BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy4377
         (81 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3UNB|M Chain M, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|AA Chain a, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|OO Chain o, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|3 Chain 3, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|M Chain M, Mouse Constitutive 20s Proteasome
 pdb|3UNE|AA Chain a, Mouse Constitutive 20s Proteasome
 pdb|3UNE|OO Chain o, Mouse Constitutive 20s Proteasome
 pdb|3UNE|3 Chain 3, Mouse Constitutive 20s Proteasome
 pdb|3UNF|M Chain M, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|AA Chain a, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|M Chain M, Mouse 20s Immunoproteasome
 pdb|3UNH|AA Chain a, Mouse 20s Immunoproteasome
          Length = 219

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 20 LSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78
          ++  SV G++FD GV++AAD L S+  LA F N  RI++VN+S +LG   ++AD QYL+
Sbjct: 6  VTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLK 64


>pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At
          2.75 A Resolution
 pdb|1IRU|2 Chain 2, Crystal Structure Of The Mammalian 20s Proteasome At
          2.75 A Resolution
          Length = 219

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 20 LSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78
          ++  SV G++F+ GV++AAD L S+  LA F N  RI++VN S +LG   ++AD QYL+
Sbjct: 6  VTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLK 64


>pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
 pdb|1RYP|2 Chain 2, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
 pdb|1G65|M Chain M, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
          Molecular Basis For Selectivity Of
          Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G65|1 Chain 1, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
          Molecular Basis For Selectivity Of
          Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1FNT|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1FNT|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1JD2|M Chain M, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
          Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1JD2|T Chain T, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
          Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1Z7Q|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1Z7Q|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|2F16|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Bortezomib
 pdb|2F16|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Bortezomib
 pdb|2FAK|M Chain M, Crystal Structure Of Salinosporamide A In Complex With
          The Yeast 20s Proteasome
 pdb|2FAK|1 Chain 1, Crystal Structure Of Salinosporamide A In Complex With
          The Yeast 20s Proteasome
 pdb|2GPL|M Chain M, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
          Proteasome Inhibitors
 pdb|2GPL|1 Chain 1, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
          Proteasome Inhibitors
 pdb|3D29|M Chain M, Proteasome Inhibition By Fellutamide B
 pdb|3D29|1 Chain 1, Proteasome Inhibition By Fellutamide B
 pdb|3E47|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Homobelactosin C
 pdb|3E47|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Homobelactosin C
 pdb|3DY3|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex
          With The Epimer Form Of Spirolactacystin
 pdb|3DY3|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex
          With The Epimer Form Of Spirolactacystin
 pdb|3DY4|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Spirolactacystin
 pdb|3DY4|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Spirolactacystin
 pdb|3GPJ|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Syringolin B
 pdb|3GPJ|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Syringolin B
 pdb|3GPT|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPT|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPW|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Irreversible
          Inhibitor Ligand
 pdb|3GPW|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Irreversible
          Inhibitor Ligand
 pdb|3HYE|M Chain M, Crystal Structure Of 20s Proteasome In Complex With
          Hydroxylated Salinosporamide
 pdb|3HYE|1 Chain 1, Crystal Structure Of 20s Proteasome In Complex With
          Hydroxylated Salinosporamide
 pdb|1VSY|N Chain N, Proteasome Activator Complex
 pdb|1VSY|2 Chain 2, Proteasome Activator Complex
 pdb|3L5Q|R Chain R, Proteasome Activator Complex
 pdb|3L5Q|4 Chain 4, Proteasome Activator Complex
 pdb|3MG4|M Chain M, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG4|1 Chain 1, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG0|M Chain M, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG0|1 Chain 1, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3OKJ|M Chain M, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
          Lead Structure Motif For Proteasome Inhibition
 pdb|3OKJ|1 Chain 1, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
          Lead Structure Motif For Proteasome Inhibition
 pdb|3OEU|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 24
 pdb|3OEU|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 24
 pdb|3OEV|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 25
 pdb|3OEV|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 25
 pdb|3TDD|M Chain M, Crystal Structure Of Yeast Cp In Complex With Belactosin
          C
 pdb|3TDD|1 Chain 1, Crystal Structure Of Yeast Cp In Complex With Belactosin
          C
 pdb|3SHJ|M Chain M, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3SHJ|1 Chain 1, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3UN4|M Chain M, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN4|AA Chain a, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN8|M Chain M, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3UN8|AA Chain a, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3SDI|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 20
 pdb|3SDI|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 20
 pdb|3SDK|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 34
 pdb|3SDK|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 34
 pdb|4GK7|M Chain M, Yeast 20s Proteasome In Complex With The
          Syringolin-Glidobactin Chimera
 pdb|4GK7|AA Chain a, Yeast 20s Proteasome In Complex With The
          Syringolin-Glidobactin Chimera
 pdb|4G4S|N Chain N, Structure Of Proteasome-Pba1-Pba2 Complex
 pdb|4FZC|M Chain M, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZC|AA Chain a, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZG|M Chain M, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4FZG|AA Chain a, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4INR|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu102
 pdb|4INR|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu102
 pdb|4INT|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu122
 pdb|4INT|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu122
 pdb|4INU|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu112
 pdb|4INU|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu112
          Length = 233

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 39/59 (66%)

Query: 20 LSCASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78
          ++  SV  +++D GV++AAD+L S+  L  F   +R++ V ++ ++G   + +D+Q+++
Sbjct: 6  VTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIE 64


>pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle
 pdb|1G0U|1 Chain 1, A Gated Channel Into The Proteasome Core Particle
 pdb|2ZCY|M Chain M, Yeast 20s Proteasome:syringolin A-Complex
 pdb|2ZCY|0 Chain 0, Yeast 20s Proteasome:syringolin A-Complex
 pdb|3BDM|M Chain M, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3BDM|0 Chain 0, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3NZJ|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Ligand 2a
 pdb|3NZJ|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Ligand 2a
 pdb|3NZW|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With 2b
 pdb|3NZW|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With 2b
 pdb|3NZX|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Ligand 2c
 pdb|3NZX|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Ligand 2c
 pdb|3MG6|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 6
 pdb|3MG6|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 6
 pdb|3MG7|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 8
 pdb|3MG7|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 8
 pdb|3MG8|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 16
 pdb|3MG8|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 16
 pdb|4B4T|7 Chain 7, Near-Atomic Resolution Structural Model Of The Yeast 26s
          Proteasome
          Length = 266

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 37/55 (67%)

Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQ 78
          SV  +++D GV++AAD+L S+  L  F   +R++ V ++ ++G   + +D+Q+++
Sbjct: 43 SVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIE 97


>pdb|1RYP|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
 pdb|1RYP|W Chain W, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
 pdb|1G65|H Chain H, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
          Molecular Basis For Selectivity Of
          Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G65|V Chain V, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
          Molecular Basis For Selectivity Of
          Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G0U|H Chain H, A Gated Channel Into The Proteasome Core Particle
 pdb|1G0U|V Chain V, A Gated Channel Into The Proteasome Core Particle
 pdb|1JD2|H Chain H, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
          Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1JD2|O Chain O, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
          Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1Z7Q|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1Z7Q|W Chain W, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|2F16|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Bortezomib
 pdb|2F16|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Bortezomib
 pdb|2FAK|H Chain H, Crystal Structure Of Salinosporamide A In Complex With
          The Yeast 20s Proteasome
 pdb|2FAK|V Chain V, Crystal Structure Of Salinosporamide A In Complex With
          The Yeast 20s Proteasome
 pdb|2GPL|H Chain H, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
          Proteasome Inhibitors
 pdb|2GPL|V Chain V, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
          Proteasome Inhibitors
 pdb|3D29|H Chain H, Proteasome Inhibition By Fellutamide B
 pdb|3D29|V Chain V, Proteasome Inhibition By Fellutamide B
 pdb|3E47|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Homobelactosin C
 pdb|3E47|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Homobelactosin C
 pdb|3DY3|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex
          With The Epimer Form Of Spirolactacystin
 pdb|3DY3|V Chain V, Crystal Structure Of Yeast 20s Proteasome In Complex
          With The Epimer Form Of Spirolactacystin
 pdb|3DY4|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Spirolactacystin
 pdb|3DY4|V Chain V, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Spirolactacystin
 pdb|3GPJ|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Syringolin B
 pdb|3GPJ|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Syringolin B
 pdb|3GPT|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPT|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPW|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Irreversible
          Inhibitor Ligand
 pdb|3GPW|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Salinosporamide Derivatives: Irreversible
          Inhibitor Ligand
 pdb|3HYE|H Chain H, Crystal Structure Of 20s Proteasome In Complex With
          Hydroxylated Salinosporamide
 pdb|3HYE|V Chain V, Crystal Structure Of 20s Proteasome In Complex With
          Hydroxylated Salinosporamide
 pdb|1VSY|I Chain I, Proteasome Activator Complex
 pdb|1VSY|W Chain W, Proteasome Activator Complex
 pdb|3L5Q|M Chain M, Proteasome Activator Complex
 pdb|3L5Q|Y Chain Y, Proteasome Activator Complex
 pdb|3MG4|H Chain H, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG4|V Chain V, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG0|H Chain H, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG0|V Chain V, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG6|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 6
 pdb|3MG6|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 6
 pdb|3MG7|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 8
 pdb|3MG7|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 8
 pdb|3MG8|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 16
 pdb|3MG8|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 16
 pdb|3OKJ|H Chain H, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
          Lead Structure Motif For Proteasome Inhibition
 pdb|3OKJ|V Chain V, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
          Lead Structure Motif For Proteasome Inhibition
 pdb|3OEU|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 24
 pdb|3OEU|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 24
 pdb|3OEV|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 25
 pdb|3OEV|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 25
 pdb|3TDD|H Chain H, Crystal Structure Of Yeast Cp In Complex With Belactosin
          C
 pdb|3TDD|V Chain V, Crystal Structure Of Yeast Cp In Complex With Belactosin
          C
 pdb|3SHJ|H Chain H, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3SHJ|V Chain V, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3SDI|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 20
 pdb|3SDI|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 20
 pdb|3SDK|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 34
 pdb|3SDK|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
          Compound 34
 pdb|4GK7|H Chain H, Yeast 20s Proteasome In Complex With The
          Syringolin-Glidobactin Chimera
 pdb|4GK7|V Chain V, Yeast 20s Proteasome In Complex With The
          Syringolin-Glidobactin Chimera
 pdb|4FZC|H Chain H, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZC|V Chain V, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZG|H Chain H, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4FZG|V Chain V, 20s Yeast Proteasome In Complex With Glidobactin
          Length = 222

 Score = 28.9 bits (63), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 28/53 (52%)

Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQ 75
           ++ G++F+ GV++AAD+  +   +    N  ++ +++  I   G    AD +
Sbjct: 1  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTE 53


>pdb|1FNT|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1FNT|W Chain W, Crystal Structure Of The 20s Proteasome From Yeast In
          Complex With The Proteasome Activator Pa26 From
          Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|2ZCY|H Chain H, Yeast 20s Proteasome:syringolin A-Complex
 pdb|2ZCY|V Chain V, Yeast 20s Proteasome:syringolin A-Complex
 pdb|3BDM|H Chain H, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3BDM|V Chain V, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3UN4|H Chain H, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN4|V Chain V, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN8|H Chain H, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3UN8|V Chain V, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|4G4S|I Chain I, Structure Of Proteasome-Pba1-Pba2 Complex
 pdb|4INR|H Chain H, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu102
 pdb|4INR|V Chain V, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu102
 pdb|4INT|H Chain H, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu122
 pdb|4INT|V Chain V, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu122
 pdb|4INU|H Chain H, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu112
 pdb|4INU|V Chain V, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
          Lu112
          Length = 232

 Score = 28.9 bits (63), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 28/53 (52%)

Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQ 75
           ++ G++F+ GV++AAD+  +   +    N  ++ +++  I   G    AD +
Sbjct: 1  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTE 53


>pdb|1IRU|H Chain H, Crystal Structure Of The Mammalian 20s Proteasome At
          2.75 A Resolution
 pdb|1IRU|V Chain V, Crystal Structure Of The Mammalian 20s Proteasome At
          2.75 A Resolution
          Length = 205

 Score = 27.3 bits (59), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%)

Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
          ++  +QFD GV+L ADS  +           ++  +++ I      + AD Q + D+V
Sbjct: 2  TIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAV 59


>pdb|1VSY|H Chain H, Proteasome Activator Complex
 pdb|1VSY|V Chain V, Proteasome Activator Complex
 pdb|3L5Q|B Chain B, Proteasome Activator Complex
 pdb|3L5Q|D Chain D, Proteasome Activator Complex
          Length = 196

 Score = 26.6 bits (57), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
          AS+  + F  GV+L ADS  +           ++ +V++ I      + AD Q + D V
Sbjct: 1  ASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 59


>pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
 pdb|1RYP|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast At
          2.4 Angstroms Resolution
          Length = 205

 Score = 26.2 bits (56), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%)

Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
          AS+  + F  GV+L ADS  +           ++ +V++ I      + AD Q + D V
Sbjct: 10 ASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 68


>pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Ligand 2a
 pdb|3NZJ|V Chain V, Crystal Structure Of Yeast 20s Proteasome In Complex
          With Ligand 2a
 pdb|3NZW|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With 2b
 pdb|3NZW|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With 2b
 pdb|3NZX|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Ligand 2c
 pdb|3NZX|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
          With Ligand 2c
 pdb|4B4T|2 Chain 2, Near-Atomic Resolution Structural Model Of The Yeast 26s
          Proteasome
          Length = 261

 Score = 26.2 bits (56), Expect = 4.9,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 28/52 (53%)

Query: 24 SVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQ 75
          ++ G++F+ GV++AAD+  +   +    N  ++ +++  I   G    AD +
Sbjct: 31 TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTE 82


>pdb|3UNB|N Chain N, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|BB Chain b, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|PP Chain p, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|4 Chain 4, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|N Chain N, Mouse Constitutive 20s Proteasome
 pdb|3UNE|BB Chain b, Mouse Constitutive 20s Proteasome
 pdb|3UNE|PP Chain p, Mouse Constitutive 20s Proteasome
 pdb|3UNE|4 Chain 4, Mouse Constitutive 20s Proteasome
          Length = 205

 Score = 25.8 bits (55), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 28/59 (47%)

Query: 23 ASVFGLQFDRGVLLAADSLVSFEGLALFCNAQRIVKVNESILLGGGNNFADLQYLQDSV 81
           ++  +QF+ GV+L ADS  +           ++  +++ I      + AD Q + D+V
Sbjct: 1  TTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAV 59


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,589,887
Number of Sequences: 62578
Number of extensions: 40782
Number of successful extensions: 119
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 115
Number of HSP's gapped (non-prelim): 12
length of query: 81
length of database: 14,973,337
effective HSP length: 50
effective length of query: 31
effective length of database: 11,844,437
effective search space: 367177547
effective search space used: 367177547
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)