Query         psy4404
Match_columns 151
No_of_seqs    123 out of 2185
Neff          10.3
Searched_HMMs 46136
Date          Sat Aug 17 00:41:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4404.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4404hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 6.4E-27 1.4E-31  160.0   6.2  121    3-131   130-250 (279)
  2 KOG2462|consensus               99.9   6E-26 1.3E-30  155.3   4.7  107    2-119   160-266 (279)
  3 KOG3576|consensus               99.7 4.5E-18 9.7E-23  112.1   2.4  116    2-126   116-242 (267)
  4 KOG1074|consensus               99.7 3.2E-18   7E-23  131.9   1.1   53   69-121   606-658 (958)
  5 KOG3608|consensus               99.6 2.4E-16 5.2E-21  111.7   4.4  117    1-127   205-322 (467)
  6 KOG3623|consensus               99.6 1.5E-16 3.2E-21  121.5   0.6  109    2-118   209-331 (1007)
  7 KOG3623|consensus               99.6 3.8E-16 8.3E-21  119.2   1.2   83   34-118   890-972 (1007)
  8 KOG1074|consensus               99.6   2E-15 4.4E-20  116.7   3.7   59   69-127   880-938 (958)
  9 KOG3576|consensus               99.5 2.2E-15 4.7E-20   99.6   1.5   85   35-121   114-198 (267)
 10 KOG3608|consensus               99.4 4.8E-13   1E-17   95.1   5.4  109    4-121   264-377 (467)
 11 PHA00733 hypothetical protein   99.2 3.8E-11 8.2E-16   75.8   4.7   87   31-121    33-124 (128)
 12 PLN03086 PRLI-interacting fact  99.2   1E-10 2.2E-15   89.3   7.7   58   44-106   457-514 (567)
 13 PLN03086 PRLI-interacting fact  99.1   3E-10 6.4E-15   86.9   7.0  102    3-120   453-564 (567)
 14 PHA00733 hypothetical protein   99.0 3.3E-10 7.1E-15   71.6   3.8   86    2-93     39-124 (128)
 15 PHA02768 hypothetical protein;  98.9 7.8E-10 1.7E-14   58.6   1.7   40   39-82      6-45  (55)
 16 KOG3993|consensus               98.8 9.5E-10 2.1E-14   80.2   1.4  121    3-126   295-488 (500)
 17 PHA02768 hypothetical protein;  98.8   2E-09 4.3E-14   57.1   1.1   38   69-108     6-43  (55)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.7 2.5E-08 5.3E-13   45.3   2.4   24   84-107     2-25  (26)
 19 KOG3993|consensus               98.6 1.8E-08 3.9E-13   73.7   1.1  108    4-121   268-381 (500)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.6 6.4E-08 1.4E-12   43.9   2.3   25   55-79      1-25  (26)
 21 PHA00616 hypothetical protein   98.4 1.4E-07 3.1E-12   47.6   1.7   32   96-127     1-32  (44)
 22 PF00096 zf-C2H2:  Zinc finger,  98.2 4.5E-07 9.7E-12   39.8   1.0   21    4-25      1-21  (23)
 23 PHA00616 hypothetical protein   98.2   6E-07 1.3E-11   45.4   1.2   28   44-71      5-32  (44)
 24 PHA00732 hypothetical protein   98.1 2.4E-06 5.2E-11   49.4   2.0   21    3-24      1-21  (79)
 25 PHA00732 hypothetical protein   98.0 3.6E-06 7.8E-11   48.6   2.5   48   38-93      1-49  (79)
 26 PF05605 zf-Di19:  Drought indu  98.0 3.6E-06 7.9E-11   45.1   2.3   51    3-64      2-53  (54)
 27 PF13894 zf-C2H2_4:  C2H2-type   98.0 2.9E-06 6.3E-11   37.3   1.2   22    4-26      1-22  (24)
 28 PF13912 zf-C2H2_6:  C2H2-type   97.9 4.2E-06   9E-11   38.2   1.1   23    3-26      1-23  (27)
 29 COG5189 SFP1 Putative transcri  97.9 2.5E-06 5.4E-11   60.7  -0.3   72   36-117   347-419 (423)
 30 PF00096 zf-C2H2:  Zinc finger,  97.8 2.2E-05 4.7E-10   34.2   2.3   23   39-63      1-23  (23)
 31 PF05605 zf-Di19:  Drought indu  97.8 5.5E-05 1.2E-09   40.5   4.2   49   69-120     3-53  (54)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.7 3.1E-05 6.7E-10   35.2   2.1   25   96-120     1-25  (27)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.7 5.2E-05 1.1E-09   33.1   2.6   24   97-120     1-24  (24)
 34 COG5189 SFP1 Putative transcri  97.6 2.7E-05 5.9E-10   55.5   1.5   22    2-24    348-371 (423)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.5 8.9E-05 1.9E-09   44.5   2.4   74    5-92      1-74  (100)
 36 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00025 5.4E-09   42.5   3.2   74   40-120     1-74  (100)
 37 PF13913 zf-C2HC_2:  zinc-finge  97.2 0.00018 3.9E-09   32.1   1.2   23    3-27      2-24  (25)
 38 smart00355 ZnF_C2H2 zinc finge  97.2 0.00016 3.6E-09   32.0   0.9   20    5-25      2-21  (26)
 39 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00017 3.6E-09   32.8  -0.0   21    4-25      2-22  (27)
 40 smart00355 ZnF_C2H2 zinc finge  96.9  0.0011 2.4E-08   29.1   2.4   23   97-119     1-23  (26)
 41 PF09237 GAGA:  GAGA factor;  I  96.8 0.00094   2E-08   34.7   1.9   30   36-67     22-51  (54)
 42 PF13909 zf-H2C2_5:  C2H2-type   96.8  0.0017 3.6E-08   28.4   2.5   24   97-121     1-24  (24)
 43 PF09237 GAGA:  GAGA factor;  I  96.7  0.0042 9.1E-08   32.3   3.8   34   63-96     19-52  (54)
 44 PF12874 zf-met:  Zinc-finger o  96.7  0.0015 3.3E-08   28.8   2.0   23   97-119     1-23  (25)
 45 PRK04860 hypothetical protein;  96.3  0.0042 9.1E-08   40.8   2.9   36   68-107   119-154 (160)
 46 PF13719 zinc_ribbon_5:  zinc-r  96.1  0.0041 8.8E-08   30.4   1.7   36    2-51      1-36  (37)
 47 PF12874 zf-met:  Zinc-finger o  96.1  0.0053 1.1E-07   27.0   1.9   19    4-23      1-19  (25)
 48 PF13717 zinc_ribbon_4:  zinc-r  95.9  0.0076 1.7E-07   29.3   2.1   36    2-51      1-36  (36)
 49 PRK04860 hypothetical protein;  95.8    0.01 2.2E-07   39.1   3.0   39   37-81    118-156 (160)
 50 TIGR02098 MJ0042_CXXC MJ0042 f  95.8  0.0069 1.5E-07   29.7   1.7   36    2-51      1-36  (38)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5  0.0057 1.2E-07   27.6   0.6   22   39-62      2-23  (27)
 52 PF13909 zf-H2C2_5:  C2H2-type   95.3   0.021 4.5E-07   24.8   2.2   19   44-63      4-22  (24)
 53 KOG2231|consensus               95.2   0.034 7.3E-07   44.3   4.4   67   50-120   159-236 (669)
 54 KOG1146|consensus               94.8  0.0084 1.8E-07   50.6   0.1   58    2-62    464-540 (1406)
 55 PRK00398 rpoP DNA-directed RNA  94.8   0.037   8E-07   28.4   2.5   32    1-51      1-32  (46)
 56 smart00451 ZnF_U1 U1-like zinc  94.1   0.028 6.1E-07   26.7   1.1   21    3-24      3-23  (35)
 57 KOG1146|consensus               93.9   0.017 3.6E-07   48.9   0.0  103    6-119   439-541 (1406)
 58 smart00451 ZnF_U1 U1-like zinc  93.5   0.092   2E-06   24.9   2.3   24   96-119     3-26  (35)
 59 COG4049 Uncharacterized protei  93.4   0.033 7.2E-07   29.5   0.7   23    2-25     16-38  (65)
 60 COG5048 FOG: Zn-finger [Genera  93.0   0.045 9.7E-07   41.0   1.1   62    3-71    289-354 (467)
 61 TIGR00622 ssl1 transcription f  92.6    0.22 4.7E-06   30.7   3.4   24   96-119    81-104 (112)
 62 KOG2785|consensus               92.1    0.39 8.5E-06   35.7   4.8   51   68-118   166-242 (390)
 63 COG2888 Predicted Zn-ribbon RN  91.6    0.11 2.3E-06   28.0   1.1   33   37-76     26-58  (61)
 64 KOG2186|consensus               90.8    0.27 5.8E-06   34.6   2.8   49    1-61      1-49  (276)
 65 cd00350 rubredoxin_like Rubred  90.8    0.18   4E-06   23.8   1.4    8   96-103    17-24  (33)
 66 PF12013 DUF3505:  Protein of u  90.6     1.2 2.6E-05   27.2   5.4   23    2-26     10-32  (109)
 67 PF09986 DUF2225:  Uncharacteri  90.0    0.12 2.5E-06   35.8   0.5   49    2-53      4-61  (214)
 68 COG5048 FOG: Zn-finger [Genera  89.8   0.093   2E-06   39.3  -0.1   60   68-127   289-354 (467)
 69 KOG4173|consensus               89.4    0.14   3E-06   34.9   0.5   80   38-120    79-170 (253)
 70 smart00531 TFIIE Transcription  89.0    0.35 7.6E-06   31.4   2.2   41   34-80     95-135 (147)
 71 PF09538 FYDLN_acid:  Protein o  88.9    0.43 9.4E-06   29.3   2.4   30   39-81     10-39  (108)
 72 PF09723 Zn-ribbon_8:  Zinc rib  88.5    0.33 7.1E-06   24.3   1.4   14    4-17      6-19  (42)
 73 KOG2186|consensus               88.4    0.31 6.8E-06   34.2   1.7   49   39-92      4-52  (276)
 74 PF07754 DUF1610:  Domain of un  88.3    0.31 6.6E-06   21.3   1.0   10    2-11     15-24  (24)
 75 KOG2893|consensus               88.0    0.14 3.1E-06   35.6  -0.1   41    6-59     13-53  (341)
 76 KOG2482|consensus               87.6     1.5 3.3E-05   32.4   4.8   51   69-119   280-357 (423)
 77 COG5236 Uncharacterized conser  87.3    0.38 8.2E-06   35.5   1.6   27   39-65    152-178 (493)
 78 smart00834 CxxC_CXXC_SSSS Puta  87.1    0.49 1.1E-05   23.2   1.6   15    3-17      5-19  (41)
 79 KOG4167|consensus               87.0    0.14   3E-06   41.2  -0.8   25    3-28    792-816 (907)
 80 KOG2231|consensus               86.6     1.5 3.2E-05   35.4   4.6   69   39-117   183-260 (669)
 81 KOG2893|consensus               86.1    0.19 4.2E-06   35.0  -0.3   39   45-87     15-53  (341)
 82 COG4049 Uncharacterized protei  85.7    0.56 1.2E-05   24.9   1.3   29   92-120    13-41  (65)
 83 TIGR00622 ssl1 transcription f  85.6     1.3 2.7E-05   27.4   3.0   83    3-92     15-105 (112)
 84 TIGR01206 lysW lysine biosynth  85.5    0.83 1.8E-05   24.3   2.0   32    2-50      1-32  (54)
 85 smart00440 ZnF_C2C2 C2C2 Zinc   85.4    0.42 9.1E-06   23.7   0.8   39    4-51      1-39  (40)
 86 PRK14890 putative Zn-ribbon RN  84.5    0.58 1.3E-05   25.3   1.1   34   36-76     23-56  (59)
 87 PF05443 ROS_MUCR:  ROS/MUCR tr  83.9     0.7 1.5E-05   29.4   1.5   23    4-30     73-95  (132)
 88 PF08209 Sgf11:  Sgf11 (transcr  83.7     1.5 3.2E-05   20.8   2.2   26    2-29      3-28  (33)
 89 PRK09678 DNA-binding transcrip  83.3    0.46   1E-05   26.9   0.4   44    4-56      2-45  (72)
 90 PF01096 TFIIS_C:  Transcriptio  82.7    0.25 5.3E-06   24.4  -0.7   38    4-50      1-38  (39)
 91 COG4957 Predicted transcriptio  82.7     1.2 2.5E-05   28.4   2.0   23    4-30     77-99  (148)
 92 TIGR00373 conserved hypothetic  82.6    0.48   1E-05   31.2   0.4   34   35-79    106-139 (158)
 93 PRK06266 transcription initiat  82.6    0.53 1.1E-05   31.6   0.6   32   37-79    116-147 (178)
 94 TIGR02605 CxxC_CxxC_SSSS putat  82.5    0.93   2E-05   23.6   1.4   12    4-15      6-17  (52)
 95 smart00734 ZnF_Rad18 Rad18-lik  82.2    0.77 1.7E-05   20.4   0.9   19    4-24      2-20  (26)
 96 PF15269 zf-C2H2_7:  Zinc-finge  81.5    0.85 1.8E-05   23.1   1.0   22    4-26     21-42  (54)
 97 TIGR02300 FYDLN_acid conserved  81.1     1.3 2.8E-05   27.9   1.9   33   38-83      9-41  (129)
 98 COG1996 RPC10 DNA-directed RNA  80.5    0.75 1.6E-05   23.9   0.6   13    1-13      4-16  (49)
 99 cd00729 rubredoxin_SM Rubredox  79.8     1.3 2.8E-05   21.0   1.3    8   96-103    18-25  (34)
100 PHA00626 hypothetical protein   79.6     1.8 3.9E-05   23.1   1.8   14   37-52     22-35  (59)
101 PRK00464 nrdR transcriptional   78.9    0.78 1.7E-05   30.0   0.4   17   38-56     28-44  (154)
102 TIGR00373 conserved hypothetic  78.5     1.9 4.2E-05   28.3   2.2   34   63-105   104-137 (158)
103 PF08790 zf-LYAR:  LYAR-type C2  78.0    0.83 1.8E-05   20.7   0.2   18    4-23      1-18  (28)
104 PF06397 Desulfoferrod_N:  Desu  78.0     1.3 2.9E-05   21.4   1.0   13    2-14      5-17  (36)
105 KOG2785|consensus               77.9     2.3 5.1E-05   31.8   2.6   57    3-62    166-242 (390)
106 COG1592 Rubrerythrin [Energy p  77.8     1.9   4E-05   28.7   1.9   24   68-104   134-157 (166)
107 smart00531 TFIIE Transcription  77.0     5.6 0.00012   25.8   4.0   38   65-106    96-133 (147)
108 COG3364 Zn-ribbon containing p  77.0     1.2 2.7E-05   26.8   0.9   16    2-17      1-16  (112)
109 smart00659 RPOLCX RNA polymera  76.8     1.6 3.4E-05   22.1   1.1   14    2-15      1-14  (44)
110 PF04606 Ogr_Delta:  Ogr/Delta-  75.5     1.4   3E-05   22.6   0.7   40    5-53      1-40  (47)
111 KOG4173|consensus               74.7    0.97 2.1E-05   30.9   0.0   73    4-88     80-166 (253)
112 PRK06266 transcription initiat  74.4     3.2 6.9E-05   27.9   2.4   33   65-106   114-146 (178)
113 COG1997 RPL43A Ribosomal prote  73.4     2.4 5.3E-05   24.8   1.4   11   69-79     54-64  (89)
114 PF02892 zf-BED:  BED zinc fing  73.2     4.3 9.3E-05   20.2   2.2   22    3-24     16-40  (45)
115 PF10571 UPF0547:  Uncharacteri  71.8       2 4.4E-05   19.1   0.7   10    5-14     16-25  (26)
116 PF03884 DUF329:  Domain of unk  71.5     2.1 4.6E-05   23.0   0.9   14    2-15      1-14  (57)
117 COG2331 Uncharacterized protei  70.7     2.1 4.4E-05   24.4   0.7   10    4-13     13-22  (82)
118 PF05191 ADK_lid:  Adenylate ki  70.4       3 6.5E-05   20.1   1.2   14    4-17      2-15  (36)
119 PF12013 DUF3505:  Protein of u  70.4     4.8  0.0001   24.5   2.4   25   97-121    81-109 (109)
120 smart00154 ZnF_AN1 AN1-like Zi  70.2     2.4 5.1E-05   20.8   0.8   14    3-16     12-25  (39)
121 PF01428 zf-AN1:  AN1-like Zinc  70.2     1.9 4.1E-05   21.6   0.5   13    3-15     13-25  (43)
122 PF13878 zf-C2H2_3:  zinc-finge  70.2     4.2   9E-05   20.2   1.7   23    4-26     14-37  (41)
123 cd00974 DSRD Desulforedoxin (D  69.2     3.3 7.1E-05   19.5   1.2   13    2-14      3-15  (34)
124 PF09845 DUF2072:  Zn-ribbon co  68.7     2.8   6E-05   26.6   1.0   15    3-17      1-15  (131)
125 smart00614 ZnF_BED BED zinc fi  68.5     4.4 9.6E-05   20.9   1.7   22    4-25     19-44  (50)
126 COG4311 SoxD Sarcosine oxidase  67.7     2.7 5.9E-05   24.9   0.8   12    1-12      1-12  (97)
127 COG5236 Uncharacterized conser  66.9      15 0.00033   27.5   4.6   74   40-120   222-305 (493)
128 TIGR00319 desulf_FeS4 desulfof  66.5       4 8.7E-05   19.2   1.2   13    2-14      6-18  (34)
129 PRK03824 hypA hydrogenase nick  66.3     4.4 9.5E-05   25.9   1.7   13    3-15     70-82  (135)
130 COG1594 RPB9 DNA-directed RNA   66.3     3.5 7.6E-05   25.5   1.2   12   38-51    100-111 (113)
131 PF13451 zf-trcl:  Probable zin  65.7     3.7 8.1E-05   21.3   1.0   16    2-17      3-18  (49)
132 PLN03238 probable histone acet  64.5     8.6 0.00019   27.9   2.9   37    2-40     47-83  (290)
133 COG5188 PRP9 Splicing factor 3  64.2     7.9 0.00017   28.9   2.7   31   88-118   366-397 (470)
134 KOG3408|consensus               64.0     3.3 7.3E-05   25.8   0.7   23    3-26     57-79  (129)
135 PF12760 Zn_Tnp_IS1595:  Transp  63.5     5.6 0.00012   20.1   1.4    9   67-75     36-44  (46)
136 PF14353 CpXC:  CpXC protein     63.4       2 4.4E-05   27.0  -0.3   20    3-23     38-57  (128)
137 PF04959 ARS2:  Arsenite-resist  62.0     4.5 9.7E-05   28.1   1.2   32   32-65     71-102 (214)
138 PF02176 zf-TRAF:  TRAF-type zi  61.3      18 0.00039   19.1   3.3   18   84-101    26-43  (60)
139 PF03811 Zn_Tnp_IS1:  InsA N-te  60.4     6.3 0.00014   19.0   1.2   31    3-46      5-35  (36)
140 PF09963 DUF2197:  Uncharacteri  60.2     5.1 0.00011   21.4   0.9   41    2-50      1-41  (56)
141 PF04959 ARS2:  Arsenite-resist  60.1     5.6 0.00012   27.6   1.3   29   94-122    75-103 (214)
142 PF07975 C1_4:  TFIIH C1-like d  58.4     4.1 8.9E-05   21.4   0.4   20   68-87     21-40  (51)
143 smart00661 RPOL9 RNA polymeras  56.9      11 0.00025   19.2   2.0   13   38-52     20-32  (52)
144 PF10013 DUF2256:  Uncharacteri  56.5       5 0.00011   20.1   0.5   13    5-17     10-22  (42)
145 PF10276 zf-CHCC:  Zinc-finger   56.1     6.4 0.00014   19.5   0.8   11    3-13     29-39  (40)
146 PF12907 zf-met2:  Zinc-binding  56.0     3.8 8.3E-05   20.3   0.0   21    4-24      2-24  (40)
147 KOG2807|consensus               55.3      28  0.0006   25.9   4.2   25   95-119   344-368 (378)
148 PTZ00064 histone acetyltransfe  54.8      15 0.00032   29.0   2.9   38    2-41    279-316 (552)
149 PF14803 Nudix_N_2:  Nudix N-te  54.6     9.6 0.00021   18.1   1.3   13   36-50     20-32  (34)
150 KOG3408|consensus               54.4     9.5 0.00021   23.9   1.5   27   93-119    54-80  (129)
151 PF04423 Rad50_zn_hook:  Rad50   54.2     5.5 0.00012   20.9   0.5   13    5-17     22-34  (54)
152 PF06524 NOA36:  NOA36 protein;  53.1     5.3 0.00011   28.5   0.3   84   34-120   138-233 (314)
153 PLN00104 MYST -like histone ac  52.8      15 0.00033   28.5   2.7   38    2-41    197-234 (450)
154 PF08271 TF_Zn_Ribbon:  TFIIB z  52.4      13 0.00029   18.4   1.7   10    4-13      1-10  (43)
155 TIGR01384 TFS_arch transcripti  52.0     5.8 0.00012   23.9   0.4   11   68-78     90-100 (104)
156 KOG2593|consensus               51.8      10 0.00022   29.1   1.6   39   35-78    125-163 (436)
157 PHA02998 RNA polymerase subuni  50.6     7.5 0.00016   26.1   0.7   11   39-51    172-182 (195)
158 KOG2907|consensus               50.2      13 0.00028   23.0   1.6   10   69-78    103-112 (116)
159 PF12230 PRP21_like_P:  Pre-mRN  49.4     5.5 0.00012   27.8   0.0   22    3-26    168-189 (229)
160 KOG2482|consensus               49.1      16 0.00034   27.3   2.2   24   97-120   280-303 (423)
161 PRK00432 30S ribosomal protein  48.9      15 0.00033   19.1   1.6   11   38-50     37-47  (50)
162 PF03604 DNA_RNApol_7kD:  DNA d  48.6     9.1  0.0002   17.9   0.7   11    4-14      1-11  (32)
163 PF05129 Elf1:  Transcription e  47.8     7.5 0.00016   22.5   0.4   11   69-79     47-57  (81)
164 PF05290 Baculo_IE-1:  Baculovi  47.0      19 0.00041   23.0   2.0   17   34-52     76-92  (140)
165 COG4530 Uncharacterized protei  45.5      14  0.0003   22.7   1.3   26   44-80     13-38  (129)
166 PF08792 A2L_zn_ribbon:  A2L zi  45.5      12 0.00027   17.6   0.9   11    4-14     22-32  (33)
167 KOG4167|consensus               45.4     5.2 0.00011   32.8  -0.7   27   37-65    791-817 (907)
168 PF05495 zf-CHY:  CHY zinc fing  45.1       5 0.00011   22.5  -0.6   13   68-80     41-53  (71)
169 KOG2747|consensus               45.0      19  0.0004   27.5   2.1   36    2-39    157-192 (396)
170 COG3024 Uncharacterized protei  44.9      10 0.00022   20.9   0.6   11    4-14      8-18  (65)
171 PF14354 Lar_restr_allev:  Rest  44.9     9.5 0.00021   20.4   0.5   14    2-15      2-15  (61)
172 PF04438 zf-HIT:  HIT zinc fing  44.5      12 0.00025   17.2   0.7   11    3-13     13-23  (30)
173 KOG0717|consensus               44.2      11 0.00023   29.3   0.8   23   97-119   461-483 (508)
174 PF08274 PhnA_Zn_Ribbon:  PhnA   44.1      11 0.00024   17.4   0.5    9    3-11     19-27  (30)
175 PF01286 XPA_N:  XPA protein N-  44.0      11 0.00023   18.0   0.5   13    5-17      5-17  (34)
176 PF11672 DUF3268:  Protein of u  44.0      19  0.0004   21.9   1.7   15    2-16      1-15  (102)
177 PF07800 DUF1644:  Protein of u  43.7      95  0.0021   20.6   5.2   57   69-127    81-140 (162)
178 KOG1842|consensus               42.5     9.4  0.0002   29.5   0.3   22    4-26     16-37  (505)
179 PF00301 Rubredoxin:  Rubredoxi  42.3      23 0.00049   18.2   1.6   14    4-17      2-15  (47)
180 COG5151 SSL1 RNA polymerase II  41.8      13 0.00029   27.3   0.9   48   70-119   364-411 (421)
181 COG1571 Predicted DNA-binding   41.5      17 0.00036   28.0   1.4   15   38-54    367-381 (421)
182 COG0068 HypF Hydrogenase matur  41.4     5.4 0.00012   32.6  -1.1   58    3-75    122-180 (750)
183 PTZ00043 cytochrome c oxidase   41.0      11 0.00024   26.4   0.4   16    2-17    180-195 (268)
184 PLN03239 histone acetyltransfe  40.7      34 0.00074   25.7   2.9   39    2-41    105-145 (351)
185 PF14446 Prok-RING_1:  Prokaryo  40.3      13 0.00027   19.8   0.5   13    5-17      7-19  (54)
186 PRK03564 formate dehydrogenase  40.1      18 0.00038   26.7   1.4   10   95-104   251-260 (309)
187 PF13453 zf-TFIIB:  Transcripti  39.9      20 0.00043   17.5   1.2   13   44-56     23-35  (41)
188 COG5216 Uncharacterized conser  39.9      13 0.00029   20.0   0.5   11   65-75     41-51  (67)
189 KOG2593|consensus               39.6      36 0.00079   26.2   2.9   38   64-104   124-161 (436)
190 KOG2272|consensus               38.9      13 0.00028   26.5   0.5   13   95-107   220-232 (332)
191 PF04216 FdhE:  Protein involve  38.4     5.1 0.00011   29.1  -1.6   35   69-104   212-246 (290)
192 PTZ00448 hypothetical protein;  38.2      17 0.00037   27.4   1.1   19   44-62    318-336 (373)
193 PF11789 zf-Nse:  Zinc-finger o  38.0      62  0.0013   17.2   3.0    9   44-52     28-36  (57)
194 PRK00418 DNA gyrase inhibitor;  37.8      15 0.00032   20.1   0.5   10    4-13      7-16  (62)
195 cd00730 rubredoxin Rubredoxin;  37.6      22 0.00049   18.5   1.2   12    4-15      2-13  (50)
196 COG1198 PriA Primosomal protei  37.1      22 0.00049   29.5   1.7   11   67-77    474-484 (730)
197 COG4338 Uncharacterized protei  36.8      10 0.00023   19.5  -0.1   12    5-16     14-25  (54)
198 TIGR00320 dfx_rbo desulfoferro  36.5      21 0.00046   22.5   1.2   13    2-14      6-18  (125)
199 PF13248 zf-ribbon_3:  zinc-rib  36.5      14  0.0003   16.1   0.2    7    5-11      4-10  (26)
200 COG3677 Transposase and inacti  36.4      27  0.0006   22.1   1.7   14   37-52     52-65  (129)
201 KOG0717|consensus               36.4      17 0.00037   28.3   0.8   24    4-28    461-484 (508)
202 COG5027 SAS2 Histone acetyltra  36.4      33 0.00072   25.8   2.2   29    1-30    156-184 (395)
203 COG1773 Rubredoxin [Energy pro  36.2      20 0.00044   19.1   0.9   17    1-17      1-17  (55)
204 PF04780 DUF629:  Protein of un  35.8      20 0.00044   28.0   1.2   21    5-26     59-79  (466)
205 PF15616 TerY-C:  TerY-C metal   34.2      22 0.00047   22.7   0.9   11   68-78    105-115 (131)
206 PRK01343 zinc-binding protein;  34.0      19 0.00041   19.4   0.6   11    4-14     10-20  (57)
207 PF14255 Cys_rich_CPXG:  Cystei  33.8      17 0.00036   19.2   0.3   11    5-15      2-12  (52)
208 TIGR03831 YgiT_finger YgiT-typ  33.6      20 0.00044   17.6   0.6   12    4-15     33-44  (46)
209 PF14787 zf-CCHC_5:  GAG-polypr  33.4      19 0.00042   17.3   0.5   11    5-15      4-14  (36)
210 PF01780 Ribosomal_L37ae:  Ribo  33.1      21 0.00045   21.2   0.7   10    3-12     35-44  (90)
211 PF10083 DUF2321:  Uncharacteri  32.9      18 0.00039   23.8   0.4   27   92-118    64-90  (158)
212 PF01194 RNA_pol_N:  RNA polyme  32.7      17 0.00037   19.8   0.2   16    2-17      3-18  (60)
213 TIGR00686 phnA alkylphosphonat  32.1      32  0.0007   21.1   1.4   30    5-54      4-33  (109)
214 KOG1280|consensus               31.9      47   0.001   25.0   2.4   21    3-24     79-99  (381)
215 PRK10220 hypothetical protein;  31.9      39 0.00086   20.8   1.7   33    2-54      2-34  (111)
216 PF14447 Prok-RING_4:  Prokaryo  31.6      22 0.00048   18.9   0.6   10    6-15     42-51  (55)
217 PF06220 zf-U1:  U1 zinc finger  31.5      34 0.00073   16.6   1.2   12    2-13      2-13  (38)
218 KOG4124|consensus               31.3     6.3 0.00014   29.4  -2.0   71   36-115   347-417 (442)
219 PF07282 OrfB_Zn_ribbon:  Putat  31.2      39 0.00084   18.4   1.6   12   95-106    45-56  (69)
220 PRK14714 DNA polymerase II lar  31.0      72  0.0016   28.5   3.6    9    4-12    668-676 (1337)
221 PF13824 zf-Mss51:  Zinc-finger  30.8      46 0.00099   17.8   1.7   14   93-106    11-24  (55)
222 KOG3497|consensus               30.8      26 0.00055   19.1   0.7   16    2-17      3-18  (69)
223 KOG3507|consensus               30.3      29 0.00062   18.8   0.9   10    2-11     19-28  (62)
224 PF08782 c-SKI_SMAD_bind:  c-SK  29.8      21 0.00045   21.4   0.3   18    4-23     29-46  (96)
225 COG1885 Uncharacterized protei  29.5      23 0.00051   21.5   0.5   12    4-15     50-61  (115)
226 KOG1280|consensus               29.5      76  0.0016   23.9   3.1   24   36-61     77-100 (381)
227 COG3091 SprT Zn-dependent meta  29.3      36 0.00078   22.3   1.3    8   96-103   140-147 (156)
228 PF13240 zinc_ribbon_2:  zinc-r  29.3      19 0.00041   15.3   0.1    6    6-11     16-21  (23)
229 PF05180 zf-DNL:  DNL zinc fing  29.0      19 0.00041   20.0   0.1   38    2-51      3-40  (66)
230 PF04780 DUF629:  Protein of un  29.0      52  0.0011   25.8   2.4   24   97-120    58-81  (466)
231 PF14369 zf-RING_3:  zinc-finge  28.4      27 0.00058   16.6   0.5   10    5-14     23-32  (35)
232 PF07649 C1_3:  C1-like domain;  28.2      34 0.00074   15.3   0.9   12    2-13     14-25  (30)
233 PF09855 DUF2082:  Nucleic-acid  28.1      23 0.00051   19.5   0.3    9    4-12      1-9   (64)
234 TIGR03655 anti_R_Lar restricti  28.0      22 0.00047   18.5   0.2   12   39-52     27-38  (53)
235 PF11931 DUF3449:  Domain of un  27.6      20 0.00044   24.6   0.0   23    2-24    100-122 (196)
236 PF01927 Mut7-C:  Mut7-C RNAse   27.5      44 0.00096   21.6   1.6   46   38-85     91-141 (147)
237 PF05741 zf-nanos:  Nanos RNA b  27.5      21 0.00045   19.1   0.0   10    3-12     33-42  (55)
238 COG3809 Uncharacterized protei  27.0      76  0.0017   18.3   2.2   27   34-62     17-43  (88)
239 PRK14892 putative transcriptio  26.9      82  0.0018   19.0   2.5   12   69-80     43-54  (99)
240 PF06827 zf-FPG_IleRS:  Zinc fi  26.8      29 0.00063   15.5   0.5   11    5-15      3-13  (30)
241 COG4888 Uncharacterized Zn rib  26.6      26 0.00057   21.2   0.4   40   35-80     19-58  (104)
242 PF14375 Cys_rich_CWC:  Cystein  26.6      31 0.00068   17.8   0.6    6    7-12      2-7   (50)
243 KOG2636|consensus               26.5      61  0.0013   25.3   2.3   32   88-119   393-425 (497)
244 PF01363 FYVE:  FYVE zinc finge  26.0      16 0.00034   20.0  -0.7   10    5-14     11-20  (69)
245 PF08882 Acetone_carb_G:  Aceto  26.0      37 0.00079   21.0   0.9   10   69-78     75-84  (112)
246 PRK08222 hydrogenase 4 subunit  25.7      34 0.00074   23.0   0.8   13    4-16    115-127 (181)
247 KOG0978|consensus               25.4      12 0.00025   30.8  -1.7   16   70-85    680-695 (698)
248 PRK12496 hypothetical protein;  25.3      55  0.0012   21.7   1.7   12   39-52    128-139 (164)
249 COG1655 Uncharacterized protei  25.0      32  0.0007   24.3   0.6   16    2-17     18-33  (267)
250 TIGR00280 L37a ribosomal prote  24.9      33 0.00072   20.4   0.6   14   37-52     52-65  (91)
251 PF13408 Zn_ribbon_recom:  Reco  24.8      37 0.00081   17.5   0.7   13    3-15      5-17  (58)
252 TIGR00100 hypA hydrogenase nic  24.7      43 0.00092   20.7   1.1   12   39-52     71-82  (115)
253 PRK04016 DNA-directed RNA poly  24.7      36 0.00078   18.6   0.6   17    1-17      2-18  (62)
254 PF14952 zf-tcix:  Putative tre  24.4      32 0.00069   17.4   0.4    8    5-12     13-20  (44)
255 PF05876 Terminase_GpA:  Phage   24.3      43 0.00092   26.9   1.2   43    4-54    201-243 (557)
256 KOG1729|consensus               24.2      47   0.001   24.3   1.4   24    4-28    169-192 (288)
257 PF11781 RRN7:  RNA polymerase   24.0      32 0.00068   16.5   0.3   12    4-15      9-20  (36)
258 PRK12380 hydrogenase nickel in  23.8      56  0.0012   20.2   1.5   12   39-52     71-82  (113)
259 TIGR00595 priA primosomal prot  23.6      31 0.00067   27.3   0.4    9   96-104   253-261 (505)
260 PRK00564 hypA hydrogenase nick  23.6      36 0.00077   21.1   0.6   14    3-16     71-84  (117)
261 PF14690 zf-ISL3:  zinc-finger   23.5      32 0.00069   17.1   0.3    8    3-10      2-9   (47)
262 PTZ00255 60S ribosomal protein  23.5      36 0.00078   20.2   0.5   14   37-52     53-66  (90)
263 COG1675 TFA1 Transcription ini  23.4      40 0.00088   22.7   0.8   34   35-79    110-143 (176)
264 TIGR00515 accD acetyl-CoA carb  23.4      40 0.00086   24.6   0.8    9    5-13     28-36  (285)
265 PLN00032 DNA-directed RNA poly  23.3      40 0.00086   19.0   0.6   23    1-23      2-24  (71)
266 COG3357 Predicted transcriptio  23.2      29 0.00064   20.6   0.1    9   44-52     62-70  (97)
267 PF11023 DUF2614:  Protein of u  22.9      49  0.0011   20.5   1.0   13    3-15     69-81  (114)
268 PF01844 HNH:  HNH endonuclease  22.7      14  0.0003   18.3  -1.2   17    6-23      1-17  (47)
269 PRK03976 rpl37ae 50S ribosomal  22.7      39 0.00084   20.1   0.6   13   38-52     54-66  (90)
270 PF03145 Sina:  Seven in absent  22.4      82  0.0018   21.3   2.2   55    2-66     13-73  (198)
271 smart00132 LIM Zinc-binding do  22.1      36 0.00078   15.6   0.3   10    4-13     28-37  (39)
272 COG4896 Uncharacterized protei  21.9      52  0.0011   18.0   0.9   11   37-49     30-40  (68)
273 COG1998 RPS31 Ribosomal protei  21.8      79  0.0017   16.5   1.5    8   39-48     38-45  (51)
274 COG2879 Uncharacterized small   21.7 1.1E+02  0.0023   16.9   2.1   19  107-125    23-41  (65)
275 PTZ00448 hypothetical protein;  21.1      77  0.0017   24.1   1.9   23   96-118   314-336 (373)
276 PF04267 SoxD:  Sarcosine oxida  21.0      49  0.0011   19.4   0.7   10    3-12      1-10  (84)
277 KOG2703|consensus               20.8      48   0.001   25.5   0.8   11    2-12     67-77  (460)
278 PF14205 Cys_rich_KTR:  Cystein  20.3      89  0.0019   16.6   1.6   32    4-48      5-36  (55)
279 PF10058 DUF2296:  Predicted in  20.2 1.4E+02   0.003   15.8   2.3    8   68-75     44-51  (54)
280 PRK05978 hypothetical protein;  20.0      45 0.00097   21.8   0.5    7    6-12     36-42  (148)

No 1  
>KOG2462|consensus
Probab=99.94  E-value=6.4e-27  Score=160.02  Aligned_cols=121  Identities=26%  Similarity=0.487  Sum_probs=107.9

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChH
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQS   82 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~   82 (151)
                      .|+|++||+.+.+.. +|-.|.-+|-.+   ...+-+.|  +.|++.|.+-.+|+.|+++|.  .+.+|.+||+.|.++.
T Consensus       130 r~~c~eCgk~ysT~s-nLsrHkQ~H~~~---~s~ka~~C--~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPW  201 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSS-NLSRHKQTHRSL---DSKKAFSC--KYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPW  201 (279)
T ss_pred             ceecccccccccccc-ccchhhcccccc---cccccccC--CCCCceeeehHHHhhHhhccC--CCcccccccccccchH
Confidence            588999999999999 999994443322   22566889  999999999999999999997  5789999999999999


Q ss_pred             HHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhhcCCcccccccCC
Q psy4404          83 ALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLKHNADLSSMIKLP  131 (151)
Q Consensus        83 ~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~  131 (151)
                      .|+.|+++|+|||||.|+.|++.|..+++|+.||++|.+.+.|+|..|.
T Consensus       202 LLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~  250 (279)
T KOG2462|consen  202 LLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCG  250 (279)
T ss_pred             HhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchh
Confidence            9999999999999999999999999999999999999999999997764


No 2  
>KOG2462|consensus
Probab=99.92  E-value=6e-26  Score=155.27  Aligned_cols=107  Identities=29%  Similarity=0.541  Sum_probs=99.8

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCCh
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQ   81 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~   81 (151)
                      +.+.|+.|||.|-+.. +|.+|      .++|+  .++.|  +.||+.|....-|+.|+|+|+|++||.|+.|+++|...
T Consensus       160 ka~~C~~C~K~YvSmp-ALkMH------irTH~--l~c~C--~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADR  228 (279)
T KOG2462|consen  160 KAFSCKYCGKVYVSMP-ALKMH------IRTHT--LPCEC--GICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADR  228 (279)
T ss_pred             ccccCCCCCceeeehH-HHhhH------hhccC--CCccc--ccccccccchHHhhcccccccCCCCccCCcccchhcch
Confidence            4688999999999999 99999      45565  56788  99999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhh
Q psy4404          82 SALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        82 ~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      ++|..|+.+|.+.++|.|..|++.|...+.|.+|...-
T Consensus       229 SNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  229 SNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             HHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            99999999999999999999999999999999997643


No 3  
>KOG3576|consensus
Probab=99.70  E-value=4.5e-18  Score=112.12  Aligned_cols=116  Identities=26%  Similarity=0.474  Sum_probs=102.0

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCCh
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQ   81 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~   81 (151)
                      .+|.|..|||.|.... .|..|      ++-|...+.+-|  ..||+.|.+.-.|.+|+++|++.+||.|..|+++|...
T Consensus       116 d~ftCrvCgK~F~lQR-mlnrh------~kch~~vkr~lc--t~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqr  186 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQR-MLNRH------LKCHSDVKRHLC--TFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQR  186 (267)
T ss_pred             CeeeeehhhhhhhHHH-HHHHH------hhhccHHHHHHH--hhccCcccchhhhhhhhccccCccccchhhhhHHHHhh
Confidence            3689999999999999 99999      566888888999  88999999999999999999999999999999999999


Q ss_pred             HHHHHHHhh-hC----------CCCceeCCcCCccccCHHHHHHHHhhhcCCcccc
Q psy4404          82 SALYNHLKR-HT----------GEKPFKCTICSHKAARKDHMKRHLQLKHNADLSS  126 (151)
Q Consensus        82 ~~l~~h~~~-h~----------~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  126 (151)
                      -.|..|++. |.          .++-|.|..||..-.....+..|++.++..-+..
T Consensus       187 csleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spal  242 (267)
T KOG3576|consen  187 CSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPAL  242 (267)
T ss_pred             ccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHHH
Confidence            999998754 32          2466999999999999999999999998655543


No 4  
>KOG1074|consensus
Probab=99.70  E-value=3.2e-18  Score=131.86  Aligned_cols=53  Identities=38%  Similarity=0.677  Sum_probs=50.4

Q ss_pred             eeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhhcC
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLKHN  121 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  121 (151)
                      -+|.+|.+++.....|+.|.++|+|++||+|.+|++.|..+.+|+.|+-+|.-
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka  658 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKA  658 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhccccccc
Confidence            47999999999999999999999999999999999999999999999998863


No 5  
>KOG3608|consensus
Probab=99.63  E-value=2.4e-16  Score=111.67  Aligned_cols=117  Identities=24%  Similarity=0.625  Sum_probs=100.6

Q ss_pred             CceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCC
Q psy4404           1 MILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQ   80 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~   80 (151)
                      .|+..||.||..|+++. .|..|++.    .+.....+|.|  ..|.+.|.+...|..|+..|..  .|+|+.|......
T Consensus       205 eKvvACp~Cg~~F~~~t-kl~DH~rR----qt~l~~n~fqC--~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmtc~~  275 (467)
T KOG3608|consen  205 EKVVACPHCGELFRTKT-KLFDHLRR----QTELNTNSFQC--AQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMTCSS  275 (467)
T ss_pred             CeEEecchHHHHhcccc-HHHHHHHh----hhhhcCCchHH--HHHHHHHhHHHHHHHHHHHhhh--cccccccccCCCC
Confidence            37889999999999999 99999754    33345678999  8999999999999999998865  5899999999999


Q ss_pred             hHHHHHHHhh-hCCCCceeCCcCCccccCHHHHHHHHhhhcCCccccc
Q psy4404          81 QSALYNHLKR-HTGEKPFKCTICSHKAARKDHMKRHLQLKHNADLSSM  127 (151)
Q Consensus        81 ~~~l~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~  127 (151)
                      .+.|..|++. |...+||+|..|++.+...+.|.+|...|. +..|.|
T Consensus       276 ~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C  322 (467)
T KOG3608|consen  276 ASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQC  322 (467)
T ss_pred             hHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceec
Confidence            9999999865 788899999999999999999999998775 666666


No 6  
>KOG3623|consensus
Probab=99.60  E-value=1.5e-16  Score=121.48  Aligned_cols=109  Identities=28%  Similarity=0.625  Sum_probs=95.7

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCC-CcceeeccCCCCcccCCchHHHHHHHhhcCC-------------C
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDV-SFKYVCLYQKCSYHTGNSDHMRRHIRRHTGE-------------K   67 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~-~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~-------------~   67 (151)
                      ++..|+.|++.++... .|+.|+++     +|.. +.-|.|  ..|..+|..+..|.+|+.+|...             +
T Consensus       209 qlltcpycdrgykrlt-slkeHiky-----rhekne~nfsC--~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lR  280 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKRLT-SLKEHIKY-----RHEKNEPNFSC--MLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLR  280 (1007)
T ss_pred             hhhcchhHHHHHHHHH-HHHHHHHH-----HHhhCCCCCcc--hhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhc
Confidence            4678999999999999 99999865     3333 345889  99999999999999999988542             3


Q ss_pred             ceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhh
Q psy4404          68 AFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQL  118 (151)
Q Consensus        68 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  118 (151)
                      .|+|.+|+++|..+-.|+.|+++|.|++||.|+.|+++|+....+..||..
T Consensus       281 KFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  281 KFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             cccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            399999999999999999999999999999999999999999999999864


No 7  
>KOG3623|consensus
Probab=99.58  E-value=3.8e-16  Score=119.24  Aligned_cols=83  Identities=24%  Similarity=0.595  Sum_probs=78.2

Q ss_pred             CCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHH
Q psy4404          34 DVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMK  113 (151)
Q Consensus        34 ~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~  113 (151)
                      +.+..|.|  +.|++.|-..++|.+|.-.|.|.+||+|.+|.++|..+-.|..|.++|.|++||.|..|+++|+....+.
T Consensus       890 te~gmyaC--DqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYS  967 (1007)
T KOG3623|consen  890 TEDGMYAC--DQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYS  967 (1007)
T ss_pred             CccccchH--HHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchH
Confidence            34557999  9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhh
Q psy4404         114 RHLQL  118 (151)
Q Consensus       114 ~H~~~  118 (151)
                      +||..
T Consensus       968 QHMNH  972 (1007)
T KOG3623|consen  968 QHMNH  972 (1007)
T ss_pred             hhhcc
Confidence            99863


No 8  
>KOG1074|consensus
Probab=99.56  E-value=2e-15  Score=116.69  Aligned_cols=59  Identities=29%  Similarity=0.524  Sum_probs=54.6

Q ss_pred             eeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhhcCCccccc
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLKHNADLSSM  127 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~  127 (151)
                      ..|.+|++.|.+...|..|+++|++++||.|..|++.|..+..|+.||.+|...++..-
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~sr  938 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSR  938 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCcc
Confidence            57999999999999999999999999999999999999999999999999986665543


No 9  
>KOG3576|consensus
Probab=99.53  E-value=2.2e-15  Score=99.56  Aligned_cols=85  Identities=25%  Similarity=0.573  Sum_probs=80.0

Q ss_pred             CCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHH
Q psy4404          35 VSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKR  114 (151)
Q Consensus        35 ~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~  114 (151)
                      +...|.|  ..|++.|.-+.-|.+|++-|...+.+.|..||+.|...-+|.+|+++|+|.+||+|..|++.|..+-.|..
T Consensus       114 d~d~ftC--rvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  114 DQDSFTC--RVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCCeeee--ehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHH
Confidence            3456999  99999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhcC
Q psy4404         115 HLQLKHN  121 (151)
Q Consensus       115 H~~~~~~  121 (151)
                      |++..+|
T Consensus       192 hl~kvhg  198 (267)
T KOG3576|consen  192 HLKKVHG  198 (267)
T ss_pred             HHHHHcC
Confidence            9987664


No 10 
>KOG3608|consensus
Probab=99.39  E-value=4.8e-13  Score=95.15  Aligned_cols=109  Identities=21%  Similarity=0.513  Sum_probs=79.7

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcc--cccccCCh
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPH--CEYRCSQQ   81 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~--C~~~~~~~   81 (151)
                      |+||.|+......+ +|..|+     ..+|..++||+|  +.|.+.+.....|++|..+|. +..|.|..  |...+...
T Consensus       264 ykCplCdmtc~~~s-sL~~H~-----r~rHs~dkpfKC--d~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~  334 (467)
T KOG3608|consen  264 YKCPLCDMTCSSAS-SLTTHI-----RYRHSKDKPFKC--DECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTY  334 (467)
T ss_pred             ccccccccCCCChH-HHHHHH-----HhhhccCCCccc--cchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHH
Confidence            45555555555555 555555     356677888888  888888888888888888776 55688876  88888888


Q ss_pred             HHHHHHHhhhC-CC--CceeCCcCCccccCHHHHHHHHhhhcC
Q psy4404          82 SALYNHLKRHT-GE--KPFKCTICSHKAARKDHMKRHLQLKHN  121 (151)
Q Consensus        82 ~~l~~h~~~h~-~~--~~~~C~~C~~~f~~~~~l~~H~~~~~~  121 (151)
                      ..+..|++-+. |.  .+|.|-.|++.|.+-..|..|++..++
T Consensus       335 ~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  335 TQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             HHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence            88888876543 43  348888888888888888888776653


No 11 
>PHA00733 hypothetical protein
Probab=99.18  E-value=3.8e-11  Score=75.84  Aligned_cols=87  Identities=18%  Similarity=0.302  Sum_probs=70.7

Q ss_pred             CCCCCCcceeeccCCCCcccCCchHHHHH--HH---hhcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCcc
Q psy4404          31 SRPDVSFKYVCLYQKCSYHTGNSDHMRRH--IR---RHTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHK  105 (151)
Q Consensus        31 ~~~~~~~~~~C~~~~C~~~f~~~~~l~~h--~~---~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~  105 (151)
                      ......+++.|  ..|.+.|.....|..+  ..   .+.+.+||.|+.|++.|.....|..|++.+  +.+|.|..|++.
T Consensus        33 ~~~~~~~~~~~--~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~  108 (128)
T PHA00733         33 SLTPEQKRLIR--AVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKE  108 (128)
T ss_pred             cCChhhhhHHH--HHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCc
Confidence            33445677889  8899888887777655  11   234477899999999999999999999876  457999999999


Q ss_pred             ccCHHHHHHHHhhhcC
Q psy4404         106 AARKDHMKRHLQLKHN  121 (151)
Q Consensus       106 f~~~~~l~~H~~~~~~  121 (151)
                      |.....|..|+...++
T Consensus       109 F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        109 FRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCHHHHHHHHHHhcC
Confidence            9999999999998775


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.17  E-value=1e-10  Score=89.35  Aligned_cols=58  Identities=17%  Similarity=0.500  Sum_probs=29.5

Q ss_pred             CCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccc
Q psy4404          44 QKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKA  106 (151)
Q Consensus        44 ~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  106 (151)
                      +.|++.|. ...|..|+..++  .++.|+ |+..+ ....|..|+.+|...+++.|..|++.+
T Consensus       457 ~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        457 EKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             CCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            55555553 344555555543  345555 55433 334455555555555555555555544


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.09  E-value=3e-10  Score=86.87  Aligned_cols=102  Identities=20%  Similarity=0.373  Sum_probs=81.7

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCC--
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQ--   80 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~--   80 (151)
                      .+.|+.||+.|. .. .|..|+++|+        .++.|  + ||..+ .+..|..|+..|.+.+++.|+.|+..+..  
T Consensus       453 H~~C~~Cgk~f~-~s-~LekH~~~~H--------kpv~C--p-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~  518 (567)
T PLN03086        453 HVHCEKCGQAFQ-QG-EMEKHMKVFH--------EPLQC--P-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGG  518 (567)
T ss_pred             CccCCCCCCccc-hH-HHHHHHHhcC--------CCccC--C-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCc
Confidence            457999999995 45 8999976532        67899  7 99765 56899999999999999999999998852  


Q ss_pred             --------hHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhhc
Q psy4404          81 --------QSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        81 --------~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                              ...|..|... .+.+++.|..|++.+..+ .+..|+...|
T Consensus       519 ~~~d~~d~~s~Lt~HE~~-CG~rt~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        519 SAMDVRDRLRGMSEHESI-CGSRTAPCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             cccchhhhhhhHHHHHHh-cCCcceEccccCCeeeeh-hHHHHHHHhh
Confidence                    3478899877 488999999999988765 5667766544


No 14 
>PHA00733 hypothetical protein
Probab=99.02  E-value=3.3e-10  Score=71.58  Aligned_cols=86  Identities=21%  Similarity=0.306  Sum_probs=67.1

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCCh
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQ   81 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~   81 (151)
                      +.+.|..|.+.|.+.. .|..+.-... .....+..+|.|  +.|++.|.+..+|..|++.+  ..++.|..|++.|...
T Consensus        39 ~~~~~~~~~~~~~~~~-~l~~~~~l~~-~~~~~~~kPy~C--~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQ-LLDESSYLYK-LLTSKAVSPYVC--PLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             hhHHHHHHhhhccChh-hhcchHHHHh-hcccCCCCCccC--CCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCH
Confidence            4578999999998876 6666511111 223345788999  99999999999999999876  3469999999999999


Q ss_pred             HHHHHHHhhhCC
Q psy4404          82 SALYNHLKRHTG   93 (151)
Q Consensus        82 ~~l~~h~~~h~~   93 (151)
                      ..|..|+....+
T Consensus       113 ~sL~~H~~~~h~  124 (128)
T PHA00733        113 DSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHhcC
Confidence            999999875443


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.89  E-value=7.8e-10  Score=58.62  Aligned_cols=40  Identities=20%  Similarity=0.434  Sum_probs=21.6

Q ss_pred             eeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChH
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQS   82 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~   82 (151)
                      |.|  +.||+.|...++|..|++.|+  +++.|..|++.|...+
T Consensus         6 y~C--~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s   45 (55)
T PHA02768          6 YEC--PICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTG   45 (55)
T ss_pred             cCc--chhCCeeccHHHHHHHHHhcC--CcccCCcccceecccc
Confidence            455  555555555555555555554  3455555555554443


No 16 
>KOG3993|consensus
Probab=98.84  E-value=9.5e-10  Score=80.18  Aligned_cols=121  Identities=17%  Similarity=0.225  Sum_probs=87.5

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCC-------------C--------------CCCCCcceeeccCCCCcccCCchH
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNL-------------S--------------RPDVSFKYVCLYQKCSYHTGNSDH   55 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~-------------~--------------~~~~~~~~~C~~~~C~~~f~~~~~   55 (151)
                      -|+|++|+|+|.=.. +|..|.|||+-.             .              ....+..|.|  ..|++.|.....
T Consensus       295 EYrCPEC~KVFsCPA-NLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C--~~C~KkFrRqAY  371 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPA-NLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSC--HTCGKKFRRQAY  371 (500)
T ss_pred             eecCCcccccccCch-hhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeec--HHhhhhhHHHHH
Confidence            589999999999999 999999999820             0              0012236999  999999999999


Q ss_pred             HHHHHHhhcCCCc----------------------------------------------eeCcccccccCChHHHHHHHh
Q psy4404          56 MRRHIRRHTGEKA----------------------------------------------FHCPHCEYRCSQQSALYNHLK   89 (151)
Q Consensus        56 l~~h~~~h~~~~~----------------------------------------------~~C~~C~~~~~~~~~l~~h~~   89 (151)
                      |+.|+.+|+....                                              ..++.++..+.+++.--.+.+
T Consensus       372 LrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~r  451 (500)
T KOG3993|consen  372 LRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGR  451 (500)
T ss_pred             HHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCcccc
Confidence            9999887643100                                              234556655555554444444


Q ss_pred             hhCCCCceeCCcCCccccCHHHHHHHHhhhcCCcccc
Q psy4404          90 RHTGEKPFKCTICSHKAARKDHMKRHLQLKHNADLSS  126 (151)
Q Consensus        90 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  126 (151)
                      ....+..|.|..|-..|.....|.+|+...|..+..+
T Consensus       452 lg~~~q~f~~ky~~atfyss~~ltrhin~~Hpse~rq  488 (500)
T KOG3993|consen  452 LGIAEQGFTCKYCPATFYSSPGLTRHINKCHPSELRQ  488 (500)
T ss_pred             ccchhhccccccchHhhhcCcchHhHhhhcChHHhhh
Confidence            4444567889999999999999999998877554443


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.79  E-value=2e-09  Score=57.08  Aligned_cols=38  Identities=24%  Similarity=0.621  Sum_probs=17.0

Q ss_pred             eeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccC
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAAR  108 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~  108 (151)
                      |.|+.|++.|...+.|..|+++|.  ++|+|..|++.|..
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~   43 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLR   43 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecc
Confidence            344444444444444444444444  24444444444443


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.65  E-value=2.5e-08  Score=45.30  Aligned_cols=24  Identities=46%  Similarity=1.025  Sum_probs=15.0

Q ss_pred             HHHHHhhhCCCCceeCCcCCcccc
Q psy4404          84 LYNHLKRHTGEKPFKCTICSHKAA  107 (151)
Q Consensus        84 l~~h~~~h~~~~~~~C~~C~~~f~  107 (151)
                      |..|+++|++++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            556666666666666666666654


No 19 
>KOG3993|consensus
Probab=98.57  E-value=1.8e-08  Score=73.65  Aligned_cols=108  Identities=20%  Similarity=0.379  Sum_probs=73.1

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCcee---CcccccccCC
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFH---CPHCEYRCSQ   80 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~---C~~C~~~~~~   80 (151)
                      |+|..|-..|..-. .|.+|      .=..+.-.-|+|  ++|++.|+-..||..|++.|......-   -+.=.+....
T Consensus       268 yiCqLCK~kYeD~F-~LAQH------rC~RIV~vEYrC--PEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~  338 (500)
T KOG3993|consen  268 YICQLCKEKYEDAF-ALAQH------RCPRIVHVEYRC--PECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVET  338 (500)
T ss_pred             HHHHHHHHhhhhHH-HHhhc------cCCeeEEeeecC--CcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhh
Confidence            78999999999999 99999      223334445999  999999999999999999986542211   0000001011


Q ss_pred             hHHHHHHH-hh--hCCCCceeCCcCCccccCHHHHHHHHhhhcC
Q psy4404          81 QSALYNHL-KR--HTGEKPFKCTICSHKAARKDHMKRHLQLKHN  121 (151)
Q Consensus        81 ~~~l~~h~-~~--h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  121 (151)
                      . .+.+.. +.  ...+-.|.|..|++.|.+...|+.|+.+|+.
T Consensus       339 r-ae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  339 R-AEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             h-hhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence            1 111111 11  1223479999999999999999999988874


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.55  E-value=6.4e-08  Score=43.90  Aligned_cols=25  Identities=52%  Similarity=1.079  Sum_probs=18.7

Q ss_pred             HHHHHHHhhcCCCceeCcccccccC
Q psy4404          55 HMRRHIRRHTGEKAFHCPHCEYRCS   79 (151)
Q Consensus        55 ~l~~h~~~h~~~~~~~C~~C~~~~~   79 (151)
                      +|..|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4677777777777788887777764


No 21 
>PHA00616 hypothetical protein
Probab=98.41  E-value=1.4e-07  Score=47.65  Aligned_cols=32  Identities=19%  Similarity=0.394  Sum_probs=21.1

Q ss_pred             ceeCCcCCccccCHHHHHHHHhhhcCCccccc
Q psy4404          96 PFKCTICSHKAARKDHMKRHLQLKHNADLSSM  127 (151)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~  127 (151)
                      ||+|+.||+.|...+.|..|++.|++++++.+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            46666666666666666677666666665544


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.23  E-value=4.5e-07  Score=39.82  Aligned_cols=21  Identities=29%  Similarity=0.550  Sum_probs=12.3

Q ss_pred             eeccccccccccCchHHHHHHh
Q psy4404           4 VICQYCEVRLESNSKELLEHCK   25 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~   25 (151)
                      |+|+.||+.|.+.. .|..|++
T Consensus         1 y~C~~C~~~f~~~~-~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKS-NLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHH-HHHHHHH
T ss_pred             CCCCCCCCccCCHH-HHHHHHh
Confidence            45666666665555 6666654


No 23 
>PHA00616 hypothetical protein
Probab=98.20  E-value=6e-07  Score=45.42  Aligned_cols=28  Identities=7%  Similarity=0.125  Sum_probs=13.4

Q ss_pred             CCCCcccCCchHHHHHHHhhcCCCceeC
Q psy4404          44 QKCSYHTGNSDHMRRHIRRHTGEKAFHC   71 (151)
Q Consensus        44 ~~C~~~f~~~~~l~~h~~~h~~~~~~~C   71 (151)
                      +.||+.|.+...|..|++.|++++++.|
T Consensus         5 ~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          5 LRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             chhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            4444444444444444444444444443


No 24 
>PHA00732 hypothetical protein
Probab=98.06  E-value=2.4e-06  Score=49.35  Aligned_cols=21  Identities=19%  Similarity=0.392  Sum_probs=11.8

Q ss_pred             eeeccccccccccCchHHHHHH
Q psy4404           3 LVICQYCEVRLESNSKELLEHC   24 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~   24 (151)
                      +|+|+.||+.|.+.. .|+.|+
T Consensus         1 py~C~~Cgk~F~s~s-~Lk~H~   21 (79)
T PHA00732          1 MFKCPICGFTTVTLF-ALKQHA   21 (79)
T ss_pred             CccCCCCCCccCCHH-HHHHHh
Confidence            355555555555555 555553


No 25 
>PHA00732 hypothetical protein
Probab=98.05  E-value=3.6e-06  Score=48.61  Aligned_cols=48  Identities=27%  Similarity=0.561  Sum_probs=37.7

Q ss_pred             ceeeccCCCCcccCCchHHHHHHHh-hcCCCceeCcccccccCChHHHHHHHhhhCC
Q psy4404          38 KYVCLYQKCSYHTGNSDHMRRHIRR-HTGEKAFHCPHCEYRCSQQSALYNHLKRHTG   93 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~   93 (151)
                      ||.|  +.|++.|.+..+|..|++. |.+   +.|+.|++.|..   +..|.++..+
T Consensus         1 py~C--~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~---l~~H~~~~~~   49 (79)
T PHA00732          1 MFKC--PICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR---LNQHFYSQYD   49 (79)
T ss_pred             CccC--CCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC---hhhhhcccCC
Confidence            4778  8999999999999999874 543   579999999874   6677765554


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.04  E-value=3.6e-06  Score=45.11  Aligned_cols=51  Identities=33%  Similarity=0.663  Sum_probs=31.0

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCCCCCCC-CcceeeccCCCCcccCCchHHHHHHHhhc
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNLSRPDV-SFKYVCLYQKCSYHTGNSDHMRRHIRRHT   64 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~-~~~~~C~~~~C~~~f~~~~~l~~h~~~h~   64 (151)
                      .|.||.||+.| +.. .|..|+..     .|.. .+.+.|  +.|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~~~-~~~-~L~~H~~~-----~H~~~~~~v~C--PiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKGF-SES-SLVEHCED-----EHRSESKNVVC--PICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCcc-CHH-HHHHHHHh-----HCcCCCCCccC--CCchhhhh--hHHHHHHHHhc
Confidence            47788888844 445 78877643     2332 235777  77876544  36777766543


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.00  E-value=2.9e-06  Score=37.32  Aligned_cols=22  Identities=36%  Similarity=0.646  Sum_probs=12.7

Q ss_pred             eeccccccccccCchHHHHHHhh
Q psy4404           4 VICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      |+|+.|++.|.+.. .|..|+++
T Consensus         1 ~~C~~C~~~~~~~~-~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKS-ELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHH-HHHHHHHH
T ss_pred             CCCcCCCCcCCcHH-HHHHHHHh
Confidence            56666666666666 66666544


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.94  E-value=4.2e-06  Score=38.16  Aligned_cols=23  Identities=30%  Similarity=0.436  Sum_probs=15.6

Q ss_pred             eeeccccccccccCchHHHHHHhh
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      ||.|..|++.|.+.. .|..|++.
T Consensus         1 ~~~C~~C~~~F~~~~-~l~~H~~~   23 (27)
T PF13912_consen    1 PFECDECGKTFSSLS-ALREHKRS   23 (27)
T ss_dssp             SEEETTTTEEESSHH-HHHHHHCT
T ss_pred             CCCCCccCCccCChh-HHHHHhHH
Confidence            467777777777777 77777543


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.87  E-value=2.5e-06  Score=60.69  Aligned_cols=72  Identities=19%  Similarity=0.432  Sum_probs=48.7

Q ss_pred             CcceeeccCCCCcccCCchHHHHHHHh-hcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHH
Q psy4404          36 SFKYVCLYQKCSYHTGNSDHMRRHIRR-HTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKR  114 (151)
Q Consensus        36 ~~~~~C~~~~C~~~f~~~~~l~~h~~~-h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~  114 (151)
                      ++||+|+.+.|.+.+..+..|+-|+.- |...+...-+.          -..+...-...+||+|++|++++.....|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~----------p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPS----------PEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCC----------ccccccccccCCceeccccchhhccCcccee
Confidence            489999999999999999999999753 32222111110          0011111234689999999999999888888


Q ss_pred             HHh
Q psy4404         115 HLQ  117 (151)
Q Consensus       115 H~~  117 (151)
                      |+.
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            864


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.80  E-value=2.2e-05  Score=34.25  Aligned_cols=23  Identities=35%  Similarity=0.868  Sum_probs=16.7

Q ss_pred             eeeccCCCCcccCCchHHHHHHHhh
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRRH   63 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~h   63 (151)
                      |.|  +.|++.|.+...|..|++.|
T Consensus         1 y~C--~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKC--PICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEE--TTTTEEESSHHHHHHHHHHH
T ss_pred             CCC--CCCCCccCCHHHHHHHHhHC
Confidence            567  77777777777777777653


No 31 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.80  E-value=5.5e-05  Score=40.48  Aligned_cols=49  Identities=39%  Similarity=0.763  Sum_probs=22.9

Q ss_pred             eeCcccccccCChHHHHHHHhh-hCCC-CceeCCcCCccccCHHHHHHHHhhhc
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKR-HTGE-KPFKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~-h~~~-~~~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                      |.||.|++ ..+...|..|... |..+ +.+.|++|...+.  .+|..|+...+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            45555555 3334445555432 3322 2355555554322  35555655443


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.71  E-value=3.1e-05  Score=35.18  Aligned_cols=25  Identities=20%  Similarity=0.559  Sum_probs=19.4

Q ss_pred             ceeCCcCCccccCHHHHHHHHhhhc
Q psy4404          96 PFKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                      ||.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5778888888888888888877665


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.68  E-value=5.2e-05  Score=33.12  Aligned_cols=24  Identities=29%  Similarity=0.837  Sum_probs=15.8

Q ss_pred             eeCCcCCccccCHHHHHHHHhhhc
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                      |.|+.|++.|.....|..|++.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777777653


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.60  E-value=2.7e-05  Score=55.53  Aligned_cols=22  Identities=18%  Similarity=0.353  Sum_probs=20.8

Q ss_pred             ceeeccc--cccccccCchHHHHHH
Q psy4404           2 ILVICQY--CEVRLESNSKELLEHC   24 (151)
Q Consensus         2 ~~~~C~~--C~~~f~~~~~~l~~H~   24 (151)
                      +||+||+  |+|.+++.. .|..|+
T Consensus       348 KpykCpV~gC~K~Yknqn-GLKYH~  371 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQN-GLKYHM  371 (423)
T ss_pred             ceecCCCCCchhhhcccc-chhhhh
Confidence            7999999  999999999 999995


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.47  E-value=8.9e-05  Score=44.49  Aligned_cols=74  Identities=23%  Similarity=0.541  Sum_probs=20.2

Q ss_pred             eccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHH
Q psy4404           5 ICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSAL   84 (151)
Q Consensus         5 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l   84 (151)
                      .|..|+..|.+.. .|..||...++......            ..+.....+....+.-. ...+.|..|+..|.+...|
T Consensus         1 ~C~~C~~~f~~~~-~l~~H~~~~H~~~~~~~------------~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l   66 (100)
T PF12756_consen    1 QCLFCDESFSSVD-DLLQHMKKKHGFDIPDQ------------KYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREAL   66 (100)
T ss_dssp             --------------------------------------------------------------SSEEBSSSS-EESSHHHH
T ss_pred             Ccccccccccccc-ccccccccccccccccc------------ccccccccccccccccc-CCCCCCCccCCCCcCHHHH
Confidence            4899999999998 99999754443322211            11112222323322221 2258899999999988889


Q ss_pred             HHHHhhhC
Q psy4404          85 YNHLKRHT   92 (151)
Q Consensus        85 ~~h~~~h~   92 (151)
                      ..|++.+.
T Consensus        67 ~~Hm~~~~   74 (100)
T PF12756_consen   67 QEHMRSKH   74 (100)
T ss_dssp             HHHHHHTT
T ss_pred             HHHHcCcc
Confidence            99987654


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.33  E-value=0.00025  Score=42.50  Aligned_cols=74  Identities=20%  Similarity=0.524  Sum_probs=22.5

Q ss_pred             eeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhh
Q psy4404          40 VCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        40 ~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      .|  ..|+..|.+...|..|+...++-..   +. ...+.....+..+..... ...+.|..|+..|.....|..|++.+
T Consensus         1 ~C--~~C~~~f~~~~~l~~H~~~~H~~~~---~~-~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QC--LFCDESFSSVDDLLQHMKKKHGFDI---PD-QKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cc--ccccccccccccccccccccccccc---cc-cccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            37  7899999999999999876554321   11 111222233333332211 23689999999999999999999976


Q ss_pred             c
Q psy4404         120 H  120 (151)
Q Consensus       120 ~  120 (151)
                      .
T Consensus        74 ~   74 (100)
T PF12756_consen   74 H   74 (100)
T ss_dssp             T
T ss_pred             c
Confidence            4


No 37 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=97.21  E-value=0.00018  Score=32.06  Aligned_cols=23  Identities=35%  Similarity=0.713  Sum_probs=17.5

Q ss_pred             eeeccccccccccCchHHHHHHhhc
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTC   27 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~   27 (151)
                      +.+|+.||+.| ... .|..|+..|
T Consensus         2 l~~C~~CgR~F-~~~-~l~~H~~~C   24 (25)
T PF13913_consen    2 LVPCPICGRKF-NPD-RLEKHEKIC   24 (25)
T ss_pred             CCcCCCCCCEE-CHH-HHHHHHHhc
Confidence            46799999999 444 899996554


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.18  E-value=0.00016  Score=31.96  Aligned_cols=20  Identities=35%  Similarity=0.582  Sum_probs=10.7

Q ss_pred             eccccccccccCchHHHHHHh
Q psy4404           5 ICQYCEVRLESNSKELLEHCK   25 (151)
Q Consensus         5 ~C~~C~~~f~~~~~~l~~H~~   25 (151)
                      .|+.|++.|.... .|..|++
T Consensus         2 ~C~~C~~~f~~~~-~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKS-ALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHH-HHHHHHH
Confidence            4555555555555 5555543


No 39 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.99  E-value=0.00017  Score=32.77  Aligned_cols=21  Identities=29%  Similarity=0.637  Sum_probs=16.1

Q ss_pred             eeccccccccccCchHHHHHHh
Q psy4404           4 VICQYCEVRLESNSKELLEHCK   25 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~   25 (151)
                      |.|..|++.|.+.. .+..|++
T Consensus         2 ~~C~~C~k~f~~~~-~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSEN-QLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHH-HHHCCTT
T ss_pred             CCcccCCCCcCCHH-HHHHHHc
Confidence            67888888888877 8888743


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.92  E-value=0.0011  Score=29.14  Aligned_cols=23  Identities=22%  Similarity=0.631  Sum_probs=15.4

Q ss_pred             eeCCcCCccccCHHHHHHHHhhh
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666777777777777776644


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.83  E-value=0.00094  Score=34.69  Aligned_cols=30  Identities=23%  Similarity=0.361  Sum_probs=12.3

Q ss_pred             CcceeeccCCCCcccCCchHHHHHHHhhcCCC
Q psy4404          36 SFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEK   67 (151)
Q Consensus        36 ~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~   67 (151)
                      +.|-.|  +.|+..+.+..+|.+|+..+++.+
T Consensus        22 ~~PatC--P~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   22 EQPATC--PICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             S--EE---TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCC--CcchhhccchhhHHHHHHHHhccc
Confidence            344445  555555555555555554444433


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.82  E-value=0.0017  Score=28.44  Aligned_cols=24  Identities=42%  Similarity=0.855  Sum_probs=17.0

Q ss_pred             eeCCcCCccccCHHHHHHHHhhhcC
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLKHN  121 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~~~  121 (151)
                      |.|+.|+.... ...|..|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            67888887777 7788888887653


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.73  E-value=0.0042  Score=32.31  Aligned_cols=34  Identities=29%  Similarity=0.451  Sum_probs=23.9

Q ss_pred             hcCCCceeCcccccccCChHHHHHHHhhhCCCCc
Q psy4404          63 HTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKP   96 (151)
Q Consensus        63 h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~   96 (151)
                      +..+.|..|++|+..+....+|..|+....+.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3456788999999999999999999988877765


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.72  E-value=0.0015  Score=28.79  Aligned_cols=23  Identities=30%  Similarity=0.795  Sum_probs=17.2

Q ss_pred             eeCCcCCccccCHHHHHHHHhhh
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      |.|..|+..|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56777888888888888877654


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.32  E-value=0.0042  Score=40.84  Aligned_cols=36  Identities=22%  Similarity=0.626  Sum_probs=19.3

Q ss_pred             ceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCcccc
Q psy4404          68 AFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAA  107 (151)
Q Consensus        68 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~  107 (151)
                      +|.|. |+.   ....+..|.+++.++++|.|..|+..|.
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeE
Confidence            35555 554   3334555555566555566666655443


No 46 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=96.14  E-value=0.0041  Score=30.43  Aligned_cols=36  Identities=22%  Similarity=0.471  Sum_probs=25.7

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccC
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTG   51 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~   51 (151)
                      |...||.|+..|.-..            .....+....+|  +.|+..|.
T Consensus         1 M~i~CP~C~~~f~v~~------------~~l~~~~~~vrC--~~C~~~f~   36 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPD------------DKLPAGGRKVRC--PKCGHVFR   36 (37)
T ss_pred             CEEECCCCCceEEcCH------------HHcccCCcEEEC--CCCCcEee
Confidence            5678999999987665            223345557888  88988774


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.12  E-value=0.0053  Score=27.00  Aligned_cols=19  Identities=26%  Similarity=0.658  Sum_probs=9.2

Q ss_pred             eeccccccccccCchHHHHH
Q psy4404           4 VICQYCEVRLESNSKELLEH   23 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H   23 (151)
                      |.|..|++.|.+.. .|+.|
T Consensus         1 ~~C~~C~~~f~s~~-~~~~H   19 (25)
T PF12874_consen    1 FYCDICNKSFSSEN-SLRQH   19 (25)
T ss_dssp             EEETTTTEEESSHH-HHHHH
T ss_pred             CCCCCCCCCcCCHH-HHHHH
Confidence            34445555554444 44444


No 48 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=95.93  E-value=0.0076  Score=29.27  Aligned_cols=36  Identities=22%  Similarity=0.471  Sum_probs=25.6

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccC
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTG   51 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~   51 (151)
                      |.+.|+.|+..|.-..            ..........+|  +.|+..|.
T Consensus         1 M~i~Cp~C~~~y~i~d------------~~ip~~g~~v~C--~~C~~~f~   36 (36)
T PF13717_consen    1 MIITCPNCQAKYEIDD------------EKIPPKGRKVRC--SKCGHVFF   36 (36)
T ss_pred             CEEECCCCCCEEeCCH------------HHCCCCCcEEEC--CCCCCEeC
Confidence            5678999999986655            233455566888  88888763


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=95.84  E-value=0.01  Score=39.06  Aligned_cols=39  Identities=31%  Similarity=0.658  Sum_probs=33.1

Q ss_pred             cceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCCh
Q psy4404          37 FKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQ   81 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~   81 (151)
                      -+|.|  . |+.   ....+..|.++|.++++|.|..|+..|...
T Consensus       118 ~~Y~C--~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRC--K-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEc--C-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            35889  7 887   667889999999999999999999887543


No 50 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=95.80  E-value=0.0069  Score=29.70  Aligned_cols=36  Identities=19%  Similarity=0.291  Sum_probs=23.9

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccC
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTG   51 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~   51 (151)
                      |.+.||.|+..|.-.. +..           ........|  +.|+..|.
T Consensus         1 M~~~CP~C~~~~~v~~-~~~-----------~~~~~~v~C--~~C~~~~~   36 (38)
T TIGR02098         1 MRIQCPNCKTSFRVVD-SQL-----------GANGGKVRC--GKCGHVWY   36 (38)
T ss_pred             CEEECCCCCCEEEeCH-HHc-----------CCCCCEEEC--CCCCCEEE
Confidence            5678999999987765 221           122235778  88988764


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.46  E-value=0.0057  Score=27.56  Aligned_cols=22  Identities=14%  Similarity=0.673  Sum_probs=16.2

Q ss_pred             eeeccCCCCcccCCchHHHHHHHh
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRR   62 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~   62 (151)
                      |.|  ..|++.|.+...+..|+++
T Consensus         2 ~~C--~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYC--DACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBB--TTTTBBBSSHHHHHCCTTS
T ss_pred             CCc--ccCCCCcCCHHHHHHHHcc
Confidence            567  7788888887777777654


No 52 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.33  E-value=0.021  Score=24.79  Aligned_cols=19  Identities=42%  Similarity=1.031  Sum_probs=8.8

Q ss_pred             CCCCcccCCchHHHHHHHhh
Q psy4404          44 QKCSYHTGNSDHMRRHIRRH   63 (151)
Q Consensus        44 ~~C~~~f~~~~~l~~h~~~h   63 (151)
                      +.|..... ...|..|++.+
T Consensus         4 ~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    4 PHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCcCC-HHHHHHHHHhh
Confidence            44555444 44555554443


No 53 
>KOG2231|consensus
Probab=95.22  E-value=0.034  Score=44.32  Aligned_cols=67  Identities=19%  Similarity=0.361  Sum_probs=38.3

Q ss_pred             cCCchHHHHHHHhhcC-CC----ceeCcccccccCChHHHHHHHhhhCCCCceeCCcCC------ccccCHHHHHHHHhh
Q psy4404          50 TGNSDHMRRHIRRHTG-EK----AFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICS------HKAARKDHMKRHLQL  118 (151)
Q Consensus        50 f~~~~~l~~h~~~h~~-~~----~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~------~~f~~~~~l~~H~~~  118 (151)
                      ..+...|..|+..-.. ..    --.|..|...|.....+..|++.+.    |.|..|.      ..|.....|..|.+.
T Consensus       159 ~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~  234 (669)
T KOG2231|consen  159 LYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRK  234 (669)
T ss_pred             hehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhh
Confidence            4444666666554222 11    1357777777777777777766433    3444442      355566667777666


Q ss_pred             hc
Q psy4404         119 KH  120 (151)
Q Consensus       119 ~~  120 (151)
                      .|
T Consensus       235 ~H  236 (669)
T KOG2231|consen  235 GH  236 (669)
T ss_pred             cC
Confidence            55


No 54 
>KOG1146|consensus
Probab=94.79  E-value=0.0084  Score=50.60  Aligned_cols=58  Identities=17%  Similarity=0.327  Sum_probs=45.2

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCC-------------------CCCCCCCcceeeccCCCCcccCCchHHHHHHHh
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKN-------------------LSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRR   62 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~-------------------~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~   62 (151)
                      +.|+|+.|+..|+... .|..|||.-+.                   ..---+.++|.|  ..|...+....+|..|+..
T Consensus       464 kt~~cpkc~~~yk~a~-~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C--~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQ-TLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPC--RACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccCCccchhhhhHH-HhhhcccccccccchhHhHhccccccccccccccCCCCcccc--eeeeeeeecchHHHHHHHH
Confidence            4589999999999999 99999887331                   111123457888  8899999999999999865


No 55 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=94.79  E-value=0.037  Score=28.35  Aligned_cols=32  Identities=22%  Similarity=0.444  Sum_probs=22.4

Q ss_pred             CceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccC
Q psy4404           1 MILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTG   51 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~   51 (151)
                      |+.|+|+.||..|....            ..   .  ...|  +.||..+.
T Consensus         1 ~~~y~C~~CG~~~~~~~------------~~---~--~~~C--p~CG~~~~   32 (46)
T PRK00398          1 MAEYKCARCGREVELDE------------YG---T--GVRC--PYCGYRIL   32 (46)
T ss_pred             CCEEECCCCCCEEEECC------------CC---C--ceEC--CCCCCeEE
Confidence            67899999999886655            11   1  4678  77886543


No 56 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.12  E-value=0.028  Score=26.75  Aligned_cols=21  Identities=19%  Similarity=0.458  Sum_probs=13.7

Q ss_pred             eeeccccccccccCchHHHHHH
Q psy4404           3 LVICQYCEVRLESNSKELLEHC   24 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~   24 (151)
                      .|.|..|++.|.+.. .+..|+
T Consensus         3 ~~~C~~C~~~~~~~~-~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEI-SVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHH-HHHHHH
Confidence            456777777776555 666664


No 57 
>KOG1146|consensus
Probab=93.87  E-value=0.017  Score=48.93  Aligned_cols=103  Identities=20%  Similarity=0.303  Sum_probs=63.3

Q ss_pred             ccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHH
Q psy4404           6 CQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALY   85 (151)
Q Consensus         6 C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~   85 (151)
                      |..|+..|.+.. .+..|+     ...+.-.+-|.|  +.|+..|+....|-.||++.+.+...  ..|..+- .-..+.
T Consensus       439 ~~~~e~~~~s~r-~~~~~t-----~~L~S~~kt~~c--pkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~gq-~~~~~a  507 (1406)
T KOG1146|consen  439 LTKAEPLLESKR-SLEGQT-----VVLHSFFKTLKC--PKCNWHYKLAQTLGVHMRSKHPESQS--AYCKAGQ-NHPRLA  507 (1406)
T ss_pred             ccchhhhhhhhc-ccccce-----eeeecccccccC--CccchhhhhHHHhhhcccccccccch--hHhHhcc-cccccc
Confidence            455566666655 666664     234444577889  88999999999999998874433211  2222111 101111


Q ss_pred             HHHhhhCCCCceeCCcCCccccCHHHHHHHHhhh
Q psy4404          86 NHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        86 ~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      .-...-.+.++|.|..|...+.....|.+|++.-
T Consensus       508 rg~~~~~~~~p~~C~~C~~stttng~LsihlqS~  541 (1406)
T KOG1146|consen  508 RGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQSD  541 (1406)
T ss_pred             ccccccCCCCcccceeeeeeeecchHHHHHHHHH
Confidence            1111123456899999999999999999998853


No 58 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.52  E-value=0.092  Score=24.87  Aligned_cols=24  Identities=25%  Similarity=0.499  Sum_probs=19.0

Q ss_pred             ceeCCcCCccccCHHHHHHHHhhh
Q psy4404          96 PFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      +|.|..|+..|.....+..|++..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHChH
Confidence            577888888888888888887653


No 59 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.42  E-value=0.033  Score=29.49  Aligned_cols=23  Identities=13%  Similarity=0.491  Sum_probs=17.6

Q ss_pred             ceeeccccccccccCchHHHHHHh
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCK   25 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~   25 (151)
                      ..+.||.||..|+... ++..|+.
T Consensus        16 ~~lrCPRC~~~FR~~K-~Y~RHVN   38 (65)
T COG4049          16 EFLRCPRCGMVFRRRK-DYIRHVN   38 (65)
T ss_pred             eeeeCCchhHHHHHhH-HHHHHhh
Confidence            3577888888888777 8888853


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.98  E-value=0.045  Score=40.99  Aligned_cols=62  Identities=23%  Similarity=0.389  Sum_probs=49.9

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCCC--CCCCC--cceeeccCCCCcccCCchHHHHHHHhhcCCCceeC
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNLS--RPDVS--FKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHC   71 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~--~~~~~--~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C   71 (151)
                      ++.|..|...|.... .|..|      ..  .|+++  +++.|++..|++.|.....+..|...|....+..+
T Consensus       289 ~~~~~~~~~~~s~~~-~l~~~------~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSS-PLTRH------LRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccc-ccccc------ccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            577889999999888 99999      55  68888  89999433799999999999999888876554433


No 61 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.56  E-value=0.22  Score=30.68  Aligned_cols=24  Identities=17%  Similarity=0.376  Sum_probs=12.8

Q ss_pred             ceeCCcCCccccCHHHHHHHHhhh
Q psy4404          96 PFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      .|.|+.|...|-..-+.-.|...|
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhcc
Confidence            455655555555555555554444


No 62 
>KOG2785|consensus
Probab=92.09  E-value=0.39  Score=35.74  Aligned_cols=51  Identities=16%  Similarity=0.436  Sum_probs=40.4

Q ss_pred             ceeCcccccccCChHHHHHHHhhhCC-----------------------CCceeCCcCC---ccccCHHHHHHHHhh
Q psy4404          68 AFHCPHCEYRCSQQSALYNHLKRHTG-----------------------EKPFKCTICS---HKAARKDHMKRHLQL  118 (151)
Q Consensus        68 ~~~C~~C~~~~~~~~~l~~h~~~h~~-----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~  118 (151)
                      |-.|..|+..+.....-..||..++|                       ..-+.|..|+   +.|.+....+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            35688898888888888888876654                       2346788888   899999999999874


No 63 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.60  E-value=0.11  Score=28.01  Aligned_cols=33  Identities=18%  Similarity=0.505  Sum_probs=18.7

Q ss_pred             cceeeccCCCCcccCCchHHHHHHHhhcCCCceeCccccc
Q psy4404          37 FKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEY   76 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~   76 (151)
                      ..|.|  +.||..--.+..-     --.-..+|.|+.||.
T Consensus        26 v~F~C--PnCGe~~I~Rc~~-----CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPC--PNCGEVEIYRCAK-----CRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeC--CCCCceeeehhhh-----HHHcCCceECCCcCc
Confidence            45778  7788554444421     111235688888864


No 64 
>KOG2186|consensus
Probab=90.79  E-value=0.27  Score=34.56  Aligned_cols=49  Identities=18%  Similarity=0.545  Sum_probs=36.5

Q ss_pred             CceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHH
Q psy4404           1 MILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIR   61 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~   61 (151)
                      |.-|.|..||....-.  .+..|+..|.+       .-|.|  -+|++.|.. .+...|..
T Consensus         1 MV~FtCnvCgEsvKKp--~vekH~srCrn-------~~fSC--IDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    1 MVFFTCNVCGESVKKP--QVEKHMSRCRN-------AYFSC--IDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             CeEEehhhhhhhcccc--chHHHHHhccC-------CeeEE--eeccccccc-chhhhhhh
Confidence            5678899999998663  68889654433       45889  999999999 44556644


No 65 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.79  E-value=0.18  Score=23.81  Aligned_cols=8  Identities=38%  Similarity=1.501  Sum_probs=4.2

Q ss_pred             ceeCCcCC
Q psy4404          96 PFKCTICS  103 (151)
Q Consensus        96 ~~~C~~C~  103 (151)
                      ++.|+.|+
T Consensus        17 ~~~CP~Cg   24 (33)
T cd00350          17 PWVCPVCG   24 (33)
T ss_pred             CCcCcCCC
Confidence            44555554


No 66 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=90.65  E-value=1.2  Score=27.24  Aligned_cols=23  Identities=26%  Similarity=0.641  Sum_probs=18.5

Q ss_pred             ceeeccccccccccCchHHHHHHhh
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      ++.+|..|+-.... + ++..|++.
T Consensus        10 ~vlIC~~C~~av~~-~-~v~~HL~~   32 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-S-EVESHLRK   32 (109)
T ss_pred             CEEEeCCCCcccCc-h-HHHHHHHH
Confidence            57889999988766 5 89999774


No 67 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.02  E-value=0.12  Score=35.83  Aligned_cols=49  Identities=12%  Similarity=0.310  Sum_probs=27.8

Q ss_pred             ceeeccccccccccCchHHHHHHhh---cCCCCCC-CCCcc-----eeeccCCCCcccCCc
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKT---CKNLSRP-DVSFK-----YVCLYQKCSYHTGNS   53 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~---~~~~~~~-~~~~~-----~~C~~~~C~~~f~~~   53 (151)
                      +-+.||.|++.|.++. -+....+.   ..+...+ .+..|     ..|  +.||..+...
T Consensus         4 k~~~CPvC~~~F~~~~-vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vC--P~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKK-VRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVC--PHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeE-EEcCCceEeeecCCCccccCCCCCeeeeEEEC--CCCCCccccc
Confidence            5688999999999876 33333111   1111122 12233     347  8888876654


No 68 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.82  E-value=0.093  Score=39.30  Aligned_cols=60  Identities=33%  Similarity=0.686  Sum_probs=40.8

Q ss_pred             ceeCcccccccCChHHHHHHHh--hhCCC--CceeCC--cCCccccCHHHHHHHHhhhcCCccccc
Q psy4404          68 AFHCPHCEYRCSQQSALYNHLK--RHTGE--KPFKCT--ICSHKAARKDHMKRHLQLKHNADLSSM  127 (151)
Q Consensus        68 ~~~C~~C~~~~~~~~~l~~h~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~~  127 (151)
                      ++.|..|...|.....+..|.+  .|.++  +|+.|+  .|++.|.+...+..|..+|.+..+..+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            4566667777777777777776  67777  677777  577777777777777777665554444


No 69 
>KOG4173|consensus
Probab=89.39  E-value=0.14  Score=34.87  Aligned_cols=80  Identities=20%  Similarity=0.456  Sum_probs=60.2

Q ss_pred             ceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhC----------CCCceeCCc--CCcc
Q psy4404          38 KYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHT----------GEKPFKCTI--CSHK  105 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~----------~~~~~~C~~--C~~~  105 (151)
                      .+.|+.-.|...|...+....|...-++.   .|.+|.+.|++.-.|-.|..-..          |.-.|.|.+  |+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            36787778999999988888887665442   69999999999888877764322          333488855  9999


Q ss_pred             ccCHHHHHHHHhhhc
Q psy4404         106 AARKDHMKRHLQLKH  120 (151)
Q Consensus       106 f~~~~~l~~H~~~~~  120 (151)
                      |.+......|+-..+
T Consensus       156 FkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhHHHHhc
Confidence            999888888876543


No 70 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=89.02  E-value=0.35  Score=31.35  Aligned_cols=41  Identities=17%  Similarity=0.400  Sum_probs=24.9

Q ss_pred             CCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCC
Q psy4404          34 DVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQ   80 (151)
Q Consensus        34 ~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~   80 (151)
                      .....|.|  +.|+..|..-..+..-   .. ...|.|+.|+.....
T Consensus        95 ~~~~~Y~C--p~C~~~y~~~ea~~~~---d~-~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       95 TNNAYYKC--PNCQSKYTFLEANQLL---DM-DGTFTCPRCGEELEE  135 (147)
T ss_pred             cCCcEEEC--cCCCCEeeHHHHHHhc---CC-CCcEECCCCCCEEEE
Confidence            34556888  7788887765544321   11 234888888876643


No 71 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.87  E-value=0.43  Score=29.28  Aligned_cols=30  Identities=17%  Similarity=0.503  Sum_probs=20.6

Q ss_pred             eeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCCh
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQ   81 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~   81 (151)
                      ..|  +.||+.|..-           ++.|..||.||..|...
T Consensus        10 R~C--p~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTC--PSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccC--CCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            457  7788887773           24567788888777655


No 72 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.53  E-value=0.33  Score=24.31  Aligned_cols=14  Identities=21%  Similarity=0.427  Sum_probs=8.6

Q ss_pred             eeccccccccccCc
Q psy4404           4 VICQYCEVRLESNS   17 (151)
Q Consensus         4 ~~C~~C~~~f~~~~   17 (151)
                      |+|..||..|....
T Consensus         6 y~C~~Cg~~fe~~~   19 (42)
T PF09723_consen    6 YRCEECGHEFEVLQ   19 (42)
T ss_pred             EEeCCCCCEEEEEE
Confidence            56777776665443


No 73 
>KOG2186|consensus
Probab=88.40  E-value=0.31  Score=34.24  Aligned_cols=49  Identities=22%  Similarity=0.491  Sum_probs=31.4

Q ss_pred             eeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhC
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHT   92 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~   92 (151)
                      |.|  ..||-...- ..+.+|+..-++ .-|.|..|+..|.. ..+..|...=+
T Consensus         4 FtC--nvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTC--NVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eeh--hhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            667  777776655 346667766665 45777778887777 44566655433


No 74 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=88.31  E-value=0.31  Score=21.31  Aligned_cols=10  Identities=20%  Similarity=0.634  Sum_probs=7.0

Q ss_pred             ceeecccccc
Q psy4404           2 ILVICQYCEV   11 (151)
Q Consensus         2 ~~~~C~~C~~   11 (151)
                      ..|+||.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4677888774


No 75 
>KOG2893|consensus
Probab=88.02  E-value=0.14  Score=35.63  Aligned_cols=41  Identities=20%  Similarity=0.535  Sum_probs=20.0

Q ss_pred             ccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHH
Q psy4404           6 CQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRH   59 (151)
Q Consensus         6 C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h   59 (151)
                      |=.|++.|..+. -|.+|          ...+.|+|  ..|.+.+.+--.|..|
T Consensus        13 cwycnrefddek-iliqh----------qkakhfkc--hichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEK-ILIQH----------QKAKHFKC--HICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhh-hhhhh----------hhhcccee--eeehhhhccCCCceee
Confidence            444555555554 55555          12234555  5555554444444444


No 76 
>KOG2482|consensus
Probab=87.58  E-value=1.5  Score=32.35  Aligned_cols=51  Identities=18%  Similarity=0.327  Sum_probs=37.0

Q ss_pred             eeCcccccccCChHHHHHHHhhhCC---------------------------CCceeCCcCCccccCHHHHHHHHhhh
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKRHTG---------------------------EKPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      ..|-.|.........|..||..-..                           ...-.|-.|...|-....|..||-.+
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            5788898888888889999864221                           01135777888888888888887643


No 77 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=87.30  E-value=0.38  Score=35.47  Aligned_cols=27  Identities=22%  Similarity=0.653  Sum_probs=15.7

Q ss_pred             eeeccCCCCcccCCchHHHHHHHhhcC
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRRHTG   65 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~h~~   65 (151)
                      |.||...|...-.....|..|.++-++
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~  178 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG  178 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC
Confidence            666555555555555666666665443


No 78 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.11  E-value=0.49  Score=23.22  Aligned_cols=15  Identities=20%  Similarity=0.321  Sum_probs=9.3

Q ss_pred             eeeccccccccccCc
Q psy4404           3 LVICQYCEVRLESNS   17 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~   17 (151)
                      .|.|+.||..|.-..
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            366777777765433


No 79 
>KOG4167|consensus
Probab=87.00  E-value=0.14  Score=41.22  Aligned_cols=25  Identities=20%  Similarity=0.272  Sum_probs=20.2

Q ss_pred             eeeccccccccccCchHHHHHHhhcC
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCK   28 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~   28 (151)
                      .|.|.+|||+|.... .+..||++|.
T Consensus       792 iFpCreC~kvF~KiK-SrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIK-SRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHh-hhhHHHHHHH
Confidence            588999999987777 8889987654


No 80 
>KOG2231|consensus
Probab=86.57  E-value=1.5  Score=35.44  Aligned_cols=69  Identities=22%  Similarity=0.434  Sum_probs=44.9

Q ss_pred             eeeccCCCCcccCCchHHHHHHHhhcCCCceeCccc------ccccCChHHHHHHHhhhCCCCceeCC--cCC-ccccCH
Q psy4404          39 YVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHC------EYRCSQQSALYNHLKRHTGEKPFKCT--ICS-HKAARK  109 (151)
Q Consensus        39 ~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C------~~~~~~~~~l~~h~~~h~~~~~~~C~--~C~-~~f~~~  109 (151)
                      -.|  ..|...|.....|..|++.++    +.|..|      +..|..-..|..|.+    +..|.|.  .|. +.|...
T Consensus       183 p~C--~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR----~~HflCE~~~C~~~~f~~~  252 (669)
T KOG2231|consen  183 PLC--KFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFR----KGHFLCEEEFCRTKKFYVA  252 (669)
T ss_pred             ccc--hhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhh----hcCccccccccccceeeeh
Confidence            347  889999999999999998765    345555      455566667777766    4557777  465 234333


Q ss_pred             HHHHHHHh
Q psy4404         110 DHMKRHLQ  117 (151)
Q Consensus       110 ~~l~~H~~  117 (151)
                      ..+..+++
T Consensus       253 ~~~ei~lk  260 (669)
T KOG2231|consen  253 FELEIELK  260 (669)
T ss_pred             hHHHHHHH
Confidence            34444444


No 81 
>KOG2893|consensus
Probab=86.09  E-value=0.19  Score=35.01  Aligned_cols=39  Identities=18%  Similarity=0.384  Sum_probs=19.4

Q ss_pred             CCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHH
Q psy4404          45 KCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNH   87 (151)
Q Consensus        45 ~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h   87 (151)
                      .|.+-|.+..-|.+|++..    -|+|.+|.+.+.+-..|..|
T Consensus        15 ycnrefddekiliqhqkak----hfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQKAK----HFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ecccccchhhhhhhhhhhc----cceeeeehhhhccCCCceee
Confidence            5566666655555554432    25555555444444334433


No 82 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=85.66  E-value=0.56  Score=24.92  Aligned_cols=29  Identities=28%  Similarity=0.577  Sum_probs=18.3

Q ss_pred             CCCCceeCCcCCccccCHHHHHHHHhhhc
Q psy4404          92 TGEKPFKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        92 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                      .|+.-+.|+-|+..|....++.+|....+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            34444667777777777777777766544


No 83 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=85.56  E-value=1.3  Score=27.40  Aligned_cols=83  Identities=13%  Similarity=0.193  Sum_probs=51.0

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCC----C--C--CCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCccc
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNL----S--R--PDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHC   74 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~----~--~--~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C   74 (151)
                      |..|+.||.+.-+.. +|..-  +|+=.    .  .  ......-.|  -.|...|........-  .-.....|.|+.|
T Consensus        15 P~~CpiCgLtLVss~-HLARS--yHHLfPl~~f~ev~~~~~~~~~~C--~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C   87 (112)
T TIGR00622        15 PVECPICGLTLILST-HLARS--YHHLFPLKAFQEIPLEEYNGSRFC--FGCQGPFPKPPVSPFD--ELKDSHRYVCAVC   87 (112)
T ss_pred             CCcCCcCCCEEeccc-hHHHh--hhccCCCcccccccccccCCCCcc--cCcCCCCCCccccccc--ccccccceeCCCC
Confidence            567999999988877 77643  11100    0  0  001112348  8899999875321100  0122346999999


Q ss_pred             ccccCChHHHHHHHhhhC
Q psy4404          75 EYRCSQQSALYNHLKRHT   92 (151)
Q Consensus        75 ~~~~~~~~~l~~h~~~h~   92 (151)
                      ...|...-+.-.|..+|.
T Consensus        88 ~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        88 KNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CCccccccchhhhhhccC
Confidence            999999988888876654


No 84 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=85.48  E-value=0.83  Score=24.30  Aligned_cols=32  Identities=16%  Similarity=0.377  Sum_probs=19.8

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCccc
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHT   50 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f   50 (151)
                      |.|+||.||..+.-..            .  .. .....|  +.||..+
T Consensus         1 ~~~~CP~CG~~iev~~------------~--~~-GeiV~C--p~CGael   32 (54)
T TIGR01206         1 MQFECPDCGAEIELEN------------P--EL-GELVIC--DECGAEL   32 (54)
T ss_pred             CccCCCCCCCEEecCC------------C--cc-CCEEeC--CCCCCEE
Confidence            3578888888774433            1  11 234678  7888664


No 85 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=85.44  E-value=0.42  Score=23.67  Aligned_cols=39  Identities=21%  Similarity=0.384  Sum_probs=20.2

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccC
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTG   51 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~   51 (151)
                      ++|+.||..-..   .++.+.+    ......-..|.|  ..|+..|.
T Consensus         1 ~~Cp~C~~~~a~---~~q~Q~R----saDE~mT~fy~C--~~C~~~w~   39 (40)
T smart00440        1 APCPKCGNREAT---FFQLQTR----SADEPMTVFYVC--TKCGHRWR   39 (40)
T ss_pred             CcCCCCCCCeEE---EEEEccc----CCCCCCeEEEEe--CCCCCEeC
Confidence            478889855322   2233311    111111235889  88998764


No 86 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.48  E-value=0.58  Score=25.25  Aligned_cols=34  Identities=21%  Similarity=0.653  Sum_probs=19.7

Q ss_pred             CcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCccccc
Q psy4404          36 SFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEY   76 (151)
Q Consensus        36 ~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~   76 (151)
                      ...|.|  +.||...-.+-.-   -+.  ...+|.|+.||.
T Consensus        23 ~~~F~C--PnCG~~~I~RC~~---CRk--~~~~Y~CP~CGF   56 (59)
T PRK14890         23 AVKFLC--PNCGEVIIYRCEK---CRK--QSNPYTCPKCGF   56 (59)
T ss_pred             cCEeeC--CCCCCeeEeechh---HHh--cCCceECCCCCC
Confidence            345888  8888773333221   111  135789998874


No 87 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=83.90  E-value=0.7  Score=29.44  Aligned_cols=23  Identities=30%  Similarity=0.650  Sum_probs=12.2

Q ss_pred             eeccccccccccCchHHHHHHhhcCCC
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNL   30 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~   30 (151)
                      .+|-+||+.|+    .|..|.+.|+++
T Consensus        73 i~clecGk~~k----~LkrHL~~~~gl   95 (132)
T PF05443_consen   73 IICLECGKKFK----TLKRHLRTHHGL   95 (132)
T ss_dssp             EE-TBT--EES----BHHHHHHHTT-S
T ss_pred             eEEccCCcccc----hHHHHHHHccCC
Confidence            56888888884    456776555443


No 88 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=83.69  E-value=1.5  Score=20.77  Aligned_cols=26  Identities=19%  Similarity=0.460  Sum_probs=17.8

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCC
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKN   29 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~   29 (151)
                      ..|.|+.|++.+..  .-+..|+..|-+
T Consensus         3 ~~~~C~nC~R~v~a--~RfA~HLekCmg   28 (33)
T PF08209_consen    3 PYVECPNCGRPVAA--SRFAPHLEKCMG   28 (33)
T ss_dssp             -EEE-TTTSSEEEG--GGHHHHHHHHTC
T ss_pred             CeEECCCCcCCcch--hhhHHHHHHHHc
Confidence            46889999999866  358888666544


No 89 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=83.27  E-value=0.46  Score=26.88  Aligned_cols=44  Identities=11%  Similarity=0.163  Sum_probs=27.8

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHH
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHM   56 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l   56 (151)
                      +.||.||....-+. .-...        ....+.-+.|.-..||.+|.....+
T Consensus         2 m~CP~Cg~~a~irt-Sr~~s--------~~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHART-SRYIT--------DTTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEE-ChhcC--------hhhheeeeecCCCCCCCEEEEEEEE
Confidence            57999998875555 33333        1244556778333899988876543


No 90 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=82.72  E-value=0.25  Score=24.36  Aligned_cols=38  Identities=16%  Similarity=0.357  Sum_probs=17.2

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCccc
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHT   50 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f   50 (151)
                      ++||.||..-...   ++.+.+    ......-..|.|  ..|+..|
T Consensus         1 ~~Cp~Cg~~~a~~---~~~Q~r----saDE~~T~fy~C--~~C~~~w   38 (39)
T PF01096_consen    1 IKCPKCGHNEAVF---FQIQTR----SADEPMTLFYVC--CNCGHRW   38 (39)
T ss_dssp             S--SSS-SSEEEE---EEESSS----SSSSSSEEEEEE--SSSTEEE
T ss_pred             CCCcCCCCCeEEE---EEeecc----CCCCCCeEEEEe--CCCCCee
Confidence            4688888763322   222210    111111234888  8898776


No 91 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=82.70  E-value=1.2  Score=28.37  Aligned_cols=23  Identities=30%  Similarity=0.394  Sum_probs=17.0

Q ss_pred             eeccccccccccCchHHHHHHhhcCCC
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNL   30 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~   30 (151)
                      ++|.++|+.|    |.|..|..+|.++
T Consensus        77 IicLEDGkkf----KSLKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKF----KSLKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcch----HHHHHHHhcccCC
Confidence            5799999999    6788895554443


No 92 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=82.65  E-value=0.48  Score=31.18  Aligned_cols=34  Identities=18%  Similarity=0.474  Sum_probs=20.0

Q ss_pred             CCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccC
Q psy4404          35 VSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCS   79 (151)
Q Consensus        35 ~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~   79 (151)
                      ....|.|  +.|+..|..-.++..-         |.|+.||..+.
T Consensus       106 ~~~~Y~C--p~c~~r~tf~eA~~~~---------F~Cp~Cg~~L~  139 (158)
T TIGR00373       106 NNMFFIC--PNMCVRFTFNEAMELN---------FTCPRCGAMLD  139 (158)
T ss_pred             CCCeEEC--CCCCcEeeHHHHHHcC---------CcCCCCCCEee
Confidence            3445667  6677666666665432         56666666543


No 93 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.55  E-value=0.53  Score=31.62  Aligned_cols=32  Identities=22%  Similarity=0.596  Sum_probs=16.7

Q ss_pred             cceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccC
Q psy4404          37 FKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCS   79 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~   79 (151)
                      ..|.|  +.|+..|..-.++..    .     |.|+.||..+.
T Consensus       116 ~~Y~C--p~C~~rytf~eA~~~----~-----F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFC--PNCHIRFTFDEAMEY----G-----FRCPQCGEMLE  147 (178)
T ss_pred             CEEEC--CCCCcEEeHHHHhhc----C-----CcCCCCCCCCe
Confidence            44556  556666555555432    1     45666655543


No 94 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=82.48  E-value=0.93  Score=23.60  Aligned_cols=12  Identities=33%  Similarity=0.661  Sum_probs=7.3

Q ss_pred             eecccccccccc
Q psy4404           4 VICQYCEVRLES   15 (151)
Q Consensus         4 ~~C~~C~~~f~~   15 (151)
                      |+|+.||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            556666666643


No 95 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.20  E-value=0.77  Score=20.40  Aligned_cols=19  Identities=21%  Similarity=0.412  Sum_probs=12.5

Q ss_pred             eeccccccccccCchHHHHHH
Q psy4404           4 VICQYCEVRLESNSKELLEHC   24 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~   24 (151)
                      ..||.|++.+ ... .+..|.
T Consensus         2 v~CPiC~~~v-~~~-~in~HL   20 (26)
T smart00734        2 VQCPVCFREV-PEN-LINSHL   20 (26)
T ss_pred             CcCCCCcCcc-cHH-HHHHHH
Confidence            4678888777 334 677774


No 96 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=81.52  E-value=0.85  Score=23.07  Aligned_cols=22  Identities=27%  Similarity=0.473  Sum_probs=17.6

Q ss_pred             eeccccccccccCchHHHHHHhh
Q psy4404           4 VICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      |+|.+|..+-..++ .|..||+.
T Consensus        21 ykcfqcpftc~~ks-hl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKS-HLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHH-HHHHHHHH
Confidence            56888888887777 89999764


No 97 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.13  E-value=1.3  Score=27.89  Aligned_cols=33  Identities=12%  Similarity=0.157  Sum_probs=22.9

Q ss_pred             ceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHH
Q psy4404          38 KYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSA   83 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~   83 (151)
                      +..|  +.||+.|..-           ++.|..|+.||..|.....
T Consensus         9 Kr~C--p~cg~kFYDL-----------nk~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300         9 KRIC--PNTGSKFYDL-----------NRRPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             cccC--CCcCcccccc-----------CCCCccCCCcCCccCcchh
Confidence            3567  8888888773           3457788888888766543


No 98 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=80.49  E-value=0.75  Score=23.88  Aligned_cols=13  Identities=23%  Similarity=0.544  Sum_probs=11.0

Q ss_pred             Cceeecccccccc
Q psy4404           1 MILVICQYCEVRL   13 (151)
Q Consensus         1 ~~~~~C~~C~~~f   13 (151)
                      ++.|+|..||+.|
T Consensus         4 ~~~Y~C~~Cg~~~   16 (49)
T COG1996           4 MMEYKCARCGREV   16 (49)
T ss_pred             eEEEEhhhcCCee
Confidence            4788999999988


No 99 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=79.77  E-value=1.3  Score=21.03  Aligned_cols=8  Identities=63%  Similarity=1.431  Sum_probs=3.8

Q ss_pred             ceeCCcCC
Q psy4404          96 PFKCTICS  103 (151)
Q Consensus        96 ~~~C~~C~  103 (151)
                      |..|+.|+
T Consensus        18 p~~CP~Cg   25 (34)
T cd00729          18 PEKCPICG   25 (34)
T ss_pred             CCcCcCCC
Confidence            34455554


No 100
>PHA00626 hypothetical protein
Probab=79.58  E-value=1.8  Score=23.07  Aligned_cols=14  Identities=36%  Similarity=0.926  Sum_probs=9.2

Q ss_pred             cceeeccCCCCcccCC
Q psy4404          37 FKYVCLYQKCSYHTGN   52 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~   52 (151)
                      ..|.|  +.||..|..
T Consensus        22 nrYkC--kdCGY~ft~   35 (59)
T PHA00626         22 DDYVC--CDCGYNDSK   35 (59)
T ss_pred             cceEc--CCCCCeech
Confidence            44777  777776654


No 101
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=78.89  E-value=0.78  Score=30.04  Aligned_cols=17  Identities=12%  Similarity=0.358  Sum_probs=13.6

Q ss_pred             ceeeccCCCCcccCCchHH
Q psy4404          38 KYVCLYQKCSYHTGNSDHM   56 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~~~~l   56 (151)
                      .+.|  +.||.+|.....+
T Consensus        28 ~~~c--~~c~~~f~~~e~~   44 (154)
T PRK00464         28 RREC--LACGKRFTTFERV   44 (154)
T ss_pred             eeec--cccCCcceEeEec
Confidence            4889  8999999887654


No 102
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=78.53  E-value=1.9  Score=28.33  Aligned_cols=34  Identities=26%  Similarity=0.489  Sum_probs=24.5

Q ss_pred             hcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCcc
Q psy4404          63 HTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHK  105 (151)
Q Consensus        63 h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~  105 (151)
                      ..+..-|.|+.|+..|.....+.         .-|.|+.||..
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            34456688999998887666543         25899999974


No 103
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=78.02  E-value=0.83  Score=20.74  Aligned_cols=18  Identities=17%  Similarity=0.418  Sum_probs=12.0

Q ss_pred             eeccccccccccCchHHHHH
Q psy4404           4 VICQYCEVRLESNSKELLEH   23 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H   23 (151)
                      |.|-.|++.| ... ..+.|
T Consensus         1 ~sCiDC~~~F-~~~-~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDF-DGD-SYKSH   18 (28)
T ss_dssp             EEETTTTEEE-EGG-GTTT-
T ss_pred             CeeecCCCCc-CcC-CcCCC
Confidence            5688888888 444 66666


No 104
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=77.95  E-value=1.3  Score=21.37  Aligned_cols=13  Identities=23%  Similarity=0.478  Sum_probs=7.6

Q ss_pred             ceeeccccccccc
Q psy4404           2 ILVICQYCEVRLE   14 (151)
Q Consensus         2 ~~~~C~~C~~~f~   14 (151)
                      +.|+|..||....
T Consensus         5 ~~YkC~~CGniVe   17 (36)
T PF06397_consen    5 EFYKCEHCGNIVE   17 (36)
T ss_dssp             EEEE-TTT--EEE
T ss_pred             cEEEccCCCCEEE
Confidence            5788999988763


No 105
>KOG2785|consensus
Probab=77.86  E-value=2.3  Score=31.82  Aligned_cols=57  Identities=23%  Similarity=0.477  Sum_probs=39.5

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCCCCCCCCc-----------------ceeeccCCCC---cccCCchHHHHHHHh
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSF-----------------KYVCLYQKCS---YHTGNSDHMRRHIRR   62 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~-----------------~~~C~~~~C~---~~f~~~~~l~~h~~~   62 (151)
                      |--|-.|++.|.+.. .-..||..+++..++.-+-                 .+.|  -.|.   +.|.+-.+.+.||..
T Consensus       166 Pt~CLfC~~~~k~~e-~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~C--L~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLE-ENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFIC--LFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHH-HHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceE--EEeccccCcccccHHHHHHHhh
Confidence            345889999999888 8889998888776655321                 2455  3355   667777777777653


No 106
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=77.85  E-value=1.9  Score=28.66  Aligned_cols=24  Identities=42%  Similarity=1.029  Sum_probs=17.6

Q ss_pred             ceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCc
Q psy4404          68 AFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSH  104 (151)
Q Consensus        68 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  104 (151)
                      .|.|++||..+             -++.|.+|++||-
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCCC
Confidence            58899997543             4466888999984


No 107
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=77.03  E-value=5.6  Score=25.75  Aligned_cols=38  Identities=18%  Similarity=0.512  Sum_probs=24.1

Q ss_pred             CCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccc
Q psy4404          65 GEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKA  106 (151)
Q Consensus        65 ~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  106 (151)
                      +...|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            4456899999988875443221   112 2338999999744


No 108
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=77.01  E-value=1.2  Score=26.77  Aligned_cols=16  Identities=19%  Similarity=0.430  Sum_probs=14.3

Q ss_pred             ceeeccccccccccCc
Q psy4404           2 ILVICQYCEVRLESNS   17 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~   17 (151)
                      |++.|..||..|..-.
T Consensus         1 MpH~CtrCG~vf~~g~   16 (112)
T COG3364           1 MPHQCTRCGEVFDDGS   16 (112)
T ss_pred             CCceeccccccccccc
Confidence            7899999999998866


No 109
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=76.77  E-value=1.6  Score=22.14  Aligned_cols=14  Identities=29%  Similarity=0.570  Sum_probs=9.0

Q ss_pred             ceeecccccccccc
Q psy4404           2 ILVICQYCEVRLES   15 (151)
Q Consensus         2 ~~~~C~~C~~~f~~   15 (151)
                      +.|+|..||..|.-
T Consensus         1 ~~Y~C~~Cg~~~~~   14 (44)
T smart00659        1 MIYICGECGRENEI   14 (44)
T ss_pred             CEEECCCCCCEeec
Confidence            45777777776643


No 110
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=75.47  E-value=1.4  Score=22.62  Aligned_cols=40  Identities=10%  Similarity=0.159  Sum_probs=25.3

Q ss_pred             eccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCc
Q psy4404           5 ICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNS   53 (151)
Q Consensus         5 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~   53 (151)
                      .||.||....-+. ....+        ....+.-+.|.-..||..|...
T Consensus         1 ~CP~Cg~~a~ir~-S~~~s--------~~~~~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen    1 RCPHCGSKARIRT-SRQLS--------PLTRELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             CcCCCCCeeEEEE-chhhC--------cceEEEEEEECCCcCCCEEEEE
Confidence            4889988876666 44444        1233455778666688887543


No 111
>KOG4173|consensus
Probab=74.73  E-value=0.97  Score=30.91  Aligned_cols=73  Identities=16%  Similarity=0.365  Sum_probs=53.0

Q ss_pred             eeccc--cccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhc----------CCCceeC
Q psy4404           4 VICQY--CEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHT----------GEKAFHC   71 (151)
Q Consensus         4 ~~C~~--C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~----------~~~~~~C   71 (151)
                      |.|+.  |..+|.+.. .+..|      -.+-.+   ..|  ..|.+.|++..-|..|+...+          |..-|+|
T Consensus        80 ~~cqvagc~~~~d~lD-~~E~h------Y~~~h~---~sC--s~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~C  147 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALD-DYEHH------YHTLHG---NSC--SFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQC  147 (253)
T ss_pred             ccccccchHHHHhhhh-hHHHh------hhhccc---chh--HHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHH
Confidence            55776  888888888 78888      333333   358  889999999999988876543          2233777


Q ss_pred             cc--cccccCChHHHHHHH
Q psy4404          72 PH--CEYRCSQQSALYNHL   88 (151)
Q Consensus        72 ~~--C~~~~~~~~~l~~h~   88 (151)
                      -+  |+..|.....-+.|+
T Consensus       148 lvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  148 LVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             HHHhhhhhhhhhhhhhhHH
Confidence            54  888888887777776


No 112
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=74.40  E-value=3.2  Score=27.91  Aligned_cols=33  Identities=27%  Similarity=0.685  Sum_probs=23.4

Q ss_pred             CCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccc
Q psy4404          65 GEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKA  106 (151)
Q Consensus        65 ~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f  106 (151)
                      ...-|.|+.|+..|.....+.         .-|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            345688999998887665431         258999999743


No 113
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=73.41  E-value=2.4  Score=24.80  Aligned_cols=11  Identities=18%  Similarity=0.815  Sum_probs=6.2

Q ss_pred             eeCcccccccC
Q psy4404          69 FHCPHCEYRCS   79 (151)
Q Consensus        69 ~~C~~C~~~~~   79 (151)
                      +.|..|+..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            55666655553


No 114
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.22  E-value=4.3  Score=20.20  Aligned_cols=22  Identities=23%  Similarity=0.546  Sum_probs=11.1

Q ss_pred             eeeccccccccccC---chHHHHHH
Q psy4404           3 LVICQYCEVRLESN---SKELLEHC   24 (151)
Q Consensus         3 ~~~C~~C~~~f~~~---~~~l~~H~   24 (151)
                      ..+|..|++.+...   ...|..|+
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            34677777777663   24677775


No 115
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=71.80  E-value=2  Score=19.09  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=6.3

Q ss_pred             eccccccccc
Q psy4404           5 ICQYCEVRLE   14 (151)
Q Consensus         5 ~C~~C~~~f~   14 (151)
                      .|+.||-.|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4667776664


No 116
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=71.54  E-value=2.1  Score=23.00  Aligned_cols=14  Identities=29%  Similarity=0.555  Sum_probs=6.6

Q ss_pred             ceeecccccccccc
Q psy4404           2 ILVICQYCEVRLES   15 (151)
Q Consensus         2 ~~~~C~~C~~~f~~   15 (151)
                      |..+||.|++.+..
T Consensus         1 m~v~CP~C~k~~~~   14 (57)
T PF03884_consen    1 MTVKCPICGKPVEW   14 (57)
T ss_dssp             -EEE-TTT--EEE-
T ss_pred             CcccCCCCCCeecc
Confidence            45678888887655


No 117
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=70.75  E-value=2.1  Score=24.38  Aligned_cols=10  Identities=30%  Similarity=0.673  Sum_probs=5.2

Q ss_pred             eecccccccc
Q psy4404           4 VICQYCEVRL   13 (151)
Q Consensus         4 ~~C~~C~~~f   13 (151)
                      |+|..||..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            4555555543


No 118
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=70.44  E-value=3  Score=20.09  Aligned_cols=14  Identities=21%  Similarity=0.339  Sum_probs=9.4

Q ss_pred             eeccccccccccCc
Q psy4404           4 VICQYCEVRLESNS   17 (151)
Q Consensus         4 ~~C~~C~~~f~~~~   17 (151)
                      ..|+.||++|.-..
T Consensus         2 r~C~~Cg~~Yh~~~   15 (36)
T PF05191_consen    2 RICPKCGRIYHIEF   15 (36)
T ss_dssp             EEETTTTEEEETTT
T ss_pred             cCcCCCCCcccccc
Confidence            46888888875444


No 119
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=70.41  E-value=4.8  Score=24.50  Aligned_cols=25  Identities=24%  Similarity=0.667  Sum_probs=22.9

Q ss_pred             eeC----CcCCccccCHHHHHHHHhhhcC
Q psy4404          97 FKC----TICSHKAARKDHMKRHLQLKHN  121 (151)
Q Consensus        97 ~~C----~~C~~~f~~~~~l~~H~~~~~~  121 (151)
                      |.|    ..|+........+..|.+.+||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998875


No 120
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=70.24  E-value=2.4  Score=20.84  Aligned_cols=14  Identities=14%  Similarity=0.263  Sum_probs=10.2

Q ss_pred             eeeccccccccccC
Q psy4404           3 LVICQYCEVRLESN   16 (151)
Q Consensus         3 ~~~C~~C~~~f~~~   16 (151)
                      +|+|..|++.|=..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            67888888887543


No 121
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=70.23  E-value=1.9  Score=21.59  Aligned_cols=13  Identities=15%  Similarity=0.314  Sum_probs=6.0

Q ss_pred             eeecccccccccc
Q psy4404           3 LVICQYCEVRLES   15 (151)
Q Consensus         3 ~~~C~~C~~~f~~   15 (151)
                      +|+|+.|++.|=.
T Consensus        13 ~~~C~~C~~~FC~   25 (43)
T PF01428_consen   13 PFKCKHCGKSFCL   25 (43)
T ss_dssp             HEE-TTTS-EE-T
T ss_pred             CeECCCCCcccCc
Confidence            4566666666643


No 122
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=70.21  E-value=4.2  Score=20.18  Aligned_cols=23  Identities=22%  Similarity=0.332  Sum_probs=15.2

Q ss_pred             eeccccccccccCc-hHHHHHHhh
Q psy4404           4 VICQYCEVRLESNS-KELLEHCKT   26 (151)
Q Consensus         4 ~~C~~C~~~f~~~~-~~l~~H~~~   26 (151)
                      .+|+.||..|.... .+-..|.+.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~y   37 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKY   37 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHH
Confidence            47899998886655 355566443


No 123
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=69.17  E-value=3.3  Score=19.49  Aligned_cols=13  Identities=23%  Similarity=0.511  Sum_probs=9.7

Q ss_pred             ceeeccccccccc
Q psy4404           2 ILVICQYCEVRLE   14 (151)
Q Consensus         2 ~~~~C~~C~~~f~   14 (151)
                      +.|+|..||....
T Consensus         3 ~~ykC~~CGniv~   15 (34)
T cd00974           3 EVYKCEICGNIVE   15 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            5788888887764


No 124
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=68.69  E-value=2.8  Score=26.60  Aligned_cols=15  Identities=27%  Similarity=0.414  Sum_probs=13.2

Q ss_pred             eeeccccccccccCc
Q psy4404           3 LVICQYCEVRLESNS   17 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~   17 (151)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578999999998876


No 125
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=68.45  E-value=4.4  Score=20.88  Aligned_cols=22  Identities=32%  Similarity=0.727  Sum_probs=14.5

Q ss_pred             eeccccccccccCc----hHHHHHHh
Q psy4404           4 VICQYCEVRLESNS----KELLEHCK   25 (151)
Q Consensus         4 ~~C~~C~~~f~~~~----~~l~~H~~   25 (151)
                      -.|..|++.+....    +.|..|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            45888888876541    37777754


No 126
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=67.70  E-value=2.7  Score=24.95  Aligned_cols=12  Identities=50%  Similarity=1.226  Sum_probs=10.5

Q ss_pred             Cceeeccccccc
Q psy4404           1 MILVICQYCEVR   12 (151)
Q Consensus         1 ~~~~~C~~C~~~   12 (151)
                      |+++.||.||..
T Consensus         1 mlLI~CP~Cg~R   12 (97)
T COG4311           1 MLLIPCPYCGER   12 (97)
T ss_pred             CceecCCCCCCC
Confidence            788999999983


No 127
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=66.87  E-value=15  Score=27.47  Aligned_cols=74  Identities=22%  Similarity=0.356  Sum_probs=49.5

Q ss_pred             eeccCCCCcccCCchHHHHHHHhhcCCCceeCcc----cccccCChHHHHHHHhhhCCCCceeCCc--CC----ccccCH
Q psy4404          40 VCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPH----CEYRCSQQSALYNHLKRHTGEKPFKCTI--CS----HKAARK  109 (151)
Q Consensus        40 ~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~----C~~~~~~~~~l~~h~~~h~~~~~~~C~~--C~----~~f~~~  109 (151)
                      .|  ..|...|.+-+.|..|++..++ +.+.|..    -..-|..-..|-.|.+    .-.|.|..  |.    ..|...
T Consensus       222 ~C--~FC~~~FYdDDEL~~HcR~~HE-~ChICD~v~p~~~QYFK~Y~~Le~HF~----~~hy~ct~qtc~~~k~~vf~~~  294 (493)
T COG5236         222 LC--IFCKIYFYDDDELRRHCRLRHE-ACHICDMVGPIRYQYFKSYEDLEAHFR----NAHYCCTFQTCRVGKCYVFPYH  294 (493)
T ss_pred             hh--hhccceecChHHHHHHHHhhhh-hhhhhhccCccchhhhhCHHHHHHHhh----cCceEEEEEEEecCcEEEeccH
Confidence            47  8899999999999999988664 3455543    2233455555665544    34566643  32    367888


Q ss_pred             HHHHHHHhhhc
Q psy4404         110 DHMKRHLQLKH  120 (151)
Q Consensus       110 ~~l~~H~~~~~  120 (151)
                      ..|..|+...+
T Consensus       295 ~el~~h~~~~h  305 (493)
T COG5236         295 TELLEHLTRFH  305 (493)
T ss_pred             HHHHHHHHHHh
Confidence            88999987655


No 128
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=66.48  E-value=4  Score=19.16  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=9.8

Q ss_pred             ceeeccccccccc
Q psy4404           2 ILVICQYCEVRLE   14 (151)
Q Consensus         2 ~~~~C~~C~~~f~   14 (151)
                      +.|+|..||....
T Consensus         6 ~~ykC~~Cgniv~   18 (34)
T TIGR00319         6 QVYKCEVCGNIVE   18 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            4788888888763


No 129
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=66.32  E-value=4.4  Score=25.91  Aligned_cols=13  Identities=15%  Similarity=0.498  Sum_probs=7.5

Q ss_pred             eeecccccccccc
Q psy4404           3 LVICQYCEVRLES   15 (151)
Q Consensus         3 ~~~C~~C~~~f~~   15 (151)
                      .+.|+.||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3556666666544


No 130
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=66.26  E-value=3.5  Score=25.51  Aligned_cols=12  Identities=33%  Similarity=0.911  Sum_probs=6.6

Q ss_pred             ceeeccCCCCcccC
Q psy4404          38 KYVCLYQKCSYHTG   51 (151)
Q Consensus        38 ~~~C~~~~C~~~f~   51 (151)
                      .|.|  ..||..|.
T Consensus       100 Fy~C--~~Cg~~wr  111 (113)
T COG1594         100 FYKC--TRCGYRWR  111 (113)
T ss_pred             EEEe--cccCCEee
Confidence            3556  55665554


No 131
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=65.72  E-value=3.7  Score=21.33  Aligned_cols=16  Identities=13%  Similarity=0.378  Sum_probs=10.6

Q ss_pred             ceeeccccccccccCc
Q psy4404           2 ILVICQYCEVRLESNS   17 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~   17 (151)
                      +.+.|..||..|.-..
T Consensus         3 k~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTA   18 (49)
T ss_pred             eeEEcccCCCeEEEeh
Confidence            5667777777765544


No 132
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=64.55  E-value=8.6  Score=27.91  Aligned_cols=37  Identities=30%  Similarity=0.520  Sum_probs=30.6

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCccee
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYV   40 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~   40 (151)
                      .+|+|..|=+-|.++. .|..|+..|.-. .+.|...|+
T Consensus        47 ~lyiCe~Clky~~~~~-~l~~H~~~C~~r-~PPG~eIYr   83 (290)
T PLN03238         47 KLYICEYCLKYMRKKK-SLLRHLAKCDIR-QPPGGGIYG   83 (290)
T ss_pred             eEEEcCCCcchhCCHH-HHHHHHHhCCCC-CCCcCEeEe
Confidence            6899999999999999 999998877654 456777776


No 133
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=64.18  E-value=7.9  Score=28.92  Aligned_cols=31  Identities=29%  Similarity=0.517  Sum_probs=24.1

Q ss_pred             HhhhCCCCceeCCcCC-ccccCHHHHHHHHhh
Q psy4404          88 LKRHTGEKPFKCTICS-HKAARKDHMKRHLQL  118 (151)
Q Consensus        88 ~~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~~  118 (151)
                      .+.|.-.+.|.|.+|| +.+.-+..+-+|...
T Consensus       366 ~klhgLd~ef~CEICgNyvy~GR~~FdrHF~E  397 (470)
T COG5188         366 CKLHGLDIEFECEICGNYVYYGRDRFDRHFEE  397 (470)
T ss_pred             HHhcCCCcceeeeecccccccchHHHHhhhhh
Confidence            3567777889999999 677777888888653


No 134
>KOG3408|consensus
Probab=64.02  E-value=3.3  Score=25.82  Aligned_cols=23  Identities=26%  Similarity=0.359  Sum_probs=17.0

Q ss_pred             eeeccccccccccCchHHHHHHhh
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      .|-|-+|.+.|.+.. .|+.|.++
T Consensus        57 qfyCi~CaRyFi~~~-~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAK-ALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchH-HHHHHHhc
Confidence            467888888887777 88888443


No 135
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=63.54  E-value=5.6  Score=20.13  Aligned_cols=9  Identities=22%  Similarity=0.962  Sum_probs=5.3

Q ss_pred             CceeCcccc
Q psy4404          67 KAFHCPHCE   75 (151)
Q Consensus        67 ~~~~C~~C~   75 (151)
                      ..|.|..|+
T Consensus        36 ~~~~C~~C~   44 (46)
T PF12760_consen   36 GRYRCKACR   44 (46)
T ss_pred             CeEECCCCC
Confidence            446666664


No 136
>PF14353 CpXC:  CpXC protein
Probab=63.44  E-value=2  Score=27.00  Aligned_cols=20  Identities=25%  Similarity=0.472  Sum_probs=15.4

Q ss_pred             eeeccccccccccCchHHHHH
Q psy4404           3 LVICQYCEVRLESNSKELLEH   23 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H   23 (151)
                      .|.||.||..|.-.. .+..|
T Consensus        38 ~~~CP~Cg~~~~~~~-p~lY~   57 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEY-PLLYH   57 (128)
T ss_pred             EEECCCCCCceecCC-CEEEE
Confidence            577888888887777 77776


No 137
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=62.04  E-value=4.5  Score=28.07  Aligned_cols=32  Identities=19%  Similarity=0.366  Sum_probs=23.2

Q ss_pred             CCCCCcceeeccCCCCcccCCchHHHHHHHhhcC
Q psy4404          32 RPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTG   65 (151)
Q Consensus        32 ~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~   65 (151)
                      ...++..|.|  +.|++.|.-...+.+|+..-+.
T Consensus        71 ~e~~~~K~~C--~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   71 KEEDEDKWRC--PLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             -SSSSEEEEE---SSS-EESSHHHHHHHHHHH-H
T ss_pred             HHHcCCEECC--CCCCcccCChHHHHHHHhhcCH
Confidence            3456667999  8999999999999999876544


No 138
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=61.32  E-value=18  Score=19.05  Aligned_cols=18  Identities=28%  Similarity=0.650  Sum_probs=8.2

Q ss_pred             HHHHHhhhCCCCceeCCc
Q psy4404          84 LYNHLKRHTGEKPFKCTI  101 (151)
Q Consensus        84 l~~h~~~h~~~~~~~C~~  101 (151)
                      |..|.......++..|..
T Consensus        26 l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   26 LDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             HHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHccCCCCcEECCC
Confidence            455554444444445555


No 139
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=60.41  E-value=6.3  Score=18.99  Aligned_cols=31  Identities=23%  Similarity=0.519  Sum_probs=19.8

Q ss_pred             eeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCC
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKC   46 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C   46 (151)
                      ...||.|+..-     .+..|      -....|...|.|  ..|
T Consensus         5 ~v~CP~C~s~~-----~v~k~------G~~~~G~qryrC--~~C   35 (36)
T PF03811_consen    5 DVHCPRCQSTE-----GVKKN------GKSPSGHQRYRC--KDC   35 (36)
T ss_pred             eeeCCCCCCCC-----cceeC------CCCCCCCEeEec--CcC
Confidence            35688887652     24445      556677777888  776


No 140
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=60.17  E-value=5.1  Score=21.44  Aligned_cols=41  Identities=20%  Similarity=0.417  Sum_probs=20.8

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCccc
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHT   50 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f   50 (151)
                      |-.+|..||+.+.=....+..-      ...-.....|.|  +.|....
T Consensus         1 m~vkC~lCdk~~~Id~~~~~aK------rLrnrPi~tYmC--~eC~~RI   41 (56)
T PF09963_consen    1 MRVKCILCDKKEEIDEDTPEAK------RLRNRPIHTYMC--DECKERI   41 (56)
T ss_pred             CeeEEEecCCEEEeccCCHHHH------HhhcCCCcceeC--hhHHHHH
Confidence            3457777887764433223322      111123445777  7776543


No 141
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=60.06  E-value=5.6  Score=27.62  Aligned_cols=29  Identities=21%  Similarity=0.591  Sum_probs=18.4

Q ss_pred             CCceeCCcCCccccCHHHHHHHHhhhcCC
Q psy4404          94 EKPFKCTICSHKAARKDHMKRHLQLKHNA  122 (151)
Q Consensus        94 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  122 (151)
                      +..|.|..|+|.|.-..-.+.|+...|.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            33477888888888777777777766543


No 142
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=58.36  E-value=4.1  Score=21.38  Aligned_cols=20  Identities=20%  Similarity=0.748  Sum_probs=7.1

Q ss_pred             ceeCcccccccCChHHHHHH
Q psy4404          68 AFHCPHCEYRCSQQSALYNH   87 (151)
Q Consensus        68 ~~~C~~C~~~~~~~~~l~~h   87 (151)
                      .|.|+.|...|-..=+.-.|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            35555555555444444433


No 143
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=56.93  E-value=11  Score=19.23  Aligned_cols=13  Identities=38%  Similarity=1.101  Sum_probs=8.4

Q ss_pred             ceeeccCCCCcccCC
Q psy4404          38 KYVCLYQKCSYHTGN   52 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~   52 (151)
                      .+.|  +.||..+..
T Consensus        20 ~~vC--~~Cg~~~~~   32 (52)
T smart00661       20 RFVC--RKCGYEEPI   32 (52)
T ss_pred             EEEC--CcCCCeEEC
Confidence            5677  777765544


No 144
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=56.49  E-value=5  Score=20.07  Aligned_cols=13  Identities=23%  Similarity=0.539  Sum_probs=7.5

Q ss_pred             eccccccccccCc
Q psy4404           5 ICQYCEVRLESNS   17 (151)
Q Consensus         5 ~C~~C~~~f~~~~   17 (151)
                      +|+.||+.|.-+.
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            3666666665443


No 145
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=56.13  E-value=6.4  Score=19.50  Aligned_cols=11  Identities=45%  Similarity=1.171  Sum_probs=8.2

Q ss_pred             eeecccccccc
Q psy4404           3 LVICQYCEVRL   13 (151)
Q Consensus         3 ~~~C~~C~~~f   13 (151)
                      +..|+.||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            46788888776


No 146
>PF12907 zf-met2:  Zinc-binding
Probab=56.02  E-value=3.8  Score=20.29  Aligned_cols=21  Identities=29%  Similarity=0.713  Sum_probs=14.2

Q ss_pred             eeccccccccccCc--hHHHHHH
Q psy4404           4 VICQYCEVRLESNS--KELLEHC   24 (151)
Q Consensus         4 ~~C~~C~~~f~~~~--~~l~~H~   24 (151)
                      ++|.+|-..|....  +.|..|.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~   24 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHA   24 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHH
Confidence            56888886665544  3688885


No 147
>KOG2807|consensus
Probab=55.28  E-value=28  Score=25.91  Aligned_cols=25  Identities=16%  Similarity=0.323  Sum_probs=18.7

Q ss_pred             CceeCCcCCccccCHHHHHHHHhhh
Q psy4404          95 KPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        95 ~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      ..|.|..|...|-..-+.-.|-..|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            3588888888888777777776665


No 148
>PTZ00064 histone acetyltransferase; Provisional
Probab=54.75  E-value=15  Score=29.00  Aligned_cols=38  Identities=26%  Similarity=0.428  Sum_probs=31.5

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceee
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVC   41 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C   41 (151)
                      ++|+|..|=+-|.+.. .|..|+..|... .+.|...|+.
T Consensus       279 ~LYICEfCLkY~~s~~-~l~rH~~~C~~r-hPPG~EIYR~  316 (552)
T PTZ00064        279 TLHFCEYCLDFFCFED-ELIRHLSRCQLR-HPPGNEIYRK  316 (552)
T ss_pred             eEEEccchhhhhCCHH-HHHHHHhcCCCC-CCCCCeEEEe
Confidence            6899999999999999 999998877654 4567777876


No 149
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=54.56  E-value=9.6  Score=18.10  Aligned_cols=13  Identities=23%  Similarity=0.703  Sum_probs=8.1

Q ss_pred             CcceeeccCCCCccc
Q psy4404          36 SFKYVCLYQKCSYHT   50 (151)
Q Consensus        36 ~~~~~C~~~~C~~~f   50 (151)
                      ...+.|  +.||...
T Consensus        20 r~R~vC--~~Cg~Ih   32 (34)
T PF14803_consen   20 RERLVC--PACGFIH   32 (34)
T ss_dssp             S-EEEE--TTTTEEE
T ss_pred             ccceEC--CCCCCEE
Confidence            345778  7888653


No 150
>KOG3408|consensus
Probab=54.40  E-value=9.5  Score=23.87  Aligned_cols=27  Identities=26%  Similarity=0.517  Sum_probs=21.2

Q ss_pred             CCCceeCCcCCccccCHHHHHHHHhhh
Q psy4404          93 GEKPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        93 ~~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      |.-.|.|..|.+-|.....|..|.++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhcc
Confidence            333488888999999999998888764


No 151
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=54.18  E-value=5.5  Score=20.90  Aligned_cols=13  Identities=23%  Similarity=0.657  Sum_probs=6.0

Q ss_pred             eccccccccccCc
Q psy4404           5 ICQYCEVRLESNS   17 (151)
Q Consensus         5 ~C~~C~~~f~~~~   17 (151)
                      .||.|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            6888888776543


No 152
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=53.12  E-value=5.3  Score=28.52  Aligned_cols=84  Identities=15%  Similarity=0.345  Sum_probs=45.2

Q ss_pred             CCCcceeeccCCCCcccCCchHHHHHHHhh--cCCCceeCcccccccCChH------HHHHHHhh----hCCCCceeCCc
Q psy4404          34 DVSFKYVCLYQKCSYHTGNSDHMRRHIRRH--TGEKAFHCPHCEYRCSQQS------ALYNHLKR----HTGEKPFKCTI  101 (151)
Q Consensus        34 ~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h--~~~~~~~C~~C~~~~~~~~------~l~~h~~~----h~~~~~~~C~~  101 (151)
                      .|.+.|.|  ..|...+..-..+ .|+.+-  .....|+|.-|++.-...-      .--.|.+.    ....+++.|+.
T Consensus       138 hGGrif~C--sfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPK  214 (314)
T PF06524_consen  138 HGGRIFKC--SFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPK  214 (314)
T ss_pred             CCCeEEEe--ecCCCeeeccchh-hhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCC
Confidence            45567888  7788755544443 333321  1122355555554322110      01233332    23346789999


Q ss_pred             CCccccCHHHHHHHHhhhc
Q psy4404         102 CSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus       102 C~~~f~~~~~l~~H~~~~~  120 (151)
                      |+........|.-..|+|.
T Consensus       215 Cg~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  215 CGYETQETKDLSMSTRSHK  233 (314)
T ss_pred             CCCcccccccceeeeecch
Confidence            9987777777766666654


No 153
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=52.80  E-value=15  Score=28.48  Aligned_cols=38  Identities=24%  Similarity=0.454  Sum_probs=31.4

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceee
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVC   41 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C   41 (151)
                      .+|+|..|=+-|.+.. .|..|+..|... .+.|...|+.
T Consensus       197 ~lyiCe~Cl~y~~~~~-~~~~H~~~C~~~-~PPG~eIYr~  234 (450)
T PLN00104        197 KLYFCEFCLKFMKRKE-QLQRHMKKCDLK-HPPGDEIYRH  234 (450)
T ss_pred             eEEEchhhhhhhcCHH-HHHHHHhcCCCC-CCCcCeEEEc
Confidence            5899999999999999 999998777644 4567777876


No 154
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=52.45  E-value=13  Score=18.38  Aligned_cols=10  Identities=20%  Similarity=0.634  Sum_probs=6.1

Q ss_pred             eecccccccc
Q psy4404           4 VICQYCEVRL   13 (151)
Q Consensus         4 ~~C~~C~~~f   13 (151)
                      |+||.||...
T Consensus         1 m~Cp~Cg~~~   10 (43)
T PF08271_consen    1 MKCPNCGSKE   10 (43)
T ss_dssp             ESBTTTSSSE
T ss_pred             CCCcCCcCCc
Confidence            4567776653


No 155
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=51.99  E-value=5.8  Score=23.92  Aligned_cols=11  Identities=27%  Similarity=0.941  Sum_probs=6.4

Q ss_pred             ceeCccccccc
Q psy4404          68 AFHCPHCEYRC   78 (151)
Q Consensus        68 ~~~C~~C~~~~   78 (151)
                      -|.|..|+..+
T Consensus        90 fy~C~~C~~~w  100 (104)
T TIGR01384        90 FYKCTKCGYVW  100 (104)
T ss_pred             EEEeCCCCCee
Confidence            36666666544


No 156
>KOG2593|consensus
Probab=51.80  E-value=10  Score=29.12  Aligned_cols=39  Identities=21%  Similarity=0.435  Sum_probs=23.1

Q ss_pred             CCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCccccccc
Q psy4404          35 VSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRC   78 (151)
Q Consensus        35 ~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~   78 (151)
                      ....|.|  +.|.+.|.+-..+   +..-.....|.|..|+.-.
T Consensus       125 ~~~~Y~C--p~C~kkyt~Lea~---~L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  125 NVAGYVC--PNCQKKYTSLEAL---QLLDNETGEFHCENCGGEL  163 (436)
T ss_pred             ccccccC--CccccchhhhHHH---HhhcccCceEEEecCCCch
Confidence            3445778  7788777665543   2233334457777776554


No 157
>PHA02998 RNA polymerase subunit; Provisional
Probab=50.56  E-value=7.5  Score=26.08  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=6.2

Q ss_pred             eeeccCCCCcccC
Q psy4404          39 YVCLYQKCSYHTG   51 (151)
Q Consensus        39 ~~C~~~~C~~~f~   51 (151)
                      |.|  ..||..|.
T Consensus       172 YkC--~~CG~~wk  182 (195)
T PHA02998        172 HAC--RDCKKHFK  182 (195)
T ss_pred             EEc--CCCCCccC
Confidence            556  55665554


No 158
>KOG2907|consensus
Probab=50.16  E-value=13  Score=22.99  Aligned_cols=10  Identities=40%  Similarity=1.560  Sum_probs=5.1

Q ss_pred             eeCccccccc
Q psy4404          69 FHCPHCEYRC   78 (151)
Q Consensus        69 ~~C~~C~~~~   78 (151)
                      |.|+.|+..|
T Consensus       103 YTC~kC~~k~  112 (116)
T KOG2907|consen  103 YTCPKCKYKF  112 (116)
T ss_pred             EEcCccceee
Confidence            5555555444


No 159
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=49.43  E-value=5.5  Score=27.78  Aligned_cols=22  Identities=23%  Similarity=0.496  Sum_probs=0.0

Q ss_pred             eeeccccccccccCchHHHHHHhh
Q psy4404           3 LVICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      ..+||.||+..-.  ..|..|||+
T Consensus       168 ~~~cPitGe~IP~--~e~~eHmRi  189 (229)
T PF12230_consen  168 MIICPITGEMIPA--DEMDEHMRI  189 (229)
T ss_dssp             ------------------------
T ss_pred             ccccccccccccc--ccccccccc
Confidence            4568888887755  367778654


No 160
>KOG2482|consensus
Probab=49.07  E-value=16  Score=27.32  Aligned_cols=24  Identities=17%  Similarity=0.449  Sum_probs=19.3

Q ss_pred             eeCCcCCccccCHHHHHHHHhhhc
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                      ..|..|....-....|..||++.|
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHH
Confidence            578888887777888888888766


No 161
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=48.95  E-value=15  Score=19.08  Aligned_cols=11  Identities=36%  Similarity=1.144  Sum_probs=5.7

Q ss_pred             ceeeccCCCCccc
Q psy4404          38 KYVCLYQKCSYHT   50 (151)
Q Consensus        38 ~~~C~~~~C~~~f   50 (151)
                      .+.|  +.||..+
T Consensus        37 r~~C--~~Cgyt~   47 (50)
T PRK00432         37 RWHC--GKCGYTE   47 (50)
T ss_pred             cEEC--CCcCCEE
Confidence            3556  5565543


No 162
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=48.61  E-value=9.1  Score=17.91  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=6.1

Q ss_pred             eeccccccccc
Q psy4404           4 VICQYCEVRLE   14 (151)
Q Consensus         4 ~~C~~C~~~f~   14 (151)
                      |+|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            45666666654


No 163
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=47.75  E-value=7.5  Score=22.51  Aligned_cols=11  Identities=18%  Similarity=0.534  Sum_probs=4.9

Q ss_pred             eeCcccccccC
Q psy4404          69 FHCPHCEYRCS   79 (151)
Q Consensus        69 ~~C~~C~~~~~   79 (151)
                      ..|..|+..|.
T Consensus        47 ~~C~~Cg~~~~   57 (81)
T PF05129_consen   47 LSCRVCGESFQ   57 (81)
T ss_dssp             EEESSS--EEE
T ss_pred             EEecCCCCeEE
Confidence            45666655553


No 164
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=46.99  E-value=19  Score=23.05  Aligned_cols=17  Identities=18%  Similarity=0.307  Sum_probs=10.5

Q ss_pred             CCCcceeeccCCCCcccCC
Q psy4404          34 DVSFKYVCLYQKCSYHTGN   52 (151)
Q Consensus        34 ~~~~~~~C~~~~C~~~f~~   52 (151)
                      .+.+-|.|  +.|..+...
T Consensus        76 ~d~~lYeC--nIC~etS~e   92 (140)
T PF05290_consen   76 LDPKLYEC--NICKETSAE   92 (140)
T ss_pred             cCCCceec--cCcccccch
Confidence            34466777  777765444


No 165
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.54  E-value=14  Score=22.70  Aligned_cols=26  Identities=4%  Similarity=-0.033  Sum_probs=17.4

Q ss_pred             CCCCcccCCchHHHHHHHhhcCCCceeCcccccccCC
Q psy4404          44 QKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQ   80 (151)
Q Consensus        44 ~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~   80 (151)
                      +.||+.|..-           +..|..|+.||+.|+.
T Consensus        13 Petg~KFYDL-----------NrdPiVsPytG~s~P~   38 (129)
T COG4530          13 PETGKKFYDL-----------NRDPIVSPYTGKSYPR   38 (129)
T ss_pred             ccccchhhcc-----------CCCccccCcccccchH
Confidence            7777777662           3456777888877743


No 166
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=45.48  E-value=12  Score=17.56  Aligned_cols=11  Identities=18%  Similarity=0.815  Sum_probs=7.1

Q ss_pred             eeccccccccc
Q psy4404           4 VICQYCEVRLE   14 (151)
Q Consensus         4 ~~C~~C~~~f~   14 (151)
                      +.|..||.+|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            45777777663


No 167
>KOG4167|consensus
Probab=45.42  E-value=5.2  Score=32.78  Aligned_cols=27  Identities=15%  Similarity=0.294  Sum_probs=23.1

Q ss_pred             cceeeccCCCCcccCCchHHHHHHHhhcC
Q psy4404          37 FKYVCLYQKCSYHTGNSDHMRRHIRRHTG   65 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~~~~l~~h~~~h~~   65 (151)
                      ..|.|  .+|++.|....++..||+.|.-
T Consensus       791 giFpC--reC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPC--RECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeeh--HHHHHHHHHHhhhhHHHHHHHH
Confidence            35889  8999999999999999998854


No 168
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=45.12  E-value=5  Score=22.54  Aligned_cols=13  Identities=15%  Similarity=0.368  Sum_probs=5.3

Q ss_pred             ceeCcccccccCC
Q psy4404          68 AFHCPHCEYRCSQ   80 (151)
Q Consensus        68 ~~~C~~C~~~~~~   80 (151)
                      ...|..|+..+..
T Consensus        41 ~v~Cg~C~~~~~~   53 (71)
T PF05495_consen   41 RVICGKCRTEQPI   53 (71)
T ss_dssp             EEEETTT--EEES
T ss_pred             CeECCCCCCccCh
Confidence            3455555544433


No 169
>KOG2747|consensus
Probab=45.05  E-value=19  Score=27.49  Aligned_cols=36  Identities=33%  Similarity=0.588  Sum_probs=28.0

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcce
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKY   39 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~   39 (151)
                      ++|+|..|=+-+.+.. .|+.|+..|.-. .+.|...|
T Consensus       157 ~lYiCEfCLkY~~s~~-~l~rH~~kC~~r-hPPG~EIY  192 (396)
T KOG2747|consen  157 KLYICEFCLKYMKSRT-SLQRHLKKCKLR-HPPGNEIY  192 (396)
T ss_pred             eEEEehHHHhHhchHH-HHHHHHHhcCCC-CCCcceee
Confidence            6899999999999999 999998887744 33444433


No 170
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.91  E-value=10  Score=20.87  Aligned_cols=11  Identities=27%  Similarity=0.552  Sum_probs=6.1

Q ss_pred             eeccccccccc
Q psy4404           4 VICQYCEVRLE   14 (151)
Q Consensus         4 ~~C~~C~~~f~   14 (151)
                      .+||.||+.-.
T Consensus         8 v~CP~Cgkpv~   18 (65)
T COG3024           8 VPCPTCGKPVV   18 (65)
T ss_pred             ccCCCCCCccc
Confidence            45666666543


No 171
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=44.88  E-value=9.5  Score=20.38  Aligned_cols=14  Identities=21%  Similarity=0.347  Sum_probs=9.4

Q ss_pred             ceeecccccccccc
Q psy4404           2 ILVICQYCEVRLES   15 (151)
Q Consensus         2 ~~~~C~~C~~~f~~   15 (151)
                      .+.+||.||..-..
T Consensus         2 ~LkPCPFCG~~~~~   15 (61)
T PF14354_consen    2 ELKPCPFCGSADVL   15 (61)
T ss_pred             CCcCCCCCCCcceE
Confidence            46778888866433


No 172
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=44.55  E-value=12  Score=17.21  Aligned_cols=11  Identities=27%  Similarity=0.588  Sum_probs=4.8

Q ss_pred             eeecccccccc
Q psy4404           3 LVICQYCEVRL   13 (151)
Q Consensus         3 ~~~C~~C~~~f   13 (151)
                      .|+|+.|+..+
T Consensus        13 kY~Cp~C~~~~   23 (30)
T PF04438_consen   13 KYRCPRCGARY   23 (30)
T ss_dssp             SEE-TTT--EE
T ss_pred             EEECCCcCCce
Confidence            36677776654


No 173
>KOG0717|consensus
Probab=44.17  E-value=11  Score=29.31  Aligned_cols=23  Identities=22%  Similarity=0.543  Sum_probs=19.4

Q ss_pred             eeCCcCCccccCHHHHHHHHhhh
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      -.|..|+..|-++..|-.|++.-
T Consensus       461 ~~C~tCr~~FdSRnkLF~Hlk~t  483 (508)
T KOG0717|consen  461 ISCTTCRESFDSRNKLFAHLKKT  483 (508)
T ss_pred             HhhhhhhhhccchhHHHHHhhhc
Confidence            46888999999999999998753


No 174
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=44.13  E-value=11  Score=17.38  Aligned_cols=9  Identities=33%  Similarity=0.969  Sum_probs=5.8

Q ss_pred             eeecccccc
Q psy4404           3 LVICQYCEV   11 (151)
Q Consensus         3 ~~~C~~C~~   11 (151)
                      +|+|+.|+-
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            567777764


No 175
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=44.04  E-value=11  Score=17.97  Aligned_cols=13  Identities=15%  Similarity=0.391  Sum_probs=6.0

Q ss_pred             eccccccccccCc
Q psy4404           5 ICQYCEVRLESNS   17 (151)
Q Consensus         5 ~C~~C~~~f~~~~   17 (151)
                      .|.+||+.|....
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            5788888886633


No 176
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=43.97  E-value=19  Score=21.93  Aligned_cols=15  Identities=33%  Similarity=0.587  Sum_probs=10.6

Q ss_pred             ceeeccccccccccC
Q psy4404           2 ILVICQYCEVRLESN   16 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~   16 (151)
                      |+.+|+.||..-.-.
T Consensus         1 ~p~~CpYCg~~~~l~   15 (102)
T PF11672_consen    1 KPIICPYCGGPAELV   15 (102)
T ss_pred             CCcccCCCCCeeEEc
Confidence            567899998874433


No 177
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=43.69  E-value=95  Score=20.58  Aligned_cols=57  Identities=21%  Similarity=0.464  Sum_probs=35.6

Q ss_pred             eeCcccccccCChHHHHHHHhhhCCCCceeCCc--CCccccCHHHHHHHHhhhc-CCccccc
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTI--CSHKAARKDHMKRHLQLKH-NADLSSM  127 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~-~~~~~~~  127 (151)
                      ..||.|.......... .-.+.+...|+-.|..  |... -....|+.|.+..| ..+|-+.
T Consensus        81 L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP~~v  140 (162)
T PF07800_consen   81 LACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARPSEV  140 (162)
T ss_pred             ccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCCccC
Confidence            5788887655544433 3356666777777765  5432 35678999998765 4444443


No 178
>KOG1842|consensus
Probab=42.55  E-value=9.4  Score=29.45  Aligned_cols=22  Identities=27%  Similarity=0.546  Sum_probs=19.6

Q ss_pred             eeccccccccccCchHHHHHHhh
Q psy4404           4 VICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      |.||.|.+.|.+.. .|..|...
T Consensus        16 flCPiC~~dl~~~~-~L~~H~d~   37 (505)
T KOG1842|consen   16 FLCPICLLDLPNLS-ALNDHLDV   37 (505)
T ss_pred             ccCchHhhhhhhHH-HHHHHHhh
Confidence            78999999999999 99999643


No 179
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=42.35  E-value=23  Score=18.19  Aligned_cols=14  Identities=14%  Similarity=0.451  Sum_probs=7.4

Q ss_pred             eeccccccccccCc
Q psy4404           4 VICQYCEVRLESNS   17 (151)
Q Consensus         4 ~~C~~C~~~f~~~~   17 (151)
                      |.|..||-++.-..
T Consensus         2 y~C~~CgyvYd~~~   15 (47)
T PF00301_consen    2 YQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEETTTSBEEETTT
T ss_pred             cCCCCCCEEEcCCc
Confidence            55666665554433


No 180
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=41.81  E-value=13  Score=27.30  Aligned_cols=48  Identities=17%  Similarity=0.302  Sum_probs=30.0

Q ss_pred             eCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHHHhhh
Q psy4404          70 HCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRHLQLK  119 (151)
Q Consensus        70 ~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  119 (151)
                      .|-.|...|+-...-.--.  -+....|.|+.|...|...-+.-.|-..|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~~~--~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPFDE--STSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCcccc--cccccceechhhhhhhhhhhHHHHHHHHh
Confidence            3666766665543211111  12234699999999998888877777665


No 181
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=41.49  E-value=17  Score=28.03  Aligned_cols=15  Identities=20%  Similarity=0.596  Sum_probs=9.5

Q ss_pred             ceeeccCCCCcccCCch
Q psy4404          38 KYVCLYQKCSYHTGNSD   54 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~~~   54 (151)
                      .|+|  +.||..+....
T Consensus       367 g~rC--~kCg~~~~~~~  381 (421)
T COG1571         367 GFRC--KKCGTRARETL  381 (421)
T ss_pred             Cccc--ccccccCCccc
Confidence            4677  66777666544


No 182
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=41.42  E-value=5.4  Score=32.57  Aligned_cols=58  Identities=21%  Similarity=0.388  Sum_probs=0.0

Q ss_pred             eee-ccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccc
Q psy4404           3 LVI-CQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCE   75 (151)
Q Consensus         3 ~~~-C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~   75 (151)
                      ||+ |..||=.|.-.. .|=.=      ....+....-.|  +.|.+-|.+..+-+-|.      .|..|+.||
T Consensus       122 PF~~CT~CGPRfTIi~-alPYD------R~nTsM~~F~lC--~~C~~EY~dP~nRRfHA------Qp~aCp~CG  180 (750)
T COG0068         122 PFINCTNCGPRFTIIE-ALPYD------RENTSMADFPLC--PFCDKEYKDPLNRRFHA------QPIACPKCG  180 (750)
T ss_pred             cccccCCCCcceeeec-cCCCC------cccCccccCcCC--HHHHHHhcCcccccccc------ccccCcccC


No 183
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=40.97  E-value=11  Score=26.36  Aligned_cols=16  Identities=19%  Similarity=0.316  Sum_probs=11.9

Q ss_pred             ceeeccccccccccCc
Q psy4404           2 ILVICQYCEVRLESNS   17 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~   17 (151)
                      ++.+|++||..|+-..
T Consensus       180 kpqRCpECGqVFKLVr  195 (268)
T PTZ00043        180 FLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCccCCCCCcEEEEEE
Confidence            4678999999986544


No 184
>PLN03239 histone acetyltransferase; Provisional
Probab=40.66  E-value=34  Score=25.69  Aligned_cols=39  Identities=26%  Similarity=0.395  Sum_probs=28.8

Q ss_pred             ceeeccccccccccCchHHHHHHhh--cCCCCCCCCCcceee
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKT--CKNLSRPDVSFKYVC   41 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~--~~~~~~~~~~~~~~C   41 (151)
                      .+|+|..|=+-|.+.. .|..|+..  +-..+.+.|...|+.
T Consensus       105 ~lYiCE~Clky~~~~~-~l~~H~~~~~~c~~~~PPG~eIYR~  145 (351)
T PLN03239        105 VLYVCEFSFGFFARKS-ELLRFQAKELPKERRHPPGNEIYRC  145 (351)
T ss_pred             eEEEeccchhhhcCHH-HHHHHHHhhccccCcCCCCCeEEEe
Confidence            5899999999998888 99999643  123444567777776


No 185
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=40.25  E-value=13  Score=19.80  Aligned_cols=13  Identities=15%  Similarity=0.626  Sum_probs=7.7

Q ss_pred             eccccccccccCc
Q psy4404           5 ICQYCEVRLESNS   17 (151)
Q Consensus         5 ~C~~C~~~f~~~~   17 (151)
                      +|+.||+.|....
T Consensus         7 ~C~~Cg~~~~~~d   19 (54)
T PF14446_consen    7 KCPVCGKKFKDGD   19 (54)
T ss_pred             cChhhCCcccCCC
Confidence            4666666665433


No 186
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=40.05  E-value=18  Score=26.72  Aligned_cols=10  Identities=30%  Similarity=0.597  Sum_probs=6.4

Q ss_pred             CceeCCcCCc
Q psy4404          95 KPFKCTICSH  104 (151)
Q Consensus        95 ~~~~C~~C~~  104 (151)
                      +...|..|+.
T Consensus       251 r~e~C~~C~~  260 (309)
T PRK03564        251 KAESCGDCGT  260 (309)
T ss_pred             Eeeecccccc
Confidence            4467777764


No 187
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=39.93  E-value=20  Score=17.52  Aligned_cols=13  Identities=8%  Similarity=0.092  Sum_probs=5.6

Q ss_pred             CCCCcccCCchHH
Q psy4404          44 QKCSYHTGNSDHM   56 (151)
Q Consensus        44 ~~C~~~f~~~~~l   56 (151)
                      +.|+-.|.+...|
T Consensus        23 ~~C~G~W~d~~el   35 (41)
T PF13453_consen   23 PSCGGIWFDAGEL   35 (41)
T ss_pred             CCCCeEEccHHHH
Confidence            4444444444433


No 188
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=39.85  E-value=13  Score=19.98  Aligned_cols=11  Identities=45%  Similarity=1.135  Sum_probs=5.5

Q ss_pred             CCCceeCcccc
Q psy4404          65 GEKAFHCPHCE   75 (151)
Q Consensus        65 ~~~~~~C~~C~   75 (151)
                      |+....|+-|.
T Consensus        41 GE~VArCPSCS   51 (67)
T COG5216          41 GEVVARCPSCS   51 (67)
T ss_pred             CceEEEcCCce
Confidence            44445555553


No 189
>KOG2593|consensus
Probab=39.63  E-value=36  Score=26.25  Aligned_cols=38  Identities=24%  Similarity=0.558  Sum_probs=26.3

Q ss_pred             cCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCc
Q psy4404          64 TGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSH  104 (151)
Q Consensus        64 ~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  104 (151)
                      .....|.|+.|.+.|.....+.   ......-.|.|..|+.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCC
Confidence            3456699999999998766543   2233233689999986


No 190
>KOG2272|consensus
Probab=38.93  E-value=13  Score=26.50  Aligned_cols=13  Identities=23%  Similarity=0.605  Sum_probs=10.3

Q ss_pred             CceeCCcCCcccc
Q psy4404          95 KPFKCTICSHKAA  107 (151)
Q Consensus        95 ~~~~C~~C~~~f~  107 (151)
                      ..|.|..|.+.|.
T Consensus       220 eHFvCa~CekPFl  232 (332)
T KOG2272|consen  220 EHFVCAKCEKPFL  232 (332)
T ss_pred             hheeehhcCCccc
Confidence            4688999998875


No 191
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=38.38  E-value=5.1  Score=29.06  Aligned_cols=35  Identities=14%  Similarity=0.456  Sum_probs=11.8

Q ss_pred             eeCcccccccCChHHHHHHHhhhCCCCceeCCcCCc
Q psy4404          69 FHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSH  104 (151)
Q Consensus        69 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~  104 (151)
                      ..|+.|+..-...-.+.. .....+.+.+.|..|+.
T Consensus       212 ~~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~C~~C~~  246 (290)
T PF04216_consen  212 IKCPYCGNTDHEKLEYFT-VEGEPAYRVEVCESCGS  246 (290)
T ss_dssp             TS-TTT---SS-EEE---------SEEEEEETTTTE
T ss_pred             CCCcCCCCCCCcceeeEe-cCCCCcEEEEECCcccc
Confidence            357777665433322210 11122334466777764


No 192
>PTZ00448 hypothetical protein; Provisional
Probab=38.23  E-value=17  Score=27.38  Aligned_cols=19  Identities=21%  Similarity=0.558  Sum_probs=8.6

Q ss_pred             CCCCcccCCchHHHHHHHh
Q psy4404          44 QKCSYHTGNSDHMRRHIRR   62 (151)
Q Consensus        44 ~~C~~~f~~~~~l~~h~~~   62 (151)
                      ..|+..|.+....+.|+++
T Consensus       318 ~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        318 RKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             cccccccCCHHHHHHHhhh
Confidence            4444444444444444443


No 193
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=37.97  E-value=62  Score=17.24  Aligned_cols=9  Identities=22%  Similarity=0.442  Sum_probs=3.7

Q ss_pred             CCCCcccCC
Q psy4404          44 QKCSYHTGN   52 (151)
Q Consensus        44 ~~C~~~f~~   52 (151)
                      ..|+-.|..
T Consensus        28 ~~C~H~fek   36 (57)
T PF11789_consen   28 KKCGHTFEK   36 (57)
T ss_dssp             SSS--EEEH
T ss_pred             CCCCCeecH
Confidence            456655554


No 194
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=37.80  E-value=15  Score=20.15  Aligned_cols=10  Identities=30%  Similarity=0.664  Sum_probs=6.2

Q ss_pred             eecccccccc
Q psy4404           4 VICQYCEVRL   13 (151)
Q Consensus         4 ~~C~~C~~~f   13 (151)
                      .+||.|++..
T Consensus         7 v~CP~C~k~~   16 (62)
T PRK00418          7 VNCPTCGKPV   16 (62)
T ss_pred             ccCCCCCCcc
Confidence            4566666654


No 195
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=37.63  E-value=22  Score=18.47  Aligned_cols=12  Identities=17%  Similarity=0.523  Sum_probs=6.4

Q ss_pred             eecccccccccc
Q psy4404           4 VICQYCEVRLES   15 (151)
Q Consensus         4 ~~C~~C~~~f~~   15 (151)
                      |+|..||-++.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            455556555543


No 196
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=37.15  E-value=22  Score=29.48  Aligned_cols=11  Identities=27%  Similarity=0.730  Sum_probs=6.0

Q ss_pred             CceeCcccccc
Q psy4404          67 KAFHCPHCEYR   77 (151)
Q Consensus        67 ~~~~C~~C~~~   77 (151)
                      .|..|+.|+..
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            44556666554


No 197
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.83  E-value=10  Score=19.50  Aligned_cols=12  Identities=25%  Similarity=0.658  Sum_probs=6.5

Q ss_pred             eccccccccccC
Q psy4404           5 ICQYCEVRLESN   16 (151)
Q Consensus         5 ~C~~C~~~f~~~   16 (151)
                      +|+.|++-|.-+
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            356666655443


No 198
>TIGR00320 dfx_rbo desulfoferrodoxin. This protein is described in some articles as rubredoxin oxidoreductase (rbo), and its gene shares an operon with the rubredoxin gene in Desulfovibrio vulgaris Hildenborough.
Probab=36.51  E-value=21  Score=22.51  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=11.1

Q ss_pred             ceeeccccccccc
Q psy4404           2 ILVICQYCEVRLE   14 (151)
Q Consensus         2 ~~~~C~~C~~~f~   14 (151)
                      +.|+|+.||..+.
T Consensus         6 ~fYkC~~CGniv~   18 (125)
T TIGR00320         6 QVYKCEVCGNIVE   18 (125)
T ss_pred             cEEECCCCCcEEE
Confidence            4899999999884


No 199
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=36.46  E-value=14  Score=16.15  Aligned_cols=7  Identities=29%  Similarity=1.032  Sum_probs=3.2

Q ss_pred             ecccccc
Q psy4404           5 ICQYCEV   11 (151)
Q Consensus         5 ~C~~C~~   11 (151)
                      .|+.||.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            3444444


No 200
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=36.44  E-value=27  Score=22.12  Aligned_cols=14  Identities=21%  Similarity=0.560  Sum_probs=7.5

Q ss_pred             cceeeccCCCCcccCC
Q psy4404          37 FKYVCLYQKCSYHTGN   52 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~   52 (151)
                      ..|.|  ..|++.|..
T Consensus        52 qRyrC--~~C~~tf~~   65 (129)
T COG3677          52 QRYKC--KSCGSTFTV   65 (129)
T ss_pred             ccccc--CCcCcceee
Confidence            34555  556555544


No 201
>KOG0717|consensus
Probab=36.41  E-value=17  Score=28.32  Aligned_cols=24  Identities=25%  Similarity=0.587  Sum_probs=16.4

Q ss_pred             eeccccccccccCchHHHHHHhhcC
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCK   28 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~   28 (151)
                      ..|..|+.+|.++. -|..|++.-+
T Consensus       461 ~~C~tCr~~FdSRn-kLF~Hlk~tg  484 (508)
T KOG0717|consen  461 ISCTTCRESFDSRN-KLFAHLKKTG  484 (508)
T ss_pred             Hhhhhhhhhccchh-HHHHHhhhcC
Confidence            45777777777777 7777764433


No 202
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=36.40  E-value=33  Score=25.78  Aligned_cols=29  Identities=31%  Similarity=0.613  Sum_probs=24.4

Q ss_pred             CceeeccccccccccCchHHHHHHhhcCCC
Q psy4404           1 MILVICQYCEVRLESNSKELLEHCKTCKNL   30 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~   30 (151)
                      .++|+|..|=+-|.+.. .|+.|.+.|.=.
T Consensus       156 d~vyICefClkY~~s~~-~~~rH~~kC~~~  184 (395)
T COG5027         156 DIVYICEFCLKYYGSQT-SLVRHRKKCSLQ  184 (395)
T ss_pred             ceEEEhhhhHHHhcchh-HHHHHHhcCcCc
Confidence            36899999999999999 999997766533


No 203
>COG1773 Rubredoxin [Energy production and conversion]
Probab=36.17  E-value=20  Score=19.11  Aligned_cols=17  Identities=18%  Similarity=0.341  Sum_probs=9.1

Q ss_pred             CceeeccccccccccCc
Q psy4404           1 MILVICQYCEVRLESNS   17 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~   17 (151)
                      |+.|.|..||-+|.-..
T Consensus         1 m~~~~C~~CG~vYd~e~   17 (55)
T COG1773           1 MKRWRCSVCGYVYDPEK   17 (55)
T ss_pred             CCceEecCCceEecccc
Confidence            34556666666654433


No 204
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.76  E-value=20  Score=27.99  Aligned_cols=21  Identities=24%  Similarity=0.604  Sum_probs=18.8

Q ss_pred             eccccccccccCchHHHHHHhh
Q psy4404           5 ICQYCEVRLESNSKELLEHCKT   26 (151)
Q Consensus         5 ~C~~C~~~f~~~~~~l~~H~~~   26 (151)
                      .|+.|+++|.... .+..|+..
T Consensus        59 iCp~CskkF~d~~-~~~~H~~~   79 (466)
T PF04780_consen   59 ICPRCSKKFSDAE-SCLSHMEQ   79 (466)
T ss_pred             eCCcccceeCCHH-HHHHHHHH
Confidence            6999999999998 99999764


No 205
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=34.16  E-value=22  Score=22.71  Aligned_cols=11  Identities=27%  Similarity=0.782  Sum_probs=7.1

Q ss_pred             ceeCccccccc
Q psy4404          68 AFHCPHCEYRC   78 (151)
Q Consensus        68 ~~~C~~C~~~~   78 (151)
                      ...||.|++.-
T Consensus       105 ~~~CPwCg~~g  115 (131)
T PF15616_consen  105 EVTCPWCGNEG  115 (131)
T ss_pred             CEECCCCCCee
Confidence            46777777653


No 206
>PRK01343 zinc-binding protein; Provisional
Probab=34.02  E-value=19  Score=19.37  Aligned_cols=11  Identities=18%  Similarity=0.302  Sum_probs=6.9

Q ss_pred             eeccccccccc
Q psy4404           4 VICQYCEVRLE   14 (151)
Q Consensus         4 ~~C~~C~~~f~   14 (151)
                      .+|+.|++.|.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            35777777653


No 207
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=33.82  E-value=17  Score=19.16  Aligned_cols=11  Identities=36%  Similarity=0.899  Sum_probs=6.8

Q ss_pred             ecccccccccc
Q psy4404           5 ICQYCEVRLES   15 (151)
Q Consensus         5 ~C~~C~~~f~~   15 (151)
                      .||.||..+..
T Consensus         2 ~CPyCge~~~~   12 (52)
T PF14255_consen    2 QCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCeeEE
Confidence            46777766543


No 208
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=33.59  E-value=20  Score=17.56  Aligned_cols=12  Identities=17%  Similarity=0.595  Sum_probs=8.0

Q ss_pred             eecccccccccc
Q psy4404           4 VICQYCEVRLES   15 (151)
Q Consensus         4 ~~C~~C~~~f~~   15 (151)
                      +.|+.||..+.+
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            358888877644


No 209
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=33.43  E-value=19  Score=17.31  Aligned_cols=11  Identities=18%  Similarity=0.588  Sum_probs=5.5

Q ss_pred             ecccccccccc
Q psy4404           5 ICQYCEVRLES   15 (151)
Q Consensus         5 ~C~~C~~~f~~   15 (151)
                      .|+.|++.|--
T Consensus         4 ~CprC~kg~Hw   14 (36)
T PF14787_consen    4 LCPRCGKGFHW   14 (36)
T ss_dssp             C-TTTSSSCS-
T ss_pred             cCcccCCCcch
Confidence            36667666543


No 210
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=33.13  E-value=21  Score=21.20  Aligned_cols=10  Identities=20%  Similarity=0.713  Sum_probs=5.7

Q ss_pred             eeeccccccc
Q psy4404           3 LVICQYCEVR   12 (151)
Q Consensus         3 ~~~C~~C~~~   12 (151)
                      .|.||.||+.
T Consensus        35 ky~Cp~Cgk~   44 (90)
T PF01780_consen   35 KYTCPFCGKT   44 (90)
T ss_dssp             -BEESSSSSS
T ss_pred             CCcCCCCCCc
Confidence            3566666665


No 211
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=32.92  E-value=18  Score=23.75  Aligned_cols=27  Identities=15%  Similarity=0.198  Sum_probs=19.5

Q ss_pred             CCCCceeCCcCCccccCHHHHHHHHhh
Q psy4404          92 TGEKPFKCTICSHKAARKDHMKRHLQL  118 (151)
Q Consensus        92 ~~~~~~~C~~C~~~f~~~~~l~~H~~~  118 (151)
                      +.+.|..|..||+.|.|......-.+.
T Consensus        64 ~~~~PsYC~~CGkpyPWt~~~L~aa~e   90 (158)
T PF10083_consen   64 HYEAPSYCHNCGKPYPWTENALEAANE   90 (158)
T ss_pred             CCCCChhHHhCCCCCchHHHHHHHHHH
Confidence            335788999999999987665554443


No 212
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=32.71  E-value=17  Score=19.78  Aligned_cols=16  Identities=25%  Similarity=0.357  Sum_probs=9.8

Q ss_pred             ceeeccccccccccCc
Q psy4404           2 ILVICQYCEVRLESNS   17 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~   17 (151)
                      .|..|..||+...+.-
T Consensus         3 iPVRCFTCGkvi~~~~   18 (60)
T PF01194_consen    3 IPVRCFTCGKVIGNKW   18 (60)
T ss_dssp             -SSS-STTTSBTCGHH
T ss_pred             CceecCCCCCChhHhH
Confidence            4566888888776654


No 213
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=32.08  E-value=32  Score=21.10  Aligned_cols=30  Identities=17%  Similarity=0.571  Sum_probs=19.1

Q ss_pred             eccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCch
Q psy4404           5 ICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSD   54 (151)
Q Consensus         5 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~   54 (151)
                      .||.|+..|.+..                  ..-|.|  ++|+.-|....
T Consensus         4 ~CP~C~seytY~d------------------g~~~iC--peC~~EW~~~~   33 (109)
T TIGR00686         4 PCPKCNSEYTYHD------------------GTQLIC--PSCLYEWNENE   33 (109)
T ss_pred             cCCcCCCcceEec------------------CCeeEC--ccccccccccc
Confidence            4777776665543                  223778  88887776543


No 214
>KOG1280|consensus
Probab=31.95  E-value=47  Score=24.96  Aligned_cols=21  Identities=19%  Similarity=0.441  Sum_probs=13.0

Q ss_pred             eeeccccccccccCchHHHHHH
Q psy4404           3 LVICQYCEVRLESNSKELLEHC   24 (151)
Q Consensus         3 ~~~C~~C~~~f~~~~~~l~~H~   24 (151)
                      .|.||.|+++=.+.. .|+.|+
T Consensus        79 SftCPyC~~~Gfte~-~f~~Hv   99 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTER-QFGTHV   99 (381)
T ss_pred             cccCCcccccccchh-HHHHHh
Confidence            466666666655555 666665


No 215
>PRK10220 hypothetical protein; Provisional
Probab=31.90  E-value=39  Score=20.77  Aligned_cols=33  Identities=18%  Similarity=0.506  Sum_probs=21.7

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCch
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSD   54 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~   54 (151)
                      .+=.||.|+..|.+..                  ..-|.|  +.|+.-|....
T Consensus         2 ~lP~CP~C~seytY~d------------------~~~~vC--peC~hEW~~~~   34 (111)
T PRK10220          2 SLPHCPKCNSEYTYED------------------NGMYIC--PECAHEWNDAE   34 (111)
T ss_pred             CCCcCCCCCCcceEcC------------------CCeEEC--CcccCcCCccc
Confidence            3445888887776544                  123888  88888777654


No 216
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=31.62  E-value=22  Score=18.95  Aligned_cols=10  Identities=30%  Similarity=0.966  Sum_probs=7.7

Q ss_pred             cccccccccc
Q psy4404           6 CQYCEVRLES   15 (151)
Q Consensus         6 C~~C~~~f~~   15 (151)
                      ||.||+.|..
T Consensus        42 CPfC~~~~~~   51 (55)
T PF14447_consen   42 CPFCGTPFEF   51 (55)
T ss_pred             CCCCCCcccC
Confidence            8888888754


No 217
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=31.46  E-value=34  Score=16.59  Aligned_cols=12  Identities=33%  Similarity=0.744  Sum_probs=3.3

Q ss_pred             ceeecccccccc
Q psy4404           2 ILVICQYCEVRL   13 (151)
Q Consensus         2 ~~~~C~~C~~~f   13 (151)
                      +-|-|+.|+..|
T Consensus         2 ~ryyCdyC~~~~   13 (38)
T PF06220_consen    2 PRYYCDYCKKYL   13 (38)
T ss_dssp             -S-B-TTT--B-
T ss_pred             cCeeccccccee
Confidence            345555555555


No 218
>KOG4124|consensus
Probab=31.30  E-value=6.3  Score=29.37  Aligned_cols=71  Identities=21%  Similarity=0.408  Sum_probs=40.5

Q ss_pred             CcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCChHHHHHHHhhhCCCCceeCCcCCccccCHHHHHHH
Q psy4404          36 SFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQQSALYNHLKRHTGEKPFKCTICSHKAARKDHMKRH  115 (151)
Q Consensus        36 ~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H  115 (151)
                      .++|.|+++.|.+.+.....|..|...-+      |......  .+ .-..|+-.....|+|+|++|.+++.....|..|
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h------~s~i~~~--s~-~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~  417 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGH------CSPITTP--TP-APIPHQGFVVENKPYRCEVCSKRYKNLNGLKYH  417 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCc------CCCCCCC--CC-CCCCcceeeeccCcccChhhhhhhccCCCCCce
Confidence            34688888889998888877766643221      1111000  00 111233233446789999998877665555444


No 219
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=31.22  E-value=39  Score=18.44  Aligned_cols=12  Identities=25%  Similarity=0.808  Sum_probs=6.7

Q ss_pred             CceeCCcCCccc
Q psy4404          95 KPFKCTICSHKA  106 (151)
Q Consensus        95 ~~~~C~~C~~~f  106 (151)
                      +.|.|+.||...
T Consensus        45 r~~~C~~Cg~~~   56 (69)
T PF07282_consen   45 RVFTCPNCGFEM   56 (69)
T ss_pred             ceEEcCCCCCEE
Confidence            346666666543


No 220
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=30.95  E-value=72  Score=28.46  Aligned_cols=9  Identities=22%  Similarity=0.597  Sum_probs=5.9

Q ss_pred             eeccccccc
Q psy4404           4 VICQYCEVR   12 (151)
Q Consensus         4 ~~C~~C~~~   12 (151)
                      ++||.||..
T Consensus       668 rkCPkCG~~  676 (1337)
T PRK14714        668 RRCPSCGTE  676 (1337)
T ss_pred             EECCCCCCc
Confidence            567777764


No 221
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=30.85  E-value=46  Score=17.77  Aligned_cols=14  Identities=21%  Similarity=0.572  Sum_probs=8.2

Q ss_pred             CCCceeCCcCCccc
Q psy4404          93 GEKPFKCTICSHKA  106 (151)
Q Consensus        93 ~~~~~~C~~C~~~f  106 (151)
                      +...|.|+.||..+
T Consensus        11 ~~v~~~Cp~cGipt   24 (55)
T PF13824_consen   11 AHVNFECPDCGIPT   24 (55)
T ss_pred             cccCCcCCCCCCcC
Confidence            34456777777543


No 222
>KOG3497|consensus
Probab=30.77  E-value=26  Score=19.05  Aligned_cols=16  Identities=19%  Similarity=0.343  Sum_probs=10.5

Q ss_pred             ceeeccccccccccCc
Q psy4404           2 ILVICQYCEVRLESNS   17 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~   17 (151)
                      .|..|..|||...++=
T Consensus         3 iPiRCFtCGKvig~KW   18 (69)
T KOG3497|consen    3 IPIRCFTCGKVIGDKW   18 (69)
T ss_pred             eeeEeeeccccccccH
Confidence            3566777777766654


No 223
>KOG3507|consensus
Probab=30.35  E-value=29  Score=18.76  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=5.6

Q ss_pred             ceeecccccc
Q psy4404           2 ILVICQYCEV   11 (151)
Q Consensus         2 ~~~~C~~C~~   11 (151)
                      +.|+|..||.
T Consensus        19 miYiCgdC~~   28 (62)
T KOG3507|consen   19 MIYICGDCGQ   28 (62)
T ss_pred             EEEEeccccc
Confidence            4556666654


No 224
>PF08782 c-SKI_SMAD_bind:  c-SKI Smad4 binding domain;  InterPro: IPR014890 c-SKI is an oncoprotein that inhibits TGF-beta signalling through interaction with Smad proteins []. This protein binds to Smad4 [].; GO: 0005634 nucleus; PDB: 1MR1_C.
Probab=29.76  E-value=21  Score=21.45  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=7.7

Q ss_pred             eeccccccccccCchHHHHH
Q psy4404           4 VICQYCEVRLESNSKELLEH   23 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H   23 (151)
                      +.|..|+..| +.. .+..|
T Consensus        29 I~C~~C~~~F-sP~-kFV~H   46 (96)
T PF08782_consen   29 IECLECRGMF-SPQ-KFVFH   46 (96)
T ss_dssp             EEETTT--EE--HH-HHTT-
T ss_pred             eEcccCCCEe-CCc-CEEEe
Confidence            4566666665 333 45555


No 225
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=29.51  E-value=23  Score=21.50  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=7.5

Q ss_pred             eecccccccccc
Q psy4404           4 VICQYCEVRLES   15 (151)
Q Consensus         4 ~~C~~C~~~f~~   15 (151)
                      ..||.||.-|..
T Consensus        50 t~CP~Cg~~~e~   61 (115)
T COG1885          50 TSCPKCGEPFES   61 (115)
T ss_pred             ccCCCCCCccce
Confidence            457777766543


No 226
>KOG1280|consensus
Probab=29.51  E-value=76  Score=23.90  Aligned_cols=24  Identities=13%  Similarity=0.344  Sum_probs=12.4

Q ss_pred             CcceeeccCCCCcccCCchHHHHHHH
Q psy4404          36 SFKYVCLYQKCSYHTGNSDHMRRHIR   61 (151)
Q Consensus        36 ~~~~~C~~~~C~~~f~~~~~l~~h~~   61 (151)
                      +..|.|  +.|+..-.+...|..|..
T Consensus        77 ~qSftC--PyC~~~Gfte~~f~~Hv~  100 (381)
T KOG1280|consen   77 PQSFTC--PYCGIMGFTERQFGTHVL  100 (381)
T ss_pred             cccccC--CcccccccchhHHHHHhh
Confidence            334555  555555555555555543


No 227
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=29.32  E-value=36  Score=22.32  Aligned_cols=8  Identities=25%  Similarity=1.090  Sum_probs=3.9

Q ss_pred             ceeCCcCC
Q psy4404          96 PFKCTICS  103 (151)
Q Consensus        96 ~~~C~~C~  103 (151)
                      .|.|..|+
T Consensus       140 ~YrC~~C~  147 (156)
T COG3091         140 VYRCGKCG  147 (156)
T ss_pred             eEEeccCC
Confidence            45555554


No 228
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=29.26  E-value=19  Score=15.31  Aligned_cols=6  Identities=33%  Similarity=1.143  Sum_probs=2.9

Q ss_pred             cccccc
Q psy4404           6 CQYCEV   11 (151)
Q Consensus         6 C~~C~~   11 (151)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444544


No 229
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=29.04  E-value=19  Score=19.99  Aligned_cols=38  Identities=16%  Similarity=0.258  Sum_probs=18.6

Q ss_pred             ceeeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccC
Q psy4404           2 ILVICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTG   51 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~   51 (151)
                      +.|.|..|+..-....+....|          .|--.-+|  +.|.....
T Consensus         3 l~FTC~~C~~Rs~~~~sk~aY~----------~GvViv~C--~gC~~~Hl   40 (66)
T PF05180_consen    3 LTFTCNKCGTRSAKMFSKQAYH----------KGVVIVQC--PGCKNRHL   40 (66)
T ss_dssp             EEEEETTTTEEEEEEEEHHHHH----------TSEEEEE---TTS--EEE
T ss_pred             EEEEcCCCCCccceeeCHHHHh----------CCeEEEEC--CCCcceee
Confidence            4678888875532222122233          45555667  77876533


No 230
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=28.98  E-value=52  Score=25.83  Aligned_cols=24  Identities=25%  Similarity=0.580  Sum_probs=18.2

Q ss_pred             eeCCcCCccccCHHHHHHHHhhhc
Q psy4404          97 FKCTICSHKAARKDHMKRHLQLKH  120 (151)
Q Consensus        97 ~~C~~C~~~f~~~~~l~~H~~~~~  120 (151)
                      |.|+.|.+.|.....+..|+...|
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhh
Confidence            678888888888888888877544


No 231
>PF14369 zf-RING_3:  zinc-finger
Probab=28.38  E-value=27  Score=16.62  Aligned_cols=10  Identities=20%  Similarity=0.547  Sum_probs=7.5

Q ss_pred             eccccccccc
Q psy4404           5 ICQYCEVRLE   14 (151)
Q Consensus         5 ~C~~C~~~f~   14 (151)
                      .||.|+..|-
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4888888774


No 232
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=28.19  E-value=34  Score=15.31  Aligned_cols=12  Identities=25%  Similarity=0.658  Sum_probs=4.0

Q ss_pred             ceeecccccccc
Q psy4404           2 ILVICQYCEVRL   13 (151)
Q Consensus         2 ~~~~C~~C~~~f   13 (151)
                      ..|.|.+|+-.+
T Consensus        14 ~~Y~C~~Cdf~l   25 (30)
T PF07649_consen   14 WFYRCSECDFDL   25 (30)
T ss_dssp             -EEE-TTT----
T ss_pred             ceEECccCCCcc
Confidence            456677766443


No 233
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=28.10  E-value=23  Score=19.49  Aligned_cols=9  Identities=22%  Similarity=0.552  Sum_probs=5.7

Q ss_pred             eeccccccc
Q psy4404           4 VICQYCEVR   12 (151)
Q Consensus         4 ~~C~~C~~~   12 (151)
                      |+|+.||..
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            467777664


No 234
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=28.00  E-value=22  Score=18.54  Aligned_cols=12  Identities=17%  Similarity=0.545  Sum_probs=8.0

Q ss_pred             eeeccCCCCcccCC
Q psy4404          39 YVCLYQKCSYHTGN   52 (151)
Q Consensus        39 ~~C~~~~C~~~f~~   52 (151)
                      +.|  ..|+.....
T Consensus        27 ~~C--~~Cga~~~~   38 (53)
T TIGR03655        27 FEC--STCGASGPV   38 (53)
T ss_pred             EEC--CCCCCCccc
Confidence            467  778776555


No 235
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=27.63  E-value=20  Score=24.55  Aligned_cols=23  Identities=17%  Similarity=0.348  Sum_probs=0.0

Q ss_pred             ceeeccccccccccCchHHHHHH
Q psy4404           2 ILVICQYCEVRLESNSKELLEHC   24 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~~~l~~H~   24 (151)
                      +.|+|.+||...=.-.+++..|+
T Consensus       100 ~ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen  100 VEYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             -----------------------
T ss_pred             CeeeeEeCCCcceecHHHHHHhc
Confidence            45788888876433334777773


No 236
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=27.54  E-value=44  Score=21.55  Aligned_cols=46  Identities=20%  Similarity=0.221  Sum_probs=27.4

Q ss_pred             ceeeccCCCCcccCCchHHHHHHHhh-----cCCCceeCcccccccCChHHHH
Q psy4404          38 KYVCLYQKCSYHTGNSDHMRRHIRRH-----TGEKAFHCPHCEYRCSQQSALY   85 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~~~~l~~h~~~h-----~~~~~~~C~~C~~~~~~~~~l~   85 (151)
                      .-.|  ..|+..+.....-..-..+.     .....+.|+.|++.|..-+.+.
T Consensus        91 ~sRC--~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen   91 FSRC--PKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             CCcc--CCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHH
Confidence            4678  88988765543211111111     1234688999999998766554


No 237
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=27.47  E-value=21  Score=19.07  Aligned_cols=10  Identities=20%  Similarity=0.703  Sum_probs=2.3

Q ss_pred             eeeccccccc
Q psy4404           3 LVICQYCEVR   12 (151)
Q Consensus         3 ~~~C~~C~~~   12 (151)
                      -|+|+.||.+
T Consensus        33 ~y~Cp~CgAt   42 (55)
T PF05741_consen   33 KYVCPICGAT   42 (55)
T ss_dssp             G---TTT---
T ss_pred             cCcCCCCcCc
Confidence            3556666654


No 238
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.05  E-value=76  Score=18.30  Aligned_cols=27  Identities=15%  Similarity=0.158  Sum_probs=17.4

Q ss_pred             CCCcceeeccCCCCcccCCchHHHHHHHh
Q psy4404          34 DVSFKYVCLYQKCSYHTGNSDHMRRHIRR   62 (151)
Q Consensus        34 ~~~~~~~C~~~~C~~~f~~~~~l~~h~~~   62 (151)
                      .+...-.|  +.|+-.+.+...|.+-+..
T Consensus        17 s~vEiD~C--PrCrGVWLDrGELdKli~r   43 (88)
T COG3809          17 SGVEIDYC--PRCRGVWLDRGELDKLIER   43 (88)
T ss_pred             cCceeeeC--CccccEeecchhHHHHHHH
Confidence            34344557  7788888887777666543


No 239
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=26.91  E-value=82  Score=19.05  Aligned_cols=12  Identities=17%  Similarity=0.495  Sum_probs=7.4

Q ss_pred             eeCcccccccCC
Q psy4404          69 FHCPHCEYRCSQ   80 (151)
Q Consensus        69 ~~C~~C~~~~~~   80 (151)
                      ..|+.|+..+..
T Consensus        43 ~~C~~CG~y~~~   54 (99)
T PRK14892         43 ITCGNCGLYTEF   54 (99)
T ss_pred             EECCCCCCccCE
Confidence            567777765543


No 240
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=26.82  E-value=29  Score=15.53  Aligned_cols=11  Identities=27%  Similarity=0.531  Sum_probs=3.9

Q ss_pred             ecccccccccc
Q psy4404           5 ICQYCEVRLES   15 (151)
Q Consensus         5 ~C~~C~~~f~~   15 (151)
                      +|+.|+..+..
T Consensus         3 ~C~rC~~~~~~   13 (30)
T PF06827_consen    3 KCPRCWNYIED   13 (30)
T ss_dssp             B-TTT--BBEE
T ss_pred             cCccCCCcceE
Confidence            35555555433


No 241
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=26.63  E-value=26  Score=21.17  Aligned_cols=40  Identities=13%  Similarity=0.358  Sum_probs=22.9

Q ss_pred             CCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccCC
Q psy4404          35 VSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCSQ   80 (151)
Q Consensus        35 ~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~~   80 (151)
                      -++.|.|  +.|+..-...-.+..-    .......|..|+..|..
T Consensus        19 L~k~FtC--p~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~e~   58 (104)
T COG4888          19 LPKTFTC--PRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             CCceEec--CccCCeeeeEEEEEec----CceeEEEcccCcceEEE
Confidence            3566888  7788765554333222    22334567777776644


No 242
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=26.58  E-value=31  Score=17.76  Aligned_cols=6  Identities=17%  Similarity=0.440  Sum_probs=2.2

Q ss_pred             cccccc
Q psy4404           7 QYCEVR   12 (151)
Q Consensus         7 ~~C~~~   12 (151)
                      |.||..
T Consensus         2 P~Cg~~    7 (50)
T PF14375_consen    2 PRCGAP    7 (50)
T ss_pred             CCCCCc
Confidence            333333


No 243
>KOG2636|consensus
Probab=26.54  E-value=61  Score=25.29  Aligned_cols=32  Identities=22%  Similarity=0.406  Sum_probs=25.6

Q ss_pred             HhhhCCCCceeCCcCC-ccccCHHHHHHHHhhh
Q psy4404          88 LKRHTGEKPFKCTICS-HKAARKDHMKRHLQLK  119 (151)
Q Consensus        88 ~~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~~~  119 (151)
                      .+.|.-...|.|.+|| ..+.-+..+.+|....
T Consensus       393 yKLHGL~~ey~CEICGNy~Y~GrkaF~RHF~Ew  425 (497)
T KOG2636|consen  393 YKLHGLDIEYNCEICGNYVYKGRKAFDRHFNEW  425 (497)
T ss_pred             HhhcCCCcccceeeccCccccCcHHHHHHhHHH
Confidence            4667777789999999 7888888888887753


No 244
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=26.04  E-value=16  Score=20.04  Aligned_cols=10  Identities=20%  Similarity=0.697  Sum_probs=4.4

Q ss_pred             eccccccccc
Q psy4404           5 ICQYCEVRLE   14 (151)
Q Consensus         5 ~C~~C~~~f~   14 (151)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            5888999983


No 245
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=26.00  E-value=37  Score=20.99  Aligned_cols=10  Identities=30%  Similarity=0.979  Sum_probs=5.6

Q ss_pred             eeCccccccc
Q psy4404          69 FHCPHCEYRC   78 (151)
Q Consensus        69 ~~C~~C~~~~   78 (151)
                      |-|+.||...
T Consensus        75 yyCP~Cgt~l   84 (112)
T PF08882_consen   75 YYCPGCGTQL   84 (112)
T ss_pred             EECCCCccee
Confidence            5566665443


No 246
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=25.65  E-value=34  Score=23.01  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=6.7

Q ss_pred             eeccccccccccC
Q psy4404           4 VICQYCEVRLESN   16 (151)
Q Consensus         4 ~~C~~C~~~f~~~   16 (151)
                      +.|..||+.|...
T Consensus       115 ~~C~~Cg~~f~~~  127 (181)
T PRK08222        115 QRCSRCERPFAPQ  127 (181)
T ss_pred             CcCcccCCccCcH
Confidence            3455555555543


No 247
>KOG0978|consensus
Probab=25.37  E-value=12  Score=30.78  Aligned_cols=16  Identities=19%  Similarity=0.561  Sum_probs=11.3

Q ss_pred             eCcccccccCChHHHH
Q psy4404          70 HCPHCEYRCSQQSALY   85 (151)
Q Consensus        70 ~C~~C~~~~~~~~~l~   85 (151)
                      .||.|+.+|.......
T Consensus       680 KCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  680 KCPKCNAAFGANDVHR  695 (698)
T ss_pred             CCCCCCCCCCcccccc
Confidence            5888888887766543


No 248
>PRK12496 hypothetical protein; Provisional
Probab=25.27  E-value=55  Score=21.69  Aligned_cols=12  Identities=25%  Similarity=0.576  Sum_probs=8.1

Q ss_pred             eeeccCCCCcccCC
Q psy4404          39 YVCLYQKCSYHTGN   52 (151)
Q Consensus        39 ~~C~~~~C~~~f~~   52 (151)
                      |.|  .+|++.|..
T Consensus       128 ~~C--~gC~~~~~~  139 (164)
T PRK12496        128 KVC--KGCKKKYPE  139 (164)
T ss_pred             EEC--CCCCccccC
Confidence            667  777777653


No 249
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.04  E-value=32  Score=24.26  Aligned_cols=16  Identities=13%  Similarity=0.557  Sum_probs=13.5

Q ss_pred             ceeeccccccccccCc
Q psy4404           2 ILVICQYCEVRLESNS   17 (151)
Q Consensus         2 ~~~~C~~C~~~f~~~~   17 (151)
                      +-+.||+|+.+|..+.
T Consensus        18 k~ieCPvC~tkFkkee   33 (267)
T COG1655          18 KTIECPVCNTKFKKEE   33 (267)
T ss_pred             ceeccCcccchhhhhh
Confidence            4578999999998877


No 250
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=24.88  E-value=33  Score=20.39  Aligned_cols=14  Identities=21%  Similarity=0.524  Sum_probs=8.9

Q ss_pred             cceeeccCCCCcccCC
Q psy4404          37 FKYVCLYQKCSYHTGN   52 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~   52 (151)
                      -.+.|  ..|++.|.-
T Consensus        52 GIW~C--~~C~~~~AG   65 (91)
T TIGR00280        52 GIWTC--RKCGAKFAG   65 (91)
T ss_pred             EEEEc--CCCCCEEeC
Confidence            35677  777776544


No 251
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=24.81  E-value=37  Score=17.52  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=9.4

Q ss_pred             eeecccccccccc
Q psy4404           3 LVICQYCEVRLES   15 (151)
Q Consensus         3 ~~~C~~C~~~f~~   15 (151)
                      +..|..||..+..
T Consensus         5 ~l~C~~CG~~m~~   17 (58)
T PF13408_consen    5 LLRCGHCGSKMTR   17 (58)
T ss_pred             cEEcccCCcEeEE
Confidence            4678888877655


No 252
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=24.70  E-value=43  Score=20.72  Aligned_cols=12  Identities=25%  Similarity=0.617  Sum_probs=5.9

Q ss_pred             eeeccCCCCcccCC
Q psy4404          39 YVCLYQKCSYHTGN   52 (151)
Q Consensus        39 ~~C~~~~C~~~f~~   52 (151)
                      ..|  ..|+..|..
T Consensus        71 ~~C--~~Cg~~~~~   82 (115)
T TIGR00100        71 CEC--EDCSEEVSP   82 (115)
T ss_pred             EEc--ccCCCEEec
Confidence            445  555544443


No 253
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=24.69  E-value=36  Score=18.65  Aligned_cols=17  Identities=29%  Similarity=0.423  Sum_probs=11.9

Q ss_pred             CceeeccccccccccCc
Q psy4404           1 MILVICQYCEVRLESNS   17 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~   17 (151)
                      +.|..|..||+...+.-
T Consensus         2 iiPvRCFTCGkvi~~~w   18 (62)
T PRK04016          2 MIPVRCFTCGKVIAEKW   18 (62)
T ss_pred             CCCeEecCCCCChHHHH
Confidence            35677888888876644


No 254
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=24.45  E-value=32  Score=17.37  Aligned_cols=8  Identities=25%  Similarity=0.667  Sum_probs=4.2

Q ss_pred             eccccccc
Q psy4404           5 ICQYCEVR   12 (151)
Q Consensus         5 ~C~~C~~~   12 (151)
                      +||.||..
T Consensus        13 kCp~CGt~   20 (44)
T PF14952_consen   13 KCPKCGTY   20 (44)
T ss_pred             cCCcCcCc
Confidence            45555543


No 255
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=24.31  E-value=43  Score=26.94  Aligned_cols=43  Identities=23%  Similarity=0.369  Sum_probs=25.4

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCcccCCch
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSYHTGNSD   54 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~   54 (151)
                      .+||+||..+.-.-..    ++...+.  ....-.|.|  +.||..+....
T Consensus       201 vpCPhCg~~~~l~~~~----l~w~~~~--~~~~a~y~C--~~Cg~~i~e~~  243 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWEN----LKWDKGE--APETARYVC--PHCGCEIEEHD  243 (557)
T ss_pred             ccCCCCCCCccccccc----eeecCCC--CccceEEEC--CCCcCCCCHHH
Confidence            4699999988654312    2221111  223345889  88998877644


No 256
>KOG1729|consensus
Probab=24.21  E-value=47  Score=24.28  Aligned_cols=24  Identities=29%  Similarity=0.582  Sum_probs=16.6

Q ss_pred             eeccccccccccCchHHHHHHhhcC
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCK   28 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~   28 (151)
                      -.|..|++.+.+.. .-..|++.|+
T Consensus       169 ~~C~~C~~~~Ftl~-~RRHHCR~CG  192 (288)
T KOG1729|consen  169 TECMVCGCTEFTLS-ERRHHCRNCG  192 (288)
T ss_pred             eecccCCCccccHH-HHHHHHHhcc
Confidence            36999999766666 6667755444


No 257
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=23.98  E-value=32  Score=16.50  Aligned_cols=12  Identities=25%  Similarity=0.379  Sum_probs=7.9

Q ss_pred             eecccccccccc
Q psy4404           4 VICQYCEVRLES   15 (151)
Q Consensus         4 ~~C~~C~~~f~~   15 (151)
                      ++|++|+..+..
T Consensus         9 ~~C~~C~~~~~~   20 (36)
T PF11781_consen    9 EPCPVCGSRWFY   20 (36)
T ss_pred             CcCCCCCCeEeE
Confidence            358888887433


No 258
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=23.79  E-value=56  Score=20.15  Aligned_cols=12  Identities=25%  Similarity=0.304  Sum_probs=6.3

Q ss_pred             eeeccCCCCcccCC
Q psy4404          39 YVCLYQKCSYHTGN   52 (151)
Q Consensus        39 ~~C~~~~C~~~f~~   52 (151)
                      ..|  ..|+..|..
T Consensus        71 ~~C--~~Cg~~~~~   82 (113)
T PRK12380         71 AWC--WDCSQVVEI   82 (113)
T ss_pred             EEc--ccCCCEEec
Confidence            555  556654443


No 259
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.61  E-value=31  Score=27.30  Aligned_cols=9  Identities=33%  Similarity=0.955  Sum_probs=5.1

Q ss_pred             ceeCCcCCc
Q psy4404          96 PFKCTICSH  104 (151)
Q Consensus        96 ~~~C~~C~~  104 (151)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            455666654


No 260
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.57  E-value=36  Score=21.15  Aligned_cols=14  Identities=21%  Similarity=0.515  Sum_probs=9.9

Q ss_pred             eeeccccccccccC
Q psy4404           3 LVICQYCEVRLESN   16 (151)
Q Consensus         3 ~~~C~~C~~~f~~~   16 (151)
                      .+.|..||..|...
T Consensus        71 ~~~C~~Cg~~~~~~   84 (117)
T PRK00564         71 ELECKDCSHVFKPN   84 (117)
T ss_pred             EEEhhhCCCccccC
Confidence            46788888776543


No 261
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=23.54  E-value=32  Score=17.07  Aligned_cols=8  Identities=25%  Similarity=0.555  Sum_probs=4.3

Q ss_pred             eeeccccc
Q psy4404           3 LVICQYCE   10 (151)
Q Consensus         3 ~~~C~~C~   10 (151)
                      +..||.||
T Consensus         2 ~~~Cp~Cg    9 (47)
T PF14690_consen    2 PPRCPHCG    9 (47)
T ss_pred             CccCCCcC
Confidence            34556665


No 262
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=23.50  E-value=36  Score=20.20  Aligned_cols=14  Identities=14%  Similarity=0.401  Sum_probs=9.2

Q ss_pred             cceeeccCCCCcccCC
Q psy4404          37 FKYVCLYQKCSYHTGN   52 (151)
Q Consensus        37 ~~~~C~~~~C~~~f~~   52 (151)
                      -.+.|  ..|++.|.-
T Consensus        53 GIW~C--~~C~~~~AG   66 (90)
T PTZ00255         53 GIWRC--KGCKKTVAG   66 (90)
T ss_pred             EEEEc--CCCCCEEeC
Confidence            45777  777776544


No 263
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=23.39  E-value=40  Score=22.69  Aligned_cols=34  Identities=26%  Similarity=0.585  Sum_probs=19.4

Q ss_pred             CCcceeeccCCCCcccCCchHHHHHHHhhcCCCceeCcccccccC
Q psy4404          35 VSFKYVCLYQKCSYHTGNSDHMRRHIRRHTGEKAFHCPHCEYRCS   79 (151)
Q Consensus        35 ~~~~~~C~~~~C~~~f~~~~~l~~h~~~h~~~~~~~C~~C~~~~~   79 (151)
                      ...-|.|  +.|...++.-.++..-         |.||.||....
T Consensus       110 ~~~~y~C--~~~~~r~sfdeA~~~~---------F~Cp~Cg~~L~  143 (176)
T COG1675         110 ENNYYVC--PNCHVKYSFDEAMELG---------FTCPKCGEDLE  143 (176)
T ss_pred             cCCceeC--CCCCCcccHHHHHHhC---------CCCCCCCchhh
Confidence            3445777  6666666555443322         66777776543


No 264
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=23.36  E-value=40  Score=24.61  Aligned_cols=9  Identities=33%  Similarity=0.678  Sum_probs=5.1

Q ss_pred             ecccccccc
Q psy4404           5 ICQYCEVRL   13 (151)
Q Consensus         5 ~C~~C~~~f   13 (151)
                      +|+.|+...
T Consensus        28 ~c~~c~~~~   36 (285)
T TIGR00515        28 KCPKCGQVL   36 (285)
T ss_pred             ECCCCcchh
Confidence            456665554


No 265
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=23.31  E-value=40  Score=19.02  Aligned_cols=23  Identities=22%  Similarity=0.361  Sum_probs=14.8

Q ss_pred             CceeeccccccccccCchHHHHH
Q psy4404           1 MILVICQYCEVRLESNSKELLEH   23 (151)
Q Consensus         1 ~~~~~C~~C~~~f~~~~~~l~~H   23 (151)
                      +.|..|..||+...+.-..+..-
T Consensus         2 iiPVRCFTCGkvig~~we~y~~~   24 (71)
T PLN00032          2 IIPVRCFTCGKVIGNKWDTYLDL   24 (71)
T ss_pred             CCceeecCCCCCcHHHHHHHHHH
Confidence            35777888888877665333333


No 266
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=23.19  E-value=29  Score=20.56  Aligned_cols=9  Identities=22%  Similarity=0.781  Sum_probs=5.5

Q ss_pred             CCCCcccCC
Q psy4404          44 QKCSYHTGN   52 (151)
Q Consensus        44 ~~C~~~f~~   52 (151)
                      ..||..|.+
T Consensus        62 kkCGfef~~   70 (97)
T COG3357          62 KKCGFEFRD   70 (97)
T ss_pred             cccCccccc
Confidence            566666655


No 267
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=22.90  E-value=49  Score=20.51  Aligned_cols=13  Identities=23%  Similarity=0.463  Sum_probs=7.8

Q ss_pred             eeecccccccccc
Q psy4404           3 LVICQYCEVRLES   15 (151)
Q Consensus         3 ~~~C~~C~~~f~~   15 (151)
                      ..+||.|++..+.
T Consensus        69 ~V~CP~C~K~TKm   81 (114)
T PF11023_consen   69 QVECPNCGKQTKM   81 (114)
T ss_pred             eeECCCCCChHhh
Confidence            4567777666543


No 268
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=22.75  E-value=14  Score=18.26  Aligned_cols=17  Identities=41%  Similarity=0.722  Sum_probs=6.4

Q ss_pred             ccccccccccCchHHHHH
Q psy4404           6 CQYCEVRLESNSKELLEH   23 (151)
Q Consensus         6 C~~C~~~f~~~~~~l~~H   23 (151)
                      |+.||+.|.... .+..|
T Consensus         1 C~~C~~~~~~~~-~~~v~   17 (47)
T PF01844_consen    1 CQYCGKPGSDNE-SLHVH   17 (47)
T ss_dssp             -TTT--B--GG--GEEEE
T ss_pred             CCCCCCcCccCc-ceEeE
Confidence            667777776654 44444


No 269
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=22.69  E-value=39  Score=20.06  Aligned_cols=13  Identities=23%  Similarity=0.649  Sum_probs=8.0

Q ss_pred             ceeeccCCCCcccCC
Q psy4404          38 KYVCLYQKCSYHTGN   52 (151)
Q Consensus        38 ~~~C~~~~C~~~f~~   52 (151)
                      .+.|  ..|++.|.-
T Consensus        54 IW~C--~~C~~~~AG   66 (90)
T PRK03976         54 IWEC--RKCGAKFAG   66 (90)
T ss_pred             EEEc--CCCCCEEeC
Confidence            4667  667766543


No 270
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=22.41  E-value=82  Score=21.32  Aligned_cols=55  Identities=20%  Similarity=0.413  Sum_probs=24.1

Q ss_pred             ceeeccc----cccccccCchHHHHHHhhcCCCCCCCCCcceeecc--CCCCcccCCchHHHHHHHhhcCC
Q psy4404           2 ILVICQY----CEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLY--QKCSYHTGNSDHMRRHIRRHTGE   66 (151)
Q Consensus         2 ~~~~C~~----C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~--~~C~~~f~~~~~l~~h~~~h~~~   66 (151)
                      ..|+|+.    |...|..  .....|.+.|       .-.|+.||.  ..|+..-.. ..|..|....+..
T Consensus        13 ~~~pC~~~~~GC~~~~~~--~~~~~HE~~C-------~~~p~~CP~~~~~C~~~G~~-~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   13 IKFPCKNAKYGCTETFPY--SEKREHEEEC-------PFRPCSCPFPGSGCDWQGSY-KELLDHLRDKHSW   73 (198)
T ss_dssp             --EE-CCGGGT---EE-G--GGHHHHHHT--------TTSEEE-SSSSTT---EEEC-CCHHHHHHHHTTT
T ss_pred             ceecCCCCCCCCcccccc--cChhhHhccC-------CCcCCcCCCCCCCccccCCH-HHHHHHHHHHCCC
Confidence            3466776    7777654  2566673221       224677765  557665543 4577776655544


No 271
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=22.11  E-value=36  Score=15.59  Aligned_cols=10  Identities=30%  Similarity=0.657  Sum_probs=6.3

Q ss_pred             eecccccccc
Q psy4404           4 VICQYCEVRL   13 (151)
Q Consensus         4 ~~C~~C~~~f   13 (151)
                      |.|..|++.+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5566666655


No 272
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.90  E-value=52  Score=17.96  Aligned_cols=11  Identities=27%  Similarity=0.875  Sum_probs=5.5

Q ss_pred             cceeeccCCCCcc
Q psy4404          37 FKYVCLYQKCSYH   49 (151)
Q Consensus        37 ~~~~C~~~~C~~~   49 (151)
                      ..|.|  ++|.-.
T Consensus        30 rtymC--~eC~~R   40 (68)
T COG4896          30 RTYMC--PECEHR   40 (68)
T ss_pred             eeEec--hhhHhh
Confidence            34556  555433


No 273
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=21.77  E-value=79  Score=16.47  Aligned_cols=8  Identities=50%  Similarity=1.564  Sum_probs=4.3

Q ss_pred             eeeccCCCCc
Q psy4404          39 YVCLYQKCSY   48 (151)
Q Consensus        39 ~~C~~~~C~~   48 (151)
                      +.|  ..||.
T Consensus        38 ~~C--GkCgy   45 (51)
T COG1998          38 WAC--GKCGY   45 (51)
T ss_pred             eEe--ccccc
Confidence            555  55554


No 274
>COG2879 Uncharacterized small protein [Function unknown]
Probab=21.65  E-value=1.1e+02  Score=16.87  Aligned_cols=19  Identities=21%  Similarity=0.302  Sum_probs=14.2

Q ss_pred             cCHHHHHHHHhhhcCCccc
Q psy4404         107 ARKDHMKRHLQLKHNADLS  125 (151)
Q Consensus       107 ~~~~~l~~H~~~~~~~~~~  125 (151)
                      ...+....||+.+++++|.
T Consensus        23 pdYdnYVehmr~~hPd~p~   41 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             CcHHHHHHHHHHhCcCCCc
Confidence            3566778888888877765


No 275
>PTZ00448 hypothetical protein; Provisional
Probab=21.06  E-value=77  Score=24.07  Aligned_cols=23  Identities=17%  Similarity=0.434  Sum_probs=20.7

Q ss_pred             ceeCCcCCccccCHHHHHHHHhh
Q psy4404          96 PFKCTICSHKAARKDHMKRHLQL  118 (151)
Q Consensus        96 ~~~C~~C~~~f~~~~~l~~H~~~  118 (151)
                      .|.|..|+-.|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999988999999886


No 276
>PF04267 SoxD:  Sarcosine oxidase, delta subunit family ;  InterPro: IPR006279 These sequences represent the delta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Rhizobium loti (Mesorhizobium loti) and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members share the same function. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate [].  Bacterial sarcosine oxidases have been isolated from over a dozen different organisms and fall into two major classes (1) monomeric form that contains only covalent flavin and (2) heterotetrameric (alpha, beta, gamma, delta) form that contain a covalent and noncovalent flavin, this entry represents the heterotetrameric form.; GO: 0008115 sarcosine oxidase activity, 0046653 tetrahydrofolate metabolic process; PDB: 3AD7_D 1X31_D 1VRQ_D 3AD8_D 3ADA_D 3AD9_D 2GAG_D 2GAH_D.
Probab=20.97  E-value=49  Score=19.37  Aligned_cols=10  Identities=40%  Similarity=0.906  Sum_probs=7.3

Q ss_pred             eeeccccccc
Q psy4404           3 LVICQYCEVR   12 (151)
Q Consensus         3 ~~~C~~C~~~   12 (151)
                      ++.||.||..
T Consensus         1 lI~CP~CG~R   10 (84)
T PF04267_consen    1 LIPCPHCGPR   10 (84)
T ss_dssp             EEEETTTEEE
T ss_pred             CccCCCCCcc
Confidence            3678888884


No 277
>KOG2703|consensus
Probab=20.83  E-value=48  Score=25.46  Aligned_cols=11  Identities=18%  Similarity=0.555  Sum_probs=8.6

Q ss_pred             ceeeccccccc
Q psy4404           2 ILVICQYCEVR   12 (151)
Q Consensus         2 ~~~~C~~C~~~   12 (151)
                      |.|.|++||-.
T Consensus        67 mSF~CpHCG~k   77 (460)
T KOG2703|consen   67 MSFECPHCGHK   77 (460)
T ss_pred             EEeecCccCCc
Confidence            57888888865


No 278
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=20.35  E-value=89  Score=16.63  Aligned_cols=32  Identities=19%  Similarity=0.469  Sum_probs=17.5

Q ss_pred             eeccccccccccCchHHHHHHhhcCCCCCCCCCcceeeccCCCCc
Q psy4404           4 VICQYCEVRLESNSKELLEHCKTCKNLSRPDVSFKYVCLYQKCSY   48 (151)
Q Consensus         4 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~C~~~~C~~   48 (151)
                      +.||.||..-+.+-     -      ..+--...|+.|  +.|.+
T Consensus         5 i~CP~CgnKTR~ki-----r------~DT~LkNfPlyC--pKCK~   36 (55)
T PF14205_consen    5 ILCPICGNKTRLKI-----R------EDTVLKNFPLYC--PKCKQ   36 (55)
T ss_pred             EECCCCCCccceee-----e------cCceeccccccC--CCCCc
Confidence            45888886543332     1      223334556777  77754


No 279
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=20.21  E-value=1.4e+02  Score=15.77  Aligned_cols=8  Identities=38%  Similarity=1.377  Sum_probs=4.0

Q ss_pred             ceeCcccc
Q psy4404          68 AFHCPHCE   75 (151)
Q Consensus        68 ~~~C~~C~   75 (151)
                      .|.|+.|+
T Consensus        44 ~y~C~~Cg   51 (54)
T PF10058_consen   44 QYRCPYCG   51 (54)
T ss_pred             EEEcCCCC
Confidence            35555554


No 280
>PRK05978 hypothetical protein; Provisional
Probab=20.01  E-value=45  Score=21.80  Aligned_cols=7  Identities=29%  Similarity=0.805  Sum_probs=3.2

Q ss_pred             ccccccc
Q psy4404           6 CQYCEVR   12 (151)
Q Consensus         6 C~~C~~~   12 (151)
                      ||.||+.
T Consensus        36 CP~CG~G   42 (148)
T PRK05978         36 CPACGEG   42 (148)
T ss_pred             CCCCCCC
Confidence            4444443


Done!