Diaphorina citri psyllid: psy4380


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MFEITDVQKIGVGLAGFGIAFLFLGVFLLFDKGLLAIGNVLFISGLACVIGFERTFRFFFQRHKVKGSLCFFGGIFVVLFGWPLIGMCIELYGFYHLFSGFFPVAINFLRRIPVLGMMLNLPGIKGILDRLAGDTHRTMV
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHccccccccc
***ITDVQKIGVGLAGFGIAFLFLGVFLLFDKGLLAIGNVLFISGLACVIGFERTFRFFFQRHKVKGSLCFFGGIFVVLFGWPLIGMCIELYGFYHLFSGFFPVAINFLRRIPVLGMMLNLPGIKGILDRLA*D******
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEITDVQKIGVGLAGFGIAFLFLGVFLLFDKGLLAIGNVLFISGLACVIGFERTFRFFFQRHKVKGSLCFFGGIFVVLFGWPLIGMCIELYGFYHLFSGFFPVAINFLRRIPVLGMMLNLPGIKGILDRLAGDTHRTMV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle transport protein GOT1B May be involved in fusion of ER-derived transport vesicles with the Golgi complex.very confidentQ2YDE3
Probable Golgi transport protein 1 May be involved in fusion of ER-derived transport vesicles with the Golgi complex.very confidentQ20263
Vesicle transport protein GOT1B May be involved in fusion of ER-derived transport vesicles with the Golgi complex.very confidentQ9Y3E0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007165 [BP]signal transductionconfidentGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043123 [BP]positive regulation of I-kappaB kinase/NF-kappaB cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043122, GO:0048522
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0032940 [BP]secretion by cellprobableGO:0046903, GO:0006810, GO:0009987, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0030134 [CC]ER to Golgi transport vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0040007 [BP]growthprobableGO:0008150
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0006895 [BP]Golgi to endosome transportprobableGO:0016197, GO:0006892, GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted