Query         psy4369
Match_columns 71
No_of_seqs    101 out of 152
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:44:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4369.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4369hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0170|consensus               99.9 3.2E-25 6.9E-30  174.7   1.8   69    1-69    165-234 (621)
  2 KOG0942|consensus               83.8    0.84 1.8E-05   39.4   2.3   22    4-25    598-619 (1001)
  3 PF07817 GLE1:  GLE1-like prote  30.8      21 0.00045   25.7   0.5   13    4-16    128-140 (256)
  4 KOG2412|consensus               26.6      30 0.00066   28.7   0.8   16    3-18    428-443 (591)
  5 COG4040 Predicted membrane pro  24.0      72  0.0016   20.2   2.0   22   17-38     26-47  (85)
  6 KOG0170|consensus               22.9      17 0.00037   30.2  -1.2   42    1-42    157-198 (621)
  7 PF12243 CTK3:  CTD kinase subu  22.0      60  0.0013   21.9   1.5   11   15-25      3-13  (139)
  8 PF09029 Preseq_ALAS:  5-aminol  20.8      32 0.00069   22.4  -0.1    8    6-13      7-14  (107)
  9 COG5021 HUL4 Ubiquitin-protein  18.9     5.8 0.00013   34.0  -4.8   35    7-41    442-476 (872)
 10 PF02865 STAT_int:  STAT protei  16.8      73  0.0016   20.9   1.0   18    5-22     16-33  (124)

No 1  
>KOG0170|consensus
Probab=99.90  E-value=3.2e-25  Score=174.69  Aligned_cols=69  Identities=30%  Similarity=0.520  Sum_probs=63.4

Q ss_pred             CchHHhhhhCCceeeHHHHHHHHHHhhcchhHHHHHHHhhCC-cCCCCCCCCcccCCCcCceeEEeeCCC
Q psy4369           1 MVTEHLATTCPFLLNFEIRQLLLYASSFDRDRALQRLVDSTP-EINNHSDTQERVTPRLDRRKRTVSRQG   69 (71)
Q Consensus         1 ~W~~~L~~~cpFLFPFetR~~~f~~TsFG~~R~i~~~q~~~~-~~~~~~~~~~~~~gRl~R~KvrVsR~~   69 (71)
                      +||.+|++.|||||||+||++||||||||++|+||+||+.+. +.+++.++...++|||+|||+||+|++
T Consensus       165 ~w~~~L~~~cpfLfpf~Tr~~~f~~taFg~~R~~~~~k~~s~~~~~~s~~e~~~~~grL~RkK~risR~~  234 (621)
T KOG0170|consen  165 DWSLFLTRRCPFLFPFDTRMLYFYSTAFGLSRAIQLLKNKSKGSKDGSNDEALQQLGRLTRKKLRISRKT  234 (621)
T ss_pred             hhhhhhhhcCCeeccHHHHHHHHHHHHhhhhhHHHHHhhcccCCCCCCchHHhHhhcccchhhhhhhHHH
Confidence            599999999999999999999999999999999999999884 445667778899999999999999974


No 2  
>KOG0942|consensus
Probab=83.77  E-value=0.84  Score=39.41  Aligned_cols=22  Identities=27%  Similarity=0.404  Sum_probs=19.5

Q ss_pred             HHhhhhCCceeeHHHHHHHHHH
Q psy4369           4 EHLATTCPFLLNFEIRQLLLYA   25 (71)
Q Consensus         4 ~~L~~~cpFLFPFetR~~~f~~   25 (71)
                      ..+...|||+.||+-|-++||.
T Consensus       598 l~IL~e~PF~vPF~~RVklfq~  619 (1001)
T KOG0942|consen  598 LCILKEIPFFVPFEERVKLFQR  619 (1001)
T ss_pred             HHHHHcCCeeechHHHHHHHHH
Confidence            4578899999999999999984


No 3  
>PF07817 GLE1:  GLE1-like protein;  InterPro: IPR012476 The members of this family are sequences that are similar to the human protein GLE1 (O75458 from SWISSPROT). This protein is localised at the nuclear pore complexes and functions in poly(A)+ RNA export to the cytoplasm []. ; GO: 0016973 poly(A)+ mRNA export from nucleus, 0005643 nuclear pore; PDB: 3PEV_B 3RRN_B 3PEU_B 3RRM_B.
Probab=30.80  E-value=21  Score=25.75  Aligned_cols=13  Identities=31%  Similarity=0.764  Sum_probs=8.3

Q ss_pred             HHhhhhCCceeeH
Q psy4369           4 EHLATTCPFLLNF   16 (71)
Q Consensus         4 ~~L~~~cpFLFPF   16 (71)
                      ..|.+.|||++|+
T Consensus       128 A~l~k~Cp~~vP~  140 (256)
T PF07817_consen  128 ARLHKKCPYLVPK  140 (256)
T ss_dssp             HHHHHH-GGGG--
T ss_pred             HHHHHcCceeEee
Confidence            3677899999974


No 4  
>KOG2412|consensus
Probab=26.55  E-value=30  Score=28.70  Aligned_cols=16  Identities=31%  Similarity=0.854  Sum_probs=12.9

Q ss_pred             hHHhhhhCCceeeHHH
Q psy4369           3 TEHLATTCPFLLNFEI   18 (71)
Q Consensus         3 ~~~L~~~cpFLFPFet   18 (71)
                      +..|-+.|||+.||-.
T Consensus       428 lA~l~KkCP~~VPf~~  443 (591)
T KOG2412|consen  428 LARLHKKCPYVVPFHI  443 (591)
T ss_pred             HHHHHhcCCccccccc
Confidence            3568899999999854


No 5  
>COG4040 Predicted membrane protein [Function unknown]
Probab=24.04  E-value=72  Score=20.20  Aligned_cols=22  Identities=23%  Similarity=0.217  Sum_probs=17.8

Q ss_pred             HHHHHHHHHhhcchhHHHHHHH
Q psy4369          17 EIRQLLLYASSFDRDRALQRLV   38 (71)
Q Consensus        17 etR~~~f~~TsFG~~R~i~~~q   38 (71)
                      ..+.+|+.+.|||.+=+|....
T Consensus        26 a~~lLYLn~~sFgisaliAlyv   47 (85)
T COG4040          26 AAQLLYLNVVSFGISALIALYV   47 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            3578899999999998887643


No 6  
>KOG0170|consensus
Probab=22.95  E-value=17  Score=30.15  Aligned_cols=42  Identities=7%  Similarity=-0.045  Sum_probs=36.1

Q ss_pred             CchHHhhhhCCceeeHHHHHHHHHHhhcchhHHHHHHHhhCC
Q psy4369           1 MVTEHLATTCPFLLNFEIRQLLLYASSFDRDRALQRLVDSTP   42 (71)
Q Consensus         1 ~W~~~L~~~cpFLFPFetR~~~f~~TsFG~~R~i~~~q~~~~   42 (71)
                      .||.-..-..++..+++++.+|-+.|.++|.|....-.++..
T Consensus       157 ~v~sg~lp~w~~~L~~~cpfLfpf~Tr~~~f~~taFg~~R~~  198 (621)
T KOG0170|consen  157 VVASGALPDWSLFLTRRCPFLFPFDTRMLYFYSTAFGLSRAI  198 (621)
T ss_pred             eeecCCCChhhhhhhhcCCeeccHHHHHHHHHHHHhhhhhHH
Confidence            377778888999999999999999999999998887665554


No 7  
>PF12243 CTK3:  CTD kinase subunit gamma CTK3
Probab=22.03  E-value=60  Score=21.88  Aligned_cols=11  Identities=27%  Similarity=0.386  Sum_probs=9.0

Q ss_pred             eHHHHHHHHHH
Q psy4369          15 NFEIRQLLLYA   25 (71)
Q Consensus        15 PFetR~~~f~~   25 (71)
                      |||+|..|-+.
T Consensus         3 pFE~r~~F~~~   13 (139)
T PF12243_consen    3 PFEVRMQFTQL   13 (139)
T ss_pred             hHHHHHHHHHH
Confidence            89999988654


No 8  
>PF09029 Preseq_ALAS:  5-aminolevulinate synthase presequence;  InterPro: IPR015118 The N-terminal presequence domain found in 5-aminolevulinate synthase exists as an amphipathic helix, with a positively charged surface provided by lysine residues and no stable helix at the N terminus. The domain is essential for the import process by which ALAS is transported into the mitochondria: translocase of the outer membrane (Tom) and translocase of the inner membrane protein complexes appear responsible for recognition and import through the mitochondrial membrane. The protein Tom20 is anchored to the mitochondrial outer membrane, and its interaction with presequences is thought to be the recognition step which allows subsequent import []. ; GO: 0003870 5-aminolevulinate synthase activity, 0030170 pyridoxal phosphate binding, 0006778 porphyrin-containing compound metabolic process, 0005759 mitochondrial matrix; PDB: 1H7J_A 1H7D_A.
Probab=20.84  E-value=32  Score=22.39  Aligned_cols=8  Identities=50%  Similarity=1.269  Sum_probs=2.5

Q ss_pred             hhhhCCce
Q psy4369           6 LATTCPFL   13 (71)
Q Consensus         6 L~~~cpFL   13 (71)
                      +.+.||||
T Consensus         7 ~l~rCPFL   14 (107)
T PF09029_consen    7 FLRRCPFL   14 (107)
T ss_dssp             TTSS---S
T ss_pred             HHhhCCce
Confidence            34556665


No 9  
>COG5021 HUL4 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones]
Probab=18.93  E-value=5.8  Score=34.00  Aligned_cols=35  Identities=20%  Similarity=0.236  Sum_probs=28.9

Q ss_pred             hhhCCceeeHHHHHHHHHHhhcchhHHHHHHHhhC
Q psy4369           7 ATTCPFLLNFEIRQLLLYASSFDRDRALQRLVDST   41 (71)
Q Consensus         7 ~~~cpFLFPFetR~~~f~~TsFG~~R~i~~~q~~~   41 (71)
                      ...-|+++|+++|...++...|+..+...-+....
T Consensus       442 ~~~~~l~~~~~~r~~~~~~~~~~~h~k~~~~~~~~  476 (872)
T COG5021         442 SREGPLLSGWKTRLNNLYRFYFVEHRKKTLTKNDS  476 (872)
T ss_pred             cccccccchHHHHhhhhheeeehhcccceeeecCC
Confidence            45679999999999999999999988776654443


No 10 
>PF02865 STAT_int:  STAT protein, protein interaction domain;  InterPro: IPR013799 The STAT protein (Signal Transducers and Activators of Transcription) family contains transcription factors that are specifically activated to regulate gene transcription when cells encounter cytokines and growth factors, hence they act as signal transducers in the cytoplasm and transcription activators in the nucleus []. Binding of these factors to cell-surface receptors leads to receptor autophosphorylation at a tyrosine, the phosphotyrosine being recognised by the STAT SH2 domain, which mediates the recruitment of STAT proteins from the cytosol and their association with the activated receptor. The STAT proteins are then activated by phosphorylation via members of the JAK family of protein kinases, causing them to dimerise and translocated to the nucleus, where they bind to specific promoter sequences in target genes. In mammals, STATs comprise a family of seven structurally and functionally related proteins: Stat1, Stat2, Stat3, Stat4, Stat5a and Stat5b, Stat6. STAT proteins play a critical role in regulating innate and acquired host immune responses. Dysregulation of at least two STAT signalling cascades (i.e. Stat3 and Stat5) is associated with cellular transformation. Signalling through the JAK/STAT pathway is initiated when a cytokine binds to its corresponding receptor. This leads to conformational changes in the cytoplasmic portion of the receptor, initiating activation of receptor associated members of the JAK family of kinases. The JAKs, in turn, mediate phosphorylation at the specific receptor tyrosine residues, which then serve as docking sites for STATs and other signalling molecules. Once recruited to the receptor, STATs also become phosphorylated by JAKs, on a single tyrosine residue. Activated STATs dissociate from the receptor, dimerise, translocate to the nucleus and bind to members of the GAS (gamma activated site) family of enhancers. The seven STAT proteins identified in mammals range in size from 750 and 850 amino acids. The chromosomal distribution of these STATs, as well as the identification of STATs in more primitive eukaryotes, suggest that this family arose from a single primordial gene. STATs share structurally and functionally conserved domains including: an N-terminal domain that strengthens interactions between STAT dimers on adjacent DNA-binding sites; a coiled-coil STAT domain that is implicated in protein-protein interactions; a DNA-binding domain with an immunoglobulin-like fold similar to p53 tumour suppressor protein; an EF-hand-like linker domain connecting the DNA-binding and SH2 domains; an SH2 domain (IPR000980 from INTERPRO) that acts as a phosphorylation-dependent switch to control receptor recognition and DNA-binding; and a C-terminal transactivation domain []. The crystal structure of the N terminus of Stat4 reveals a dimer. The interface of this dimer is formed by a ring-shaped element consisting of five short helices. Several studies suggest that this N-terminal dimerisation promotes cooperativity of binding to tandem GAS elements and with the transcriptional coactivator CBP/p300. This entry represents the N-terminal domain, which is responsible for protein interactions. This domain has a multi-helical structure that can be subdivided into two structural sub-domains.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0004871 signal transducer activity, 0006355 regulation of transcription, DNA-dependent, 0007165 signal transduction; PDB: 1BGF_A 1YVL_A.
Probab=16.79  E-value=73  Score=20.89  Aligned_cols=18  Identities=17%  Similarity=0.218  Sum_probs=10.2

Q ss_pred             HhhhhCCceeeHHHHHHH
Q psy4369           5 HLATTCPFLLNFEIRQLL   22 (71)
Q Consensus         5 ~L~~~cpFLFPFetR~~~   22 (71)
                      ++-..|+==||.|.|+.+
T Consensus        16 qv~~lY~~~FPiEvRh~L   33 (124)
T PF02865_consen   16 QVQQLYGDHFPIEVRHYL   33 (124)
T ss_dssp             HHHCC-BTTC-HHHHHHT
T ss_pred             HHHHHhcccCCHHHHHHH
Confidence            344444434799999875


Done!