCCCC
Q psy4350          16 KSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSE   56 (107)
Q Consensus        16 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   56 (107)
                      .+-|-.|+....+..++..-.+.   ..|+|..|.+.|...
T Consensus        10 kpwcwycnrefddekiliqhqka---khfkchichkkl~sg   47 (341)
T KOG2893|consen   10 KPWCWYCNREFDDEKILIQHQKA---KHFKCHICHKKLFSG   47 (341)
T ss_pred             Cceeeecccccchhhhhhhhhhh---ccceeeeehhhhccC
Confidence            34588888887666433222222   358889999887543


No 84 
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=29.76  E-value=22  Score=23.25  Aligned_cols=34  Identities=21%  Similarity=0.358  Sum_probs=21.2

Q ss_pred             ccccccccccCCCCCCCCceeccCCeeccHHHHhh
Q psy4350          40 HLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR   74 (107)
Q Consensus        40 H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~   74 (107)
                      |..|++|..-....+.. .++.-+.+++|..|..-
T Consensus       136 ~~kC~QC~~~~~~~~~~-~~~~F~~~lFC~~ClFP  169 (173)
T PF11077_consen  136 YDKCVQCSQKCENVGAK-IFTYFNFNLFCKNCLFP  169 (173)
T ss_pred             ccccCcCCCCcccccce-eEEecChhhcccccCcc
Confidence            34566665543333333 36777889999988764


No 85 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=29.67  E-value=33  Score=21.48  Aligned_cols=36  Identities=17%  Similarity=0.158  Sum_probs=18.6

Q ss_pred             CCccccccccccCceEEeec------CcccccccccccccCC
Q psy4350          16 KSSCGGCGQPIIDRFYLLAV------DRQWHLGCLQCAHCHV   51 (107)
Q Consensus        16 ~~~C~~C~~~i~~~~~~~~~------~~~~H~~Cf~C~~C~~   51 (107)
                      ..+|..||..+.....-.+.      -...+...+.|..|++
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~k  132 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGK  132 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCC
Confidence            56788888866322111111      1112444667777775


No 86 
>CHL00136 rpl31 ribosomal protein L31; Validated
Probab=28.43  E-value=26  Score=19.24  Aligned_cols=7  Identities=43%  Similarity=0.952  Sum_probs=4.4

Q ss_pred             CCCCcCC
Q psy4350         101 SEPLLTG  107 (107)
Q Consensus       101 ~~p~~~~  107 (107)
                      .||+.||
T Consensus        41 ~HPfyTG   47 (68)
T CHL00136         41 NHPFYTG   47 (68)
T ss_pred             CCccCcC
Confidence            5666665


No 87 
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=28.27  E-value=68  Score=16.20  Aligned_cols=8  Identities=13%  Similarity=0.567  Sum_probs=5.2

Q ss_pred             ccHHHHhh
Q psy4350          67 YCKQDFFR   74 (107)
Q Consensus        67 ~C~~~y~~   74 (107)
                      +|..||.+
T Consensus        28 lC~~C~~~   35 (48)
T cd02341          28 LCQDCVVK   35 (48)
T ss_pred             cCHHHHhC
Confidence            47777665


No 89 
>PLN02195 cellulose synthase A
Probab=28.26  E-value=55  Score=27.25  Aligned_cols=53  Identities=13%  Similarity=0.262  Sum_probs=30.0

Q ss_pred             CCCCccccccccccCceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHh--h-hCCCCCCCCCCCCcch
Q psy4350          14 EEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFF--R-YSQARYPDLPIPKTLV   90 (107)
Q Consensus        14 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~--~-~~~~~C~~~~C~~~i~   90 (107)
                      ++...|.-|+..|.    +...|..|    -.|..|+-              +.|++||+  + -|.+.|-+  |+..-.
T Consensus         4 ~~~~~c~~cgd~~~----~~~~g~~f----vaC~eC~~--------------pvCrpCyeyer~eg~q~Cpq--Ckt~Yk   59 (977)
T PLN02195          4 SGAPICATCGEEVG----VDSNGEAF----VACHECSY--------------PLCKACLEYEIKEGRKVCLR--CGGPYD   59 (977)
T ss_pred             CCCccceecccccC----cCCCCCeE----EEeccCCC--------------ccccchhhhhhhcCCccCCc--cCCccc
Confidence            44567888877663    23345444    23444432              34777775  3 44567888  876654


No 90 
>COG0254 RpmE Ribosomal protein L31 [Translation, ribosomal structure and biogenesis]
Probab=27.69  E-value=31  Score=19.37  Aligned_cols=10  Identities=30%  Similarity=0.597  Sum_probs=6.4

Q ss_pred             cccCCCCcCC
Q psy4350          98 GAASEPLLTG  107 (107)
Q Consensus        98 g~~~~p~~~~  107 (107)
                      -...||+.||
T Consensus        40 ~s~~HPFyTG   49 (75)
T COG0254          40 CSKCHPFYTG   49 (75)
T ss_pred             CCCCCCcCcC
Confidence            3446777776


No 91 
>PF12773 DZR:  Double zinc ribbon
Probab=27.47  E-value=85  Score=15.42  Aligned_cols=13  Identities=31%  Similarity=0.871  Sum_probs=6.5

Q ss_pred             CCCcccccccccc
Q psy4350          15 EKSSCGGCGQPII   27 (107)
Q Consensus        15 ~~~~C~~C~~~i~   27 (107)
                      ....|..|+..+.
T Consensus        11 ~~~fC~~CG~~l~   23 (50)
T PF12773_consen   11 DAKFCPHCGTPLP   23 (50)
T ss_pred             cccCChhhcCChh
Confidence            3444555555444


No 92 
>PF14149 YhfH:  YhfH-like protein
Probab=27.16  E-value=16  Score=17.63  Aligned_cols=20  Identities=20%  Similarity=0.419  Sum_probs=14.7

Q ss_pred             HHhh-hCCCCCCCCCCCCcchhh
Q psy4350          71 DFFR-YSQARYPDLPIPKTLVSF   92 (107)
Q Consensus        71 ~y~~-~~~~~C~~~~C~~~i~~~   92 (107)
                      .|.+ ++.+.|..  |++.|...
T Consensus         6 eFfrnLp~K~C~~--CG~~i~EQ   26 (37)
T PF14149_consen    6 EFFRNLPPKKCTE--CGKEIEEQ   26 (37)
T ss_pred             HHHHhCCCcccHH--HHHHHHHH
Confidence            4566 66688999  99888653


No 93 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=26.34  E-value=41  Score=15.60  Aligned_cols=7  Identities=14%  Similarity=0.344  Sum_probs=3.0

Q ss_pred             cCCeecc
Q psy4350          62 RHGNIYC   68 (107)
Q Consensus        62 ~~~~~~C   68 (107)
                      .++..+|
T Consensus        18 ~~~~~~C   24 (33)
T PF08792_consen   18 EDDYEVC   24 (33)
T ss_pred             cCCeEEc
Confidence            3444444


No 94 
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=25.37  E-value=39  Score=20.09  Aligned_cols=25  Identities=20%  Similarity=0.371  Sum_probs=16.8

Q ss_pred             CCCCCCCCCCCCccccccccccCce
Q psy4350           6 DDSSSPCPEEKSSCGGCGQPIIDRF   30 (107)
Q Consensus         6 ~~~~~~~~~~~~~C~~C~~~i~~~~   30 (107)
                      +....-.+.+...|+.|++++....
T Consensus        37 ~~~~VeIevG~~~cP~Cge~~~~a~   61 (102)
T PF04475_consen   37 DLDYVEIEVGDTICPKCGEELDSAF   61 (102)
T ss_pred             CCCeEEEecCcccCCCCCCccCceE
Confidence            3444445567778999999887654


No 95 
>PLN00162 transport protein sec23; Provisional
Probab=24.67  E-value=1.2e+02  Score=24.51  Aligned_cols=34  Identities=18%  Similarity=0.451  Sum_probs=22.6

Q ss_pred             CCCCCccccccccccCceEEeecCcccccccccccccCC
Q psy4350          13 PEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHV   51 (107)
Q Consensus        13 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~   51 (107)
                      +..+.+|.+|+..|.+--.+...++.|     +|..|..
T Consensus        50 ~~~pvRC~~CraylNPf~~~d~~~~~W-----~C~~C~~   83 (761)
T PLN00162         50 PYDPLRCRTCRAVLNPYCRVDFQAKIW-----ICPFCFQ   83 (761)
T ss_pred             CCCCCccCCCcCEECCceEEecCCCEE-----EccCCCC
Confidence            446788999999887754455556666     5555554


No 96 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=24.67  E-value=43  Score=17.96  Aligned_cols=13  Identities=31%  Similarity=0.588  Sum_probs=7.5

Q ss_pred             CCccccccccccC
Q psy4350          16 KSSCGGCGQPIID   28 (107)
Q Consensus        16 ~~~C~~C~~~i~~   28 (107)
                      +.+|..|+++|.+
T Consensus         4 PVRCFTCGkvi~~   16 (60)
T PF01194_consen    4 PVRCFTCGKVIGN   16 (60)
T ss_dssp             SSS-STTTSBTCG
T ss_pred             ceecCCCCCChhH
Confidence            4567777777643


No 97 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=24.40  E-value=56  Score=25.90  Aligned_cols=9  Identities=22%  Similarity=0.434  Sum_probs=4.6

Q ss_pred             ccccccccc
Q psy4350          18 SCGGCGQPI   26 (107)
Q Consensus        18 ~C~~C~~~i   26 (107)
                      .|..|+..+
T Consensus         3 ~Cp~Cg~~n   11 (645)
T PRK14559          3 ICPQCQFEN   11 (645)
T ss_pred             cCCCCCCcC
Confidence            455555544


No 98 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=24.37  E-value=37  Score=16.45  Aligned_cols=9  Identities=33%  Similarity=0.947  Sum_probs=3.7

Q ss_pred             cccccCCCC
Q psy4350          45 QCAHCHVPL   53 (107)
Q Consensus        45 ~C~~C~~~l   53 (107)
                      .|..|+..|
T Consensus        21 vC~~CG~Vl   29 (43)
T PF08271_consen   21 VCPNCGLVL   29 (43)
T ss_dssp             EETTT-BBE
T ss_pred             ECCCCCCEe
Confidence            444554444


No 99 
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit
Probab=24.26  E-value=1.1e+02  Score=25.90  Aligned_cols=21  Identities=14%  Similarity=0.477  Sum_probs=12.9

Q ss_pred             CCCccccccccccCceEEeecCccc
Q psy4350          15 EKSSCGGCGQPIIDRFYLLAVDRQW   39 (107)
Q Consensus        15 ~~~~C~~C~~~i~~~~~~~~~~~~~   39 (107)
                      ....|.-|+..|.    +.+.|..|
T Consensus        14 ~~~~c~iCGd~vg----~~~~Ge~F   34 (1044)
T PLN02915         14 DAKTCRVCGDEVG----VKEDGQPF   34 (1044)
T ss_pred             CcchhhccccccC----cCCCCCEE
Confidence            4567888888763    23445554


No 100
>TIGR00105 L31 ribosomal protein L31. This family consists exclusively of bacterial (and organellar) 50S ribosomal protein L31. In some species, such as Bacillus subtilis, this protein exists in two forms (RpmE and YtiA), one of which (RpmE) contains a pair of motifs, CXC and CXXC, for binding zinc.
Probab=24.15  E-value=34  Score=18.68  Aligned_cols=9  Identities=33%  Similarity=0.737  Sum_probs=5.4

Q ss_pred             ccCCCCcCC
Q psy4350          99 AASEPLLTG  107 (107)
Q Consensus        99 ~~~~p~~~~  107 (107)
                      ...||+.||
T Consensus        39 s~~HPfyTG   47 (68)
T TIGR00105        39 SKCHPFYTG   47 (68)
T ss_pred             CCCcccCCC
Confidence            346677665


No 101
>PF01197 Ribosomal_L31:  Ribosomal protein L31;  InterPro: IPR002150 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L31 is one of the proteins from the large ribosomal subunit. L31 is a protein of 66 to 97 amino-acid residues which has only been found so far in bacteria and in some plant and algal chloroplasts.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3D5D_4 3PYO_1 3D5B_4 3PYV_1 3PYT_1 3MRZ_1 3MS1_1 3PYR_1 3F1F_4 3F1H_4 ....
Probab=23.16  E-value=40  Score=18.44  Aligned_cols=7  Identities=43%  Similarity=0.914  Sum_probs=4.2

Q ss_pred             CCCCcCC
Q psy4350         101 SEPLLTG  107 (107)
Q Consensus       101 ~~p~~~~  107 (107)
                      .||+.||
T Consensus        42 ~HPfytG   48 (69)
T PF01197_consen   42 CHPFYTG   48 (69)
T ss_dssp             SSCTTCS
T ss_pred             CCEEEcC
Confidence            4666665


No 102
>COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 [Transcription]
Probab=23.12  E-value=76  Score=20.65  Aligned_cols=30  Identities=10%  Similarity=0.404  Sum_probs=15.7

Q ss_pred             ccccCCCCCCCCceeccCCee-ccHHHHhhhC
Q psy4350          46 CAHCHVPLHSELSCFSRHGNI-YCKQDFFRYS   76 (107)
Q Consensus        46 C~~C~~~l~~~~~~~~~~~~~-~C~~~y~~~~   76 (107)
                      |..|++...........+..+ .|..|+ +||
T Consensus         6 CEiCG~~i~~~~~v~vegsel~VC~~Ca-k~G   36 (165)
T COG1813           6 CELCGREIDKPIKVKVEGAELTVCDDCA-KFG   36 (165)
T ss_pred             eeccccccCCCeeEEeecceeehhHHHH-Hhc
Confidence            666776665331222333333 577777 555


No 103
>PRK00807 50S ribosomal protein L24e; Validated
Probab=23.01  E-value=53  Score=16.90  Aligned_cols=24  Identities=17%  Similarity=0.169  Sum_probs=14.4

Q ss_pred             CccccccccccCceE---EeecCcccc
Q psy4350          17 SSCGGCGQPIIDRFY---LLAVDRQWH   40 (107)
Q Consensus        17 ~~C~~C~~~i~~~~~---~~~~~~~~H   40 (107)
                      ..|..|+..|+++.-   +...|+.|.
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~   28 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILY   28 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEE
Confidence            458888888874432   234455554


No 104
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=22.29  E-value=23  Score=15.68  Aligned_cols=12  Identities=33%  Similarity=0.564  Sum_probs=6.0

Q ss_pred             CccccccccccC
Q psy4350          17 SSCGGCGQPIID   28 (107)
Q Consensus        17 ~~C~~C~~~i~~   28 (107)
                      ..|.+|+..|..
T Consensus         2 ~~C~rC~~~~~~   13 (30)
T PF06827_consen    2 EKCPRCWNYIED   13 (30)
T ss_dssp             SB-TTT--BBEE
T ss_pred             CcCccCCCcceE
Confidence            358888887644


No 105
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=21.92  E-value=46  Score=16.32  Aligned_cols=9  Identities=33%  Similarity=1.232  Sum_probs=5.1

Q ss_pred             ccccccccc
Q psy4350          18 SCGGCGQPI   26 (107)
Q Consensus        18 ~C~~C~~~i   26 (107)
                      +|..|+..+
T Consensus         5 ~C~~CG~~~   13 (46)
T PRK00398          5 KCARCGREV   13 (46)
T ss_pred             ECCCCCCEE
Confidence            466666644


No 106
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=21.87  E-value=13  Score=19.21  Aligned_cols=10  Identities=40%  Similarity=1.089  Sum_probs=4.4

Q ss_pred             cccccCCCCC
Q psy4350          45 QCAHCHVPLH   54 (107)
Q Consensus        45 ~C~~C~~~l~   54 (107)
                      +|..|...|.
T Consensus        24 ~C~gC~~~l~   33 (56)
T PF02591_consen   24 TCSGCHMELP   33 (56)
T ss_pred             ccCCCCEEcC
Confidence            3444444443


No 107
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=21.72  E-value=1.4e+02  Score=25.33  Aligned_cols=15  Identities=20%  Similarity=0.441  Sum_probs=9.9

Q ss_pred             CCCCCCccccccccc
Q psy4350          12 CPEEKSSCGGCGQPI   26 (107)
Q Consensus        12 ~~~~~~~C~~C~~~i   26 (107)
                      .......|.-|+..|
T Consensus        13 ~~~~~qiCqICGD~v   27 (1079)
T PLN02638         13 KHGGGQVCQICGDNV   27 (1079)
T ss_pred             cccCCceeeeccccc
Confidence            344455788888766


No 108
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=20.83  E-value=1.5e+02  Score=15.69  Aligned_cols=42  Identities=17%  Similarity=0.331  Sum_probs=22.1

Q ss_pred             ccccCCCCCCCC--ceeccCCeeccHHHHhh-hCCCCCCCCCCCCcch
Q psy4350          46 CAHCHVPLHSEL--SCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLV   90 (107)
Q Consensus        46 C~~C~~~l~~~~--~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~   90 (107)
                      |..|.+.|....  .++-.-.=-||.+|-.. +. ..|-.  |++.++
T Consensus         8 CE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~-~~CPN--CgGelv   52 (57)
T PF06906_consen    8 CECCDKDLPPDSPEAYICSFECTFCADCAETMLN-GVCPN--CGGELV   52 (57)
T ss_pred             ccccCCCCCCCCCcceEEeEeCcccHHHHHHHhc-CcCcC--CCCccc
Confidence            455555554321  22222223367777777 66 47777  776654


No 109
>KOG3497|consensus
Probab=20.63  E-value=32  Score=18.52  Aligned_cols=12  Identities=42%  Similarity=0.700  Sum_probs=7.0

Q ss_pred             CccccccccccC
Q psy4350          17 SSCGGCGQPIID   28 (107)
Q Consensus        17 ~~C~~C~~~i~~   28 (107)
                      .+|..|++.|.+
T Consensus         5 iRCFtCGKvig~   16 (69)
T KOG3497|consen    5 IRCFTCGKVIGD   16 (69)
T ss_pred             eEeeeccccccc
Confidence            456666666644


No 110
>PRK14873 primosome assembly protein PriA; Provisional
Probab=20.43  E-value=68  Score=25.52  Aligned_cols=27  Identities=19%  Similarity=-0.003  Sum_probs=19.2

Q ss_pred             eeccCCeeccHHHHhh-hCCCCCCCCCCCCc
Q psy4350          59 CFSRHGNIYCKQDFFR-YSQARYPDLPIPKT   88 (107)
Q Consensus        59 ~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~   88 (107)
                      +....+.+.|.-|-.. .. ..|..  |+..
T Consensus       404 ~h~~~~~l~Ch~CG~~~~p-~~Cp~--Cgs~  431 (665)
T PRK14873        404 LPSAGGTPRCRWCGRAAPD-WRCPR--CGSD  431 (665)
T ss_pred             EecCCCeeECCCCcCCCcC-ccCCC--CcCC
Confidence            3344567889888666 54 68999  9875


No 111
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=20.08  E-value=41  Score=18.19  Aligned_cols=13  Identities=31%  Similarity=0.580  Sum_probs=8.5

Q ss_pred             CCccccccccccC
Q psy4350          16 KSSCGGCGQPIID   28 (107)
Q Consensus        16 ~~~C~~C~~~i~~   28 (107)
                      +.+|..|+++|.+
T Consensus         4 PiRCFsCGkvi~~   16 (63)
T COG1644           4 PVRCFSCGKVIGH   16 (63)
T ss_pred             ceEeecCCCCHHH
Confidence            4567777777743


Done!