Query         psy4378
Match_columns 136
No_of_seqs    17 out of 19
Neff          3.2 
Searched_HMMs 46136
Date          Sat Aug 17 00:00:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4378.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4378hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05404 TRAP-delta:  Transloco   5.9 5.5E+02   0.012   20.8   2.6   29    4-32    114-142 (167)
  2 cd09001 GH43_XYL_2 Glycosyl hy   5.7 3.7E+02  0.0081   21.5   1.5   31   11-41     18-48  (269)
  3 PF07999 RHSP:  Retrotransposon   5.4 3.4E+02  0.0074   24.6   1.3   20   18-37     12-31  (439)
  4 cd08985 GH43_6 Glycosyl hydrol   5.0 5.3E+02   0.011   20.7   2.0   37    5-41      4-44  (265)
  5 cd08989 GH43_XYL Glycosyl hydr   4.8 5.2E+02   0.011   20.7   1.8   31    9-39     13-43  (269)
  6 PF13121 DUF3976:  Domain of un   4.7 2.8E+02   0.006   17.9   0.2    8   47-54     11-18  (41)
  7 PF13533 Biotin_lipoyl_2:  Biot   4.4 4.8E+02    0.01   16.1   1.1   13   36-48     22-34  (50)
  8 PF04616 Glyco_hydro_43:  Glyco   4.3 4.3E+02  0.0092   20.5   1.0   28   12-39     18-45  (286)
  9 PRK06748 hypothetical protein;   4.2   1E+03   0.022   16.8   2.8   10   36-45     24-33  (83)
 10 PF07697 7TMR-HDED:  7TM-HD ext   3.6   4E+02  0.0086   20.0   0.2   16   38-53    193-208 (222)

No 1  
>PF05404 TRAP-delta:  Translocon-associated protein, delta subunit precursor (TRAP-delta);  InterPro: IPR008855 This family consists of several eukaryotic translocon-associated protein, delta subunit precursors (TRAP-delta or SSR-delta). The exact function of this protein is unknown [].; GO: 0005783 endoplasmic reticulum, 0016021 integral to membrane
Probab=5.95  E-value=5.5e+02  Score=20.80  Aligned_cols=29  Identities=24%  Similarity=0.430  Sum_probs=25.8

Q ss_pred             CCCCCcccCCceeEEEeeccccccCCccc
Q psy4378           4 QNGDSIDDVNTEYTLVSTHANETKGMRQY   32 (136)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   32 (136)
                      .||++++.|..-+|+.-.|..-.+||.+.
T Consensus       114 R~ged~~~vkplftV~v~h~Ga~~gpwV~  142 (167)
T PF05404_consen  114 RNGEDVSSVKPLFTVTVNHPGAYKGPWVN  142 (167)
T ss_pred             hcCCCcccCCccEEEEEecCccccCCCch
Confidence            47899999999999999999999998754


No 2  
>cd09001 GH43_XYL_2 Glycosyl hydrolase family 43, beta-D-xylosidase. This glycosyl hydrolase family 43 (GH43) includes mostly enzymes that have been characterized to have beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity. They are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extend
Probab=5.66  E-value=3.7e+02  Score=21.54  Aligned_cols=31  Identities=26%  Similarity=0.354  Sum_probs=24.8

Q ss_pred             cCCceeEEEeeccccccCCcccccCcccccC
Q psy4378          11 DVNTEYTLVSTHANETKGMRQYEDNTLVKED   41 (136)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~e~~~lvke~   41 (136)
                      -.+..|-+++|+.....|.+.+.+.+|++=.
T Consensus        18 ~~~~~yY~~~t~~~~~~gi~v~~S~Dl~~W~   48 (269)
T cd09001          18 RVGDDYYMVSTTMHYSPGAPILHSKDLVNWE   48 (269)
T ss_pred             EECCEEEEEECCcccCCCCEEEEcccccCCe
Confidence            3466799999987767899999999988644


No 3  
>PF07999 RHSP:  Retrotransposon hot spot protein;  InterPro: IPR006518 These sequences are full-length and part-length members of the RHS (retrotransposon hot spot) family in Trypanosoma brucei and Trypanosoma cruzi. Members of this family are frequently interrupted by non-LTR retrotransposons inserted at exactly the same relative position. 
Probab=5.43  E-value=3.4e+02  Score=24.60  Aligned_cols=20  Identities=30%  Similarity=0.321  Sum_probs=16.5

Q ss_pred             EEeeccccccCCcccccCcc
Q psy4378          18 LVSTHANETKGMRQYEDNTL   37 (136)
Q Consensus        18 ~~~~~~~~~~~~~~~e~~~l   37 (136)
                      .+|.|+.+..||+++++.|+
T Consensus        12 V~~~~~~~~lGM~V~~G~p~   31 (439)
T PF07999_consen   12 VVSGYDGEPLGMKVVEGEPP   31 (439)
T ss_pred             EEEEcCCCcceEEEecCcCC
Confidence            46889999999999987543


No 4  
>cd08985 GH43_6 Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43) includes enzymes with beta-1,4-xylosidase (xylan 1,4-beta-xylosidase; EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanase and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially e
Probab=4.99  E-value=5.3e+02  Score=20.73  Aligned_cols=37  Identities=22%  Similarity=0.292  Sum_probs=28.5

Q ss_pred             CCCCcccCCceeEEEeeccc----cccCCcccccCcccccC
Q psy4378           5 NGDSIDDVNTEYTLVSTHAN----ETKGMRQYEDNTLVKED   41 (136)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~----~~~~~~~~e~~~lvke~   41 (136)
                      -|-+|--++..|-+..||..    ...|.+.|.+.+|++=.
T Consensus         4 h~~~i~~~~~~yY~ygs~~~~~~~~~~gi~~~sS~DLvnW~   44 (265)
T cd08985           4 HGGGILKVGGTYYWYGENKGGGDTAFGGVSCYSSTDLVNWT   44 (265)
T ss_pred             ccCceEEECCEEEEEEEecCCCCcccccEEEEECCCCccce
Confidence            35566667778999999974    55899999999997643


No 5  
>cd08989 GH43_XYL Glycosyl hydrolase family 43, beta-D-xylosidase. This glycosyl hydrolase family 43 (GH43) includes mostly enzymes that have been characterized to have beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity. They are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended
Probab=4.77  E-value=5.2e+02  Score=20.73  Aligned_cols=31  Identities=19%  Similarity=0.238  Sum_probs=24.4

Q ss_pred             cccCCceeEEEeeccccccCCcccccCcccc
Q psy4378           9 IDDVNTEYTLVSTHANETKGMRQYEDNTLVK   39 (136)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~e~~~lvk   39 (136)
                      |--++..|-+++|+.+...|.+.+.+.+|++
T Consensus        13 ii~~~~~yY~~~t~~~~~~g~~~~~S~DL~~   43 (269)
T cd08989          13 IIRAGDDYYMASSTFEWFPGVQIHHSTDLVN   43 (269)
T ss_pred             EEEECCeEEEEECccccCCCcEEEECCccCC
Confidence            3345677888888877778999999999985


No 6  
>PF13121 DUF3976:  Domain of unknown function (DUF3976)
Probab=4.71  E-value=2.8e+02  Score=17.90  Aligned_cols=8  Identities=63%  Similarity=0.825  Sum_probs=3.4

Q ss_pred             ecCcceee
Q psy4378          47 EDNTLVKE   54 (136)
Q Consensus        47 ~~n~LVke   54 (136)
                      +||.|+|+
T Consensus        11 ~~ntltkr   18 (41)
T PF13121_consen   11 KDNTLTKR   18 (41)
T ss_pred             CCCeeehh
Confidence            34444443


No 7  
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=4.39  E-value=4.8e+02  Score=16.10  Aligned_cols=13  Identities=31%  Similarity=0.330  Sum_probs=5.7

Q ss_pred             cccccCCcceeec
Q psy4378          36 TLVKEDSTLVKED   48 (136)
Q Consensus        36 ~lvke~~~lVk~~   48 (136)
                      ..|+.|++|+.=+
T Consensus        22 ~~VkkGd~L~~ld   34 (50)
T PF13533_consen   22 QQVKKGDVLLVLD   34 (50)
T ss_pred             CEEcCCCEEEEEC
Confidence            3444444444433


No 8  
>PF04616 Glyco_hydro_43:  Glycosyl hydrolases family 43;  InterPro: IPR006710 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  Glycoside hydrolase family 43 GH43 from CAZY includes enzymes with the following activities, beta-xylosidase (3.2.1.37 from EC), alpha-L-arabinofuranosidase (3.2.1.55 from EC); arabinanase (3.2.1.99 from EC), and xylanase (3.2.1.8 from EC).; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3KST_B 1UV4_A 1YRZ_A 1YIF_B 3NQH_A 3QED_D 3QEE_A 3QEF_B 1YI7_A 1Y7B_B ....
Probab=4.33  E-value=4.3e+02  Score=20.48  Aligned_cols=28  Identities=25%  Similarity=0.386  Sum_probs=23.0

Q ss_pred             CCceeEEEeeccccccCCcccccCcccc
Q psy4378          12 VNTEYTLVSTHANETKGMRQYEDNTLVK   39 (136)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~e~~~lvk   39 (136)
                      .+..|-++.|+.....|++.+.+.+|++
T Consensus        18 ~~~~yY~~~t~~~~~~~i~v~~S~DL~~   45 (286)
T PF04616_consen   18 FGDGYYLYGTTDPEGPGIPVWSSKDLVN   45 (286)
T ss_dssp             ETTEEEEEEEEBTCESBEEEEEESSSSS
T ss_pred             ECCEEEEEEEcCCCCCeEEEEECCCCcc
Confidence            3445888888888889999999999974


No 9  
>PRK06748 hypothetical protein; Validated
Probab=4.20  E-value=1e+03  Score=16.83  Aligned_cols=10  Identities=30%  Similarity=0.189  Sum_probs=4.0

Q ss_pred             cccccCCcce
Q psy4378          36 TLVKEDSTLV   45 (136)
Q Consensus        36 ~lvke~~~lV   45 (136)
                      +.|++|++++
T Consensus        24 D~V~~gd~l~   33 (83)
T PRK06748         24 SYVYEWEKLA   33 (83)
T ss_pred             CEECCCCEEE
Confidence            3344444443


No 10 
>PF07697 7TMR-HDED:  7TM-HD extracellular;  InterPro: IPR011624 This entry represents the extracellular domain of the 7TM-HD (7TM Receptors with HD hydrolase) protein family []. These proteins are known or predicted, to posses metal-dependent phospohydrolase activity.
Probab=3.56  E-value=4e+02  Score=20.05  Aligned_cols=16  Identities=19%  Similarity=0.451  Sum_probs=9.9

Q ss_pred             cccCCcceeecCccee
Q psy4378          38 VKEDSTLVKEDNTLVK   53 (136)
Q Consensus        38 vke~~~lVk~~n~LVk   53 (136)
                      |++|+-+|++|...+.
T Consensus       193 V~~Ge~IV~kGe~VT~  208 (222)
T PF07697_consen  193 VKKGEVIVRKGEIVTE  208 (222)
T ss_pred             ccCCCEEecCCcEeCH
Confidence            5666666666665543


Done!