Query         psy4407
Match_columns 130
No_of_seqs    122 out of 1720
Neff          10.4
Searched_HMMs 46136
Date          Sat Aug 17 00:44:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4407.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4407hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 1.3E-23 2.7E-28  137.9   4.8   97   29-130   127-247 (279)
  2 KOG2462|consensus               99.9 1.9E-22 4.1E-27  132.4   3.4  100   15-115   142-263 (279)
  3 KOG3623|consensus               99.7 1.6E-17 3.4E-22  121.3   0.7   82   27-115   889-970 (1007)
  4 KOG1074|consensus               99.6 5.5E-17 1.2E-21  119.8   2.7   54   67-121   605-658 (958)
  5 KOG1074|consensus               99.6 9.2E-16   2E-20  113.4   5.0   57   68-127   880-936 (958)
  6 KOG3576|consensus               99.6 2.4E-16 5.2E-21   99.9  -1.0   89   26-121   111-199 (267)
  7 KOG3608|consensus               99.5 2.4E-15 5.2E-20  102.3   2.3  115   13-129   189-355 (467)
  8 KOG3623|consensus               99.4 5.5E-14 1.2E-18  103.1   1.3   65   63-130   890-954 (1007)
  9 KOG3576|consensus               99.3 4.2E-13 9.1E-18   85.3  -0.7   94   19-120   133-237 (267)
 10 PHA00733 hypothetical protein   99.2 1.6E-11 3.4E-16   74.4   2.4   90   26-121    34-125 (128)
 11 KOG3608|consensus               99.1 4.5E-11 9.7E-16   81.8   2.6  108    6-121   266-378 (467)
 12 PHA02768 hypothetical protein;  99.0 2.4E-10 5.1E-15   58.3   1.7   44   67-112     5-48  (55)
 13 PF13465 zf-H2C2_2:  Zinc-finge  98.8   5E-09 1.1E-13   45.9   2.0   26   82-107     1-26  (26)
 14 PLN03086 PRLI-interacting fact  98.6 2.2E-08 4.7E-13   73.5   3.4   59   66-130   477-545 (567)
 15 PHA02768 hypothetical protein;  98.6 5.4E-09 1.2E-13   53.4  -0.3   44   32-84      5-48  (55)
 16 PLN03086 PRLI-interacting fact  98.6 3.8E-08 8.2E-13   72.3   3.4   93   14-120   463-565 (567)
 17 KOG3993|consensus               98.6 1.2E-08 2.6E-13   71.5   0.3   80   33-120   268-380 (500)
 18 PHA00733 hypothetical protein   98.5 4.9E-08 1.1E-12   59.2   2.0   57   27-92     68-124 (128)
 19 PHA00616 hypothetical protein   98.5 4.1E-08 8.9E-13   47.8   1.1   31   68-98      2-32  (44)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 3.8E-08 8.2E-13   43.0   0.7   24   19-43      2-25  (26)
 21 PHA00616 hypothetical protein   98.4 1.2E-07 2.6E-12   46.2   1.0   33   95-130     1-33  (44)
 22 PHA00732 hypothetical protein   98.1 2.9E-06 6.3E-11   47.1   2.4   47   32-91      1-48  (79)
 23 PHA00732 hypothetical protein   97.9 6.9E-06 1.5E-10   45.6   1.7   43   67-115     1-44  (79)
 24 PF00096 zf-C2H2:  Zinc finger,  97.8 1.6E-05 3.5E-10   33.4   1.8   22   68-89      1-22  (23)
 25 PF05605 zf-Di19:  Drought indu  97.6 0.00011 2.3E-09   37.8   3.7   48   68-118     3-52  (54)
 26 PF13912 zf-C2H2_6:  C2H2-type   97.5 6.7E-05 1.5E-09   32.7   1.4   23   68-90      2-24  (27)
 27 KOG3993|consensus               97.5 3.6E-05 7.8E-10   54.6   0.6   76   15-91    279-380 (500)
 28 PF05605 zf-Di19:  Drought indu  97.4 9.1E-05   2E-09   38.1   1.5   51   32-91      2-53  (54)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.4 0.00018 3.8E-09   30.1   2.2   23   68-90      1-23  (24)
 30 PF00096 zf-C2H2:  Zinc finger,  97.4 4.3E-05 9.3E-10   32.1   0.0   21   96-116     1-21  (23)
 31 COG5189 SFP1 Putative transcri  97.3 0.00016 3.5E-09   49.7   2.2   51   65-115   347-418 (423)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.2 0.00017 3.6E-09   31.5   1.2   25   95-120     1-25  (27)
 33 PF09237 GAGA:  GAGA factor;  I  97.1 0.00089 1.9E-08   33.5   3.0   33   63-95     20-52  (54)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.0 0.00033 7.2E-09   29.3   1.0   23   96-118     1-23  (24)
 35 PRK04860 hypothetical protein;  97.0 0.00084 1.8E-08   42.3   2.9   39   66-108   118-156 (160)
 36 COG5189 SFP1 Putative transcri  96.9 0.00033 7.2E-09   48.2   0.7   59   30-88    347-419 (423)
 37 PF12756 zf-C2H2_2:  C2H2 type   96.8  0.0012 2.5E-08   37.9   2.2   18   34-51      1-18  (100)
 38 smart00355 ZnF_C2H2 zinc finge  96.7  0.0014   3E-08   27.7   1.9   22   69-90      2-23  (26)
 39 PF12756 zf-C2H2_2:  C2H2 type   96.6  0.0015 3.3E-08   37.3   2.1   23   95-117    50-72  (100)
 40 PF12874 zf-met:  Zinc-finger o  96.3  0.0025 5.4E-08   27.0   1.4   22   68-89      1-22  (25)
 41 smart00355 ZnF_C2H2 zinc finge  96.3   0.002 4.3E-08   27.1   1.0   25   96-121     1-25  (26)
 42 PF09237 GAGA:  GAGA factor;  I  95.9  0.0039 8.4E-08   31.3   1.0   33   91-126    20-52  (54)
 43 PF13909 zf-H2C2_5:  C2H2-type   95.6   0.013 2.9E-07   24.5   1.9   22   68-90      1-22  (24)
 44 COG2888 Predicted Zn-ribbon RN  95.5   0.013 2.8E-07   30.3   2.0   26   34-59     11-36  (61)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  95.3  0.0035 7.6E-08   27.2  -0.4   20   68-87      2-21  (27)
 46 PRK14890 putative Zn-ribbon RN  95.1   0.027 5.8E-07   29.2   2.4   26   33-58      8-33  (59)
 47 PRK04860 hypothetical protein;  94.4   0.017 3.6E-07   36.5   0.8   39   31-80    118-156 (160)
 48 PF13913 zf-C2HC_2:  zinc-finge  94.2   0.048   1E-06   23.2   1.8   21   68-89      3-23  (25)
 49 PRK00398 rpoP DNA-directed RNA  93.3   0.061 1.3E-06   26.5   1.5   27   32-58      3-29  (46)
 50 smart00451 ZnF_U1 U1-like zinc  92.9   0.094   2E-06   23.9   1.8   22   67-88      3-24  (35)
 51 cd00350 rubredoxin_like Rubred  91.9    0.16 3.4E-06   23.1   1.8    9   94-102    16-24  (33)
 52 KOG2186|consensus               91.3    0.12 2.7E-06   34.8   1.4   45   68-115     4-48  (276)
 53 PF09538 FYDLN_acid:  Protein o  91.2     0.2 4.3E-06   29.5   2.1   17   64-80     23-39  (108)
 54 PF13719 zinc_ribbon_5:  zinc-r  91.2    0.26 5.7E-06   23.0   2.2   11   67-77     25-35  (37)
 55 PF09723 Zn-ribbon_8:  Zinc rib  91.1    0.17 3.6E-06   24.4   1.5   16   32-47      5-20  (42)
 56 COG5048 FOG: Zn-finger [Genera  90.8   0.087 1.9E-06   37.6   0.4   54   67-121   289-348 (467)
 57 PF09986 DUF2225:  Uncharacteri  90.8    0.17 3.6E-06   33.6   1.7   48   30-80      3-61  (214)
 58 COG5048 FOG: Zn-finger [Genera  90.7    0.15 3.2E-06   36.5   1.5   62   31-99    288-355 (467)
 59 COG1996 RPC10 DNA-directed RNA  90.4    0.16 3.4E-06   25.4   1.0   30   30-59      4-33  (49)
 60 PHA00626 hypothetical protein   90.2    0.35 7.6E-06   24.8   2.2   13   66-78     22-34  (59)
 61 TIGR02098 MJ0042_CXXC MJ0042 f  90.1    0.36 7.9E-06   22.5   2.2   13   33-45      3-15  (38)
 62 PF13717 zinc_ribbon_4:  zinc-r  90.1    0.47   1E-05   22.0   2.5   14   34-47      4-17  (36)
 63 smart00834 CxxC_CXXC_SSSS Puta  90.1    0.22 4.7E-06   23.5   1.4   14   32-45      5-18  (41)
 64 COG1198 PriA Primosomal protei  89.7    0.39 8.4E-06   37.6   3.1    9   35-43    438-446 (730)
 65 COG1997 RPL43A Ribosomal prote  88.3     0.5 1.1E-05   26.6   2.1   29   51-79     36-65  (89)
 66 smart00659 RPOLCX RNA polymera  88.3    0.37 8.1E-06   23.5   1.5   26   32-58      2-27  (44)
 67 PF09845 DUF2072:  Zn-ribbon co  88.2    0.28 6.1E-06   29.8   1.2   28   32-59      1-28  (131)
 68 PF10571 UPF0547:  Uncharacteri  88.0    0.52 1.1E-05   20.2   1.7    9   69-77     16-24  (26)
 69 PF03604 DNA_RNApol_7kD:  DNA d  87.6    0.59 1.3E-05   21.2   1.8   11   33-43      1-11  (32)
 70 TIGR02605 CxxC_CxxC_SSSS putat  87.2    0.43 9.4E-06   23.9   1.4   14   32-45      5-18  (52)
 71 COG3364 Zn-ribbon containing p  87.1     0.3 6.4E-06   28.3   0.8   28   32-59      2-29  (112)
 72 PF07754 DUF1610:  Domain of un  86.4     1.1 2.4E-05   18.9   2.2    7   68-74     17-23  (24)
 73 COG4049 Uncharacterized protei  85.7    0.46 9.9E-06   24.3   1.0   28   62-89     12-39  (65)
 74 cd00729 rubredoxin_SM Rubredox  83.9       1 2.2E-05   20.6   1.7   10   33-42      3-12  (34)
 75 KOG2893|consensus               82.6    0.51 1.1E-05   31.7   0.5   42   34-86     12-53  (341)
 76 TIGR02300 FYDLN_acid conserved  82.0     1.2 2.6E-05   27.0   1.8   28   53-80     12-39  (129)
 77 TIGR00595 priA primosomal prot  81.9     1.6 3.5E-05   32.8   3.0    9   34-42    215-223 (505)
 78 smart00531 TFIIE Transcription  81.7     0.8 1.7E-05   28.5   1.1   40   27-77     94-133 (147)
 79 KOG2893|consensus               80.0     0.4 8.7E-06   32.2  -0.7   45   65-114     9-53  (341)
 80 PRK14873 primosome assembly pr  78.8     2.2 4.7E-05   33.3   2.8    9   34-42    385-393 (665)
 81 TIGR00622 ssl1 transcription f  78.3     3.1 6.7E-05   24.7   2.7   87   31-120    14-105 (112)
 82 KOG2907|consensus               77.9     1.2 2.6E-05   26.3   1.0   38   68-106    75-113 (116)
 83 KOG4173|consensus               77.0    0.61 1.3E-05   30.6  -0.5   82   30-121    77-172 (253)
 84 PF12773 DZR:  Double zinc ribb  76.7     2.4 5.2E-05   20.9   1.8    8   68-75     30-37  (50)
 85 KOG1146|consensus               76.4     1.5 3.3E-05   36.4   1.4   55   62-116   460-539 (1406)
 86 PTZ00255 60S ribosomal protein  76.3     2.2 4.8E-05   24.3   1.7   15   65-79     52-66  (90)
 87 TIGR00373 conserved hypothetic  76.3     1.6 3.5E-05   27.5   1.3   23   26-48    103-125 (158)
 88 PRK00464 nrdR transcriptional   75.6     1.9 4.1E-05   27.2   1.4   19   67-85     28-46  (154)
 89 smart00661 RPOL9 RNA polymeras  75.5     4.4 9.6E-05   20.0   2.6   12   67-78     20-31  (52)
 90 COG1592 Rubrerythrin [Energy p  74.4     2.3   5E-05   27.1   1.6   10   93-102   147-156 (166)
 91 COG1773 Rubredoxin [Energy pro  74.4       3 6.6E-05   21.4   1.7   43   31-75      2-44  (55)
 92 PRK06266 transcription initiat  74.2     1.9 4.1E-05   27.8   1.2   21   28-48    113-133 (178)
 93 TIGR00280 L37a ribosomal prote  74.2     2.3   5E-05   24.2   1.4   15   65-79     51-65  (91)
 94 PF00301 Rubredoxin:  Rubredoxi  74.1     4.2 9.1E-05   20.1   2.2   14   33-46      2-15  (47)
 95 PF08790 zf-LYAR:  LYAR-type C2  74.0       1 2.2E-05   19.7  -0.0   19   96-115     1-19  (28)
 96 PF14446 Prok-RING_1:  Prokaryo  73.7     2.1 4.6E-05   21.9   1.1   24   33-58      6-29  (54)
 97 KOG3408|consensus               73.7     2.3   5E-05   25.5   1.4   27   63-89     53-79  (129)
 98 PF06524 NOA36:  NOA36 protein;  73.0     1.6 3.4E-05   29.9   0.6   21   29-49    139-159 (314)
 99 KOG1146|consensus               72.8     1.7 3.7E-05   36.2   0.9   66   24-89    457-540 (1406)
100 PRK04023 DNA polymerase II lar  71.1     5.3 0.00012   32.7   3.2   35   30-74    624-658 (1121)
101 PRK00432 30S ribosomal protein  71.1     4.4 9.6E-05   20.3   1.9    9   68-76     38-46  (50)
102 PF02892 zf-BED:  BED zinc fing  70.7     3.6 7.9E-05   19.7   1.6   11   68-78     17-27  (45)
103 COG1198 PriA Primosomal protei  70.4     3.2   7E-05   32.7   1.9   41   32-76    444-484 (730)
104 PRK05580 primosome assembly pr  70.2       5 0.00011   31.4   2.9   21   52-76    410-430 (679)
105 PF14353 CpXC:  CpXC protein     69.9     2.6 5.6E-05   25.4   1.1   12   34-45      3-14  (128)
106 PF09082 DUF1922:  Domain of un  69.9     1.6 3.4E-05   23.4   0.1   25   33-59      4-28  (68)
107 smart00154 ZnF_AN1 AN1-like Zi  69.3     4.1 8.9E-05   19.2   1.5   15   32-46     12-26  (39)
108 PRK03564 formate dehydrogenase  69.1     6.6 0.00014   27.7   3.0   43   30-75    185-234 (309)
109 PF08274 PhnA_Zn_Ribbon:  PhnA   69.0     2.3 5.1E-05   18.9   0.6    7   68-74     20-26  (30)
110 KOG2186|consensus               68.5     2.1 4.6E-05   29.1   0.5   51   33-93      4-54  (276)
111 PF01286 XPA_N:  XPA protein N-  68.4       4 8.7E-05   18.7   1.3   17   34-50      5-21  (34)
112 PRK03976 rpl37ae 50S ribosomal  68.4     3.5 7.7E-05   23.4   1.3   15   65-79     52-66  (90)
113 PF01780 Ribosomal_L37ae:  Ribo  67.7     1.9 4.1E-05   24.5   0.1   12   67-78     53-64  (90)
114 PF05290 Baculo_IE-1:  Baculovi  67.4     6.1 0.00013   24.2   2.3   26   28-53     76-101 (140)
115 PF05191 ADK_lid:  Adenylate ki  66.8     5.9 0.00013   18.3   1.7   11   34-44      3-13  (36)
116 TIGR01206 lysW lysine biosynth  66.5     4.7  0.0001   20.6   1.5   11   33-43      3-13  (54)
117 PF01428 zf-AN1:  AN1-like Zinc  66.5     4.2   9E-05   19.5   1.2   23   31-53     12-35  (43)
118 cd00730 rubredoxin Rubredoxin;  66.1     5.3 0.00011   20.1   1.6   13   33-45      2-14  (50)
119 PF04216 FdhE:  Protein involve  66.0     3.1 6.7E-05   28.9   1.0   48   52-103   199-246 (290)
120 PF14803 Nudix_N_2:  Nudix N-te  64.6     5.8 0.00013   18.2   1.4    8   68-75     23-30  (34)
121 PRK12380 hydrogenase nickel in  64.5     4.6 9.9E-05   24.0   1.4   27   30-58     68-94  (113)
122 PRK12496 hypothetical protein;  64.3     5.5 0.00012   25.3   1.8   25   33-59    128-152 (164)
123 PF11781 RRN7:  RNA polymerase   64.1     5.7 0.00012   18.4   1.4   10   65-74     23-32  (36)
124 smart00734 ZnF_Rad18 Rad18-lik  63.7       8 0.00017   16.4   1.7   19   69-88      3-21  (26)
125 PF07282 OrfB_Zn_ribbon:  Putat  62.6     8.6 0.00019   20.3   2.1   27   52-78     30-57  (69)
126 PF13451 zf-trcl:  Probable zin  62.2     8.7 0.00019   19.2   1.9   39   65-103     2-41  (49)
127 PRK00420 hypothetical protein;  61.8     8.6 0.00019   22.9   2.2   27   53-79     26-52  (112)
128 COG1571 Predicted DNA-binding   61.7     5.9 0.00013   29.1   1.7   30   52-81    352-381 (421)
129 smart00614 ZnF_BED BED zinc fi  61.1     6.1 0.00013   19.5   1.3   21   68-88     19-44  (50)
130 PF12013 DUF3505:  Protein of u  61.0     8.8 0.00019   22.4   2.2   24   68-91     81-108 (109)
131 COG2331 Uncharacterized protei  61.0     2.4 5.3E-05   23.2  -0.2   13   32-44     12-24  (82)
132 PRK09678 DNA-binding transcrip  61.0     2.9 6.2E-05   22.8   0.1   19   65-83     25-45  (72)
133 COG3357 Predicted transcriptio  60.9     5.6 0.00012   22.6   1.2   14   31-44     57-70  (97)
134 KOG4167|consensus               59.6     2.4 5.3E-05   33.2  -0.5   25   95-120   792-816 (907)
135 PF08271 TF_Zn_Ribbon:  TFIIB z  59.4     9.1  0.0002   18.2   1.7    8   68-75     20-27  (43)
136 PF13248 zf-ribbon_3:  zinc-rib  59.3     5.4 0.00012   16.9   0.8    6   35-40      5-10  (26)
137 PF07295 DUF1451:  Protein of u  59.2     8.2 0.00018   24.1   1.9   13   30-42    110-122 (146)
138 COG4888 Uncharacterized Zn rib  59.0     9.2  0.0002   22.2   1.9   20   29-48     19-38  (104)
139 KOG3183|consensus               58.7     9.2  0.0002   25.9   2.1   25   29-53     20-45  (250)
140 PF15269 zf-C2H2_7:  Zinc-finge  58.6     7.7 0.00017   19.0   1.3   24   67-90     20-43  (54)
141 PRK00564 hypA hydrogenase nick  57.6     7.3 0.00016   23.3   1.4   30   29-59     68-97  (117)
142 PF01155 HypA:  Hydrogenase exp  57.0     5.4 0.00012   23.6   0.8   29   29-59     67-95  (113)
143 KOG2593|consensus               56.1     7.2 0.00016   28.7   1.4   25   25-49    121-145 (436)
144 KOG4167|consensus               55.4     2.1 4.5E-05   33.6  -1.4   28   65-92    790-817 (907)
145 PRK10220 hypothetical protein;  54.8      12 0.00026   22.1   1.9   12   67-78     20-31  (111)
146 PF04959 ARS2:  Arsenite-resist  54.1      12 0.00027   24.9   2.1   28   63-90     73-100 (214)
147 TIGR00686 phnA alkylphosphonat  54.0     9.5 0.00021   22.5   1.4   11   67-77     19-29  (109)
148 PF07649 C1_3:  C1-like domain;  53.7      13 0.00028   16.1   1.6   11   66-76     14-24  (30)
149 PF07503 zf-HYPF:  HypF finger;  53.2     3.4 7.3E-05   19.1  -0.4   13   35-47      2-14  (35)
150 PF12760 Zn_Tnp_IS1595:  Transp  53.1      19 0.00042   17.4   2.3    7   68-74     38-44  (46)
151 COG5112 UFD2 U1-like Zn-finger  51.5     6.2 0.00013   23.1   0.4   28   61-88     49-76  (126)
152 PF01096 TFIIS_C:  Transcriptio  51.1      12 0.00027   17.5   1.4    9   68-76     29-37  (39)
153 COG5236 Uncharacterized conser  51.1     7.5 0.00016   27.9   0.8   38   13-51    198-239 (493)
154 TIGR00100 hypA hydrogenase nic  50.0      11 0.00025   22.3   1.4   28   29-58     67-94  (115)
155 cd00924 Cyt_c_Oxidase_Vb Cytoc  50.0       9 0.00019   22.2   0.9   19   25-44     73-91  (97)
156 COG1645 Uncharacterized Zn-fin  49.9      14  0.0003   22.7   1.7   23   52-76     30-53  (131)
157 PLN02294 cytochrome c oxidase   49.6       9  0.0002   24.5   0.9   15   30-44    139-153 (174)
158 PF08792 A2L_zn_ribbon:  A2L zi  49.2      17 0.00038   16.4   1.6   10   68-77     22-31  (33)
159 KOG2231|consensus               48.8      15 0.00032   28.8   2.1   48   68-119   183-236 (669)
160 COG4530 Uncharacterized protei  48.7      10 0.00023   22.4   1.0   16   63-78     22-37  (129)
161 PF01363 FYVE:  FYVE zinc finge  48.7     9.7 0.00021   20.0   0.9   25   32-58      9-33  (69)
162 KOG1280|consensus               48.4      28 0.00061   25.0   3.2   37   66-102    78-116 (381)
163 TIGR01562 FdhE formate dehydro  48.2      29 0.00062   24.6   3.3   41   33-76    185-233 (305)
164 COG1439 Predicted nucleic acid  47.8      13 0.00027   24.1   1.4   23   33-59    140-162 (177)
165 COG0068 HypF Hydrogenase matur  47.7       4 8.6E-05   32.0  -1.0   66   34-105   103-183 (750)
166 KOG2785|consensus               47.6      19  0.0004   26.2   2.3   51   66-116   165-241 (390)
167 PF15135 UPF0515:  Uncharacteri  47.4      19 0.00041   24.7   2.2   53   27-79    107-167 (278)
168 smart00440 ZnF_C2C2 C2C2 Zinc   47.4      26 0.00056   16.5   2.2    9   68-76     29-37  (40)
169 PRK14714 DNA polymerase II lar  46.8      21 0.00044   30.3   2.7   35   33-77    668-702 (1337)
170 PF05443 ROS_MUCR:  ROS/MUCR tr  45.8      13 0.00028   22.8   1.2   24   67-93     72-95  (132)
171 COG3677 Transposase and inacti  45.3      17 0.00037   22.2   1.7   16   65-80     51-66  (129)
172 PF13453 zf-TFIIB:  Transcripti  44.4      36 0.00078   15.9   2.5   18   67-84     19-36  (41)
173 PRK05978 hypothetical protein;  44.1      14 0.00031   23.1   1.2   27   33-59     34-61  (148)
174 cd00065 FYVE FYVE domain; Zinc  44.0      18 0.00038   18.1   1.4   24   34-59      4-27  (57)
175 PF09855 DUF2082:  Nucleic-acid  43.7      16 0.00034   19.4   1.2    9   33-41      1-9   (64)
176 PF14599 zinc_ribbon_6:  Zinc-r  43.5      12 0.00025   19.7   0.7   25   34-58     32-56  (61)
177 PF07191 zinc-ribbons_6:  zinc-  43.2      20 0.00043   19.4   1.5   39   31-74     16-57  (70)
178 PRK11823 DNA repair protein Ra  43.1      19  0.0004   26.8   1.9   26   30-59      5-30  (446)
179 PF05495 zf-CHY:  CHY zinc fing  43.0      26 0.00056   18.8   2.0   57   32-103    10-69  (71)
180 PF02148 zf-UBP:  Zn-finger in   42.3      17 0.00037   18.9   1.2   25   64-88      8-35  (63)
181 PF14206 Cys_rich_CPCC:  Cystei  42.2      19  0.0004   20.0   1.3   27   33-59      2-29  (78)
182 PF10083 DUF2321:  Uncharacteri  42.1      20 0.00044   22.6   1.6   19   65-83     66-84  (158)
183 PRK14559 putative protein seri  42.1      23  0.0005   27.8   2.3   36   34-78     17-52  (645)
184 TIGR00416 sms DNA repair prote  41.9      17 0.00037   27.1   1.6   25   31-59      6-30  (454)
185 PF13878 zf-C2H2_3:  zinc-finge  41.7      30 0.00064   16.4   1.9   23   68-90     14-38  (41)
186 PF07975 C1_4:  TFIIH C1-like d  41.6      14 0.00029   18.7   0.7   22   30-51     19-40  (51)
187 PRK03824 hypA hydrogenase nick  40.7      13 0.00029   22.8   0.7   10   68-77     71-80  (135)
188 PRK00762 hypA hydrogenase nick  40.6      20 0.00043   21.7   1.4   16   29-45     67-82  (124)
189 PHA02942 putative transposase;  40.6      32  0.0007   25.1   2.7   29   51-79    326-354 (383)
190 PF02150 RNA_POL_M_15KD:  RNA p  40.6      17 0.00037   16.6   0.9    9   69-77     22-30  (35)
191 TIGR00244 transcriptional regu  39.8      21 0.00045   22.4   1.4   17   68-84     29-45  (147)
192 cd01121 Sms Sms (bacterial rad  39.8      18 0.00039   26.3   1.3   23   33-59      1-23  (372)
193 PF02591 DUF164:  Putative zinc  39.5      23 0.00051   17.9   1.4    9   94-102    45-53  (56)
194 COG1655 Uncharacterized protei  39.5     8.1 0.00018   26.1  -0.4   17   30-46     17-33  (267)
195 PF14205 Cys_rich_KTR:  Cystein  38.9      26 0.00056   17.9   1.5    9   66-74     27-35  (55)
196 PF06677 Auto_anti-p27:  Sjogre  38.7      29 0.00063   16.6   1.6   22   53-74     20-41  (41)
197 COG5216 Uncharacterized conser  38.5      24 0.00053   18.3   1.3   29   33-74     23-51  (67)
198 PRK03681 hypA hydrogenase nick  38.3      22 0.00047   21.1   1.3   13   31-43     69-81  (114)
199 PF09297 zf-NADH-PPase:  NADH p  38.3      25 0.00053   15.5   1.2   10   66-75     20-29  (32)
200 PF12647 RNHCP:  RNHCP domain;   37.6      56  0.0012   18.7   2.8   29   30-59      2-33  (92)
201 PF05766 NinG:  Bacteriophage L  37.0      11 0.00024   24.6  -0.0   30   30-59      4-33  (189)
202 KOG3507|consensus               36.6      27 0.00059   18.2   1.3   14   94-107    36-49  (62)
203 TIGR03830 CxxCG_CxxCG_HTH puta  36.5      38 0.00083   20.0   2.3   23   65-87     29-51  (127)
204 COG5152 Uncharacterized conser  36.5     6.3 0.00014   25.9  -1.2   18   28-45    192-209 (259)
205 COG1066 Sms Predicted ATP-depe  36.4      26 0.00056   26.1   1.7   25   31-59      6-30  (456)
206 PF01215 COX5B:  Cytochrome c o  35.3      18 0.00039   22.3   0.7   18   26-44    107-124 (136)
207 PF00628 PHD:  PHD-finger;  Int  34.7      56  0.0012   15.7   2.4   15   64-78     11-25  (51)
208 PF03811 Zn_Tnp_IS1:  InsA N-te  34.5      32 0.00069   15.9   1.3   11   63-73     25-35  (36)
209 TIGR03826 YvyF flagellar opero  34.5      21 0.00045   22.1   0.8   23   34-59      5-27  (137)
210 PRK11032 hypothetical protein;  33.9      35 0.00076   21.7   1.8   12   31-42    123-134 (160)
211 PF09332 Mcm10:  Mcm10 replicat  33.7      11 0.00024   27.0  -0.5    9   33-41    253-261 (344)
212 TIGR01384 TFS_arch transcripti  33.4      46 0.00099   19.1   2.2   10   95-104    62-71  (104)
213 PF10276 zf-CHCC:  Zinc-finger   33.2      25 0.00054   16.7   0.8   12   31-42     28-39  (40)
214 PF02318 FYVE_2:  FYVE-type zin  32.0      12 0.00027   22.2  -0.4   14   31-44     53-66  (118)
215 KOG2906|consensus               31.6      43 0.00094   19.4   1.8   15   66-80     20-34  (105)
216 PRK12286 rpmF 50S ribosomal pr  31.3      34 0.00074   17.6   1.2    9   33-41     28-36  (57)
217 PF05129 Elf1:  Transcription e  30.9      23 0.00051   19.6   0.6   42   28-80     18-59  (81)
218 PF00130 C1_1:  Phorbol esters/  30.9      30 0.00065   17.0   1.0   13   30-42      9-21  (53)
219 PF07800 DUF1644:  Protein of u  30.9 1.5E+02  0.0032   19.0   4.2   57   67-128    80-139 (162)
220 PF04810 zf-Sec23_Sec24:  Sec23  30.6      39 0.00084   15.8   1.3   12   64-75     21-32  (40)
221 PF14149 YhfH:  YhfH-like prote  30.5       8 0.00017   18.1  -1.1   11   34-44     15-25  (37)
222 PF14369 zf-RING_3:  zinc-finge  30.5      48   0.001   15.1   1.5   10   69-78     23-32  (35)
223 PRK14892 putative transcriptio  30.4      68  0.0015   18.6   2.5   11   30-40     19-29  (99)
224 COG1327 Predicted transcriptio  30.2      31 0.00068   21.7   1.1   14   69-82     30-43  (156)
225 PF12907 zf-met2:  Zinc-binding  29.9      29 0.00063   16.5   0.8    9   97-105     3-11  (40)
226 COG3091 SprT Zn-dependent meta  29.7      46   0.001   21.0   1.8   34   65-103   115-148 (156)
227 PF09416 UPF1_Zn_bind:  RNA hel  29.5      95  0.0021   19.6   3.2   12   93-104    58-69  (152)
228 PHA02998 RNA polymerase subuni  29.3      62  0.0013   21.1   2.3   12   96-107   172-183 (195)
229 PF11672 DUF3268:  Protein of u  29.0      83  0.0018   18.4   2.7    9   32-40      2-10  (102)
230 PRK09710 lar restriction allev  28.7      64  0.0014   17.1   2.0   10   67-76     27-36  (64)
231 PF14319 Zn_Tnp_IS91:  Transpos  28.3      51  0.0011   19.5   1.8   13   29-41     39-51  (111)
232 smart00778 Prim_Zn_Ribbon Zinc  28.0      76  0.0016   14.8   2.1    9   66-74     24-32  (37)
233 PTZ00043 cytochrome c oxidase   27.9      30 0.00064   23.4   0.8   16   29-44    178-193 (268)
234 PF02176 zf-TRAF:  TRAF-type zi  27.5      64  0.0014   16.2   1.9   34   67-100     9-43  (60)
235 KOG0782|consensus               26.9      15 0.00032   28.4  -0.8   31   17-48    239-269 (1004)
236 PF10263 SprT-like:  SprT-like   26.7      53  0.0011   20.2   1.8   11   67-77    123-133 (157)
237 PRK05452 anaerobic nitric oxid  26.6      55  0.0012   24.7   2.1   18   28-45    421-438 (479)
238 KOG0978|consensus               26.4     6.7 0.00014   30.8  -2.7   17   94-110   677-693 (698)
239 PF03107 C1_2:  C1 domain;  Int  26.3      70  0.0015   13.8   2.0    8   67-74     15-22  (30)
240 COG0375 HybF Zn finger protein  26.3      45 0.00097   20.0   1.3   25   32-58     70-94  (115)
241 PF10122 Mu-like_Com:  Mu-like   26.3      33 0.00071   17.3   0.6   13   32-44      4-16  (51)
242 COG2051 RPS27A Ribosomal prote  26.0      63  0.0014   17.3   1.7   10   68-77     39-48  (67)
243 TIGR01031 rpmF_bact ribosomal   25.8      43 0.00094   17.1   1.0    9   33-41     27-35  (55)
244 CHL00174 accD acetyl-CoA carbo  25.6      37 0.00079   24.0   1.0   35   52-86     40-76  (296)
245 smart00064 FYVE Protein presen  25.6      60  0.0013   16.9   1.6   25   33-59     11-35  (68)
246 PF06827 zf-FPG_IleRS:  Zinc fi  25.5      44 0.00096   14.3   0.9    9   65-73     19-27  (30)
247 COG1545 Predicted nucleic-acid  25.3      51  0.0011   20.3   1.5   23   33-59     30-52  (140)
248 PF06397 Desulfoferrod_N:  Desu  24.9      35 0.00076   15.8   0.5   12   31-42      5-16  (36)
249 smart00249 PHD PHD zinc finger  24.8      85  0.0018   14.2   2.3   13   65-77     12-24  (47)
250 PF13824 zf-Mss51:  Zinc-finger  24.7      62  0.0013   16.6   1.5   13   65-77     12-24  (55)
251 PRK05654 acetyl-CoA carboxylas  24.6      38 0.00083   23.8   0.9   23   68-90     47-69  (292)
252 KOG2071|consensus               24.4      56  0.0012   25.3   1.8   27   65-91    416-442 (579)
253 TIGR03831 YgiT_finger YgiT-typ  24.1      38 0.00082   15.9   0.6   14   31-44     31-44  (46)
254 PF15199 DAOA:  D-amino acid ox  24.0      25 0.00055   18.6  -0.0    7    2-8      15-21  (82)
255 COG0333 RpmF Ribosomal protein  24.0      55  0.0012   16.9   1.2   21   33-58     28-48  (57)
256 COG1998 RPS31 Ribosomal protei  24.0      74  0.0016   16.0   1.6    7   68-74     38-44  (51)
257 PF06221 zf-C2HC5:  Putative zi  24.0      58  0.0013   16.8   1.3   11   35-45     21-31  (57)
258 PF04981 NMD3:  NMD3 family ;    23.7      67  0.0015   21.6   1.9   12   68-79     36-47  (236)
259 TIGR00515 accD acetyl-CoA carb  23.7      35 0.00076   23.9   0.6   15   68-82     46-60  (285)
260 PF04423 Rad50_zn_hook:  Rad50   23.6      36 0.00078   17.0   0.5   11   69-79     22-32  (54)
261 KOG1994|consensus               23.5      29 0.00063   23.4   0.2   26   26-51    233-258 (268)
262 PF04780 DUF629:  Protein of un  23.2      65  0.0014   24.4   1.9   32   61-92     51-83  (466)
263 KOG2807|consensus               23.1      85  0.0018   22.6   2.3   25   94-119   344-368 (378)
264 PF01783 Ribosomal_L32p:  Ribos  22.6      73  0.0016   16.2   1.5    9   33-41     27-35  (56)
265 KOG4602|consensus               22.3 1.2E+02  0.0026   21.1   2.8    7   52-58    270-276 (318)
266 COG4957 Predicted transcriptio  22.1      65  0.0014   20.0   1.4   22   69-93     78-99  (148)
267 PF10058 DUF2296:  Predicted in  21.9   1E+02  0.0022   15.6   2.0    7   68-74     45-51  (54)
268 PF06044 DRP:  Dam-replacing fa  21.8      44 0.00094   22.9   0.7   16   65-80     51-66  (254)
269 KOG1813|consensus               21.7      84  0.0018   22.2   2.1   18   28-45    237-254 (313)
270 PRK00415 rps27e 30S ribosomal   21.6 1.2E+02  0.0025   15.9   2.1   11   67-77     30-40  (59)
271 PRK04351 hypothetical protein;  21.5      84  0.0018   19.7   1.9   33   66-106   111-143 (149)
272 KOG2923|consensus               21.3      52  0.0011   17.5   0.8   11   33-44     23-33  (67)
273 PF10013 DUF2256:  Uncharacteri  21.1      51  0.0011   15.9   0.7   11   69-79     10-20  (42)
274 KOG4727|consensus               21.1      55  0.0012   21.1   1.0   23   66-88     74-96  (193)
275 PF14311 DUF4379:  Domain of un  20.8      98  0.0021   15.4   1.8   11   68-78     29-39  (55)
276 PF13821 DUF4187:  Domain of un  20.8      39 0.00085   17.2   0.3   25   27-51     22-46  (55)
277 PF14445 Prok-RING_2:  Prokaryo  20.7     5.4 0.00012   20.0  -2.8   11   33-43      8-18  (57)
278 KOG0957|consensus               20.7   1E+02  0.0022   23.7   2.4   46   28-76    540-598 (707)
279 COG0675 Transposase and inacti  20.6 1.3E+02  0.0028   20.8   3.0   24   52-79    311-334 (364)
280 cd00029 C1 Protein kinase C co  20.5      59  0.0013   15.4   0.9   12   32-43     11-22  (50)
281 PF14354 Lar_restr_allev:  Rest  20.5 1.3E+02  0.0027   15.2   2.2    8   68-75     30-37  (61)
282 COG1326 Uncharacterized archae  20.4 1.2E+02  0.0027   20.0   2.5   13   66-78     29-41  (201)
283 PF08646 Rep_fac-A_C:  Replicat  20.3      56  0.0012   20.0   1.0   10   67-76     37-46  (146)
284 smart00109 C1 Protein kinase C  20.2      80  0.0017   14.7   1.4   12   32-43     11-22  (49)
285 PF14569 zf-UDP:  Zinc-binding   20.0      83  0.0018   17.5   1.4   55   46-105     5-61  (80)

No 1  
>KOG2462|consensus
Probab=99.89  E-value=1.3e-23  Score=137.93  Aligned_cols=97  Identities=28%  Similarity=0.501  Sum_probs=80.5

Q ss_pred             cCcceecccccccccCccccccc-------------cCCCCCCc-----------ccCCCCceeeCCCCCCcccCchhHH
Q psy4407          29 ETEMLTCKYCYEFLPNDAEIIAD-------------HCKFCSYK-----------LRPDKTYIFTCFACEYHSAKRSHIK   84 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~~l~~h-------------~c~~C~~~-----------~~h~~~~~~~C~~C~~~f~~~~~l~   84 (130)
                      ....|.|+.||+.+.+.++|.+|             .|+.||+.           ++|+  -++.|.+||+.|...=-|+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhh
Confidence            44568888888888888888777             58888887           4443  6688899999998888888


Q ss_pred             HHHHhhcCCCCeecccChhhhcCcchHHHhhhhcCCCCCCCCccCC
Q psy4407          85 EHIRQHTGEKPFSCLLCEYKAAKKSNLTKHMSKKHPSSYEDPFFVS  130 (130)
Q Consensus        85 ~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~~h~g~~e~~~~C~  130 (130)
                      .|+++|||||||.|..|++.|..+++|+.|+ ++|.+  .|+|+|.
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHm-QTHS~--~K~~qC~  247 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHM-QTHSD--VKKHQCP  247 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHH-HhhcC--CccccCc
Confidence            9999999999999999999999999999999 88888  8888884


No 2  
>KOG2462|consensus
Probab=99.86  E-value=1.9e-22  Score=132.41  Aligned_cols=100  Identities=26%  Similarity=0.440  Sum_probs=77.5

Q ss_pred             ccccceehhhhhcc---cCcceecccccccccCccccccc--------cCCCCCCc-----------ccCCCCceeeCCC
Q psy4407          15 YSSGLKVSEVDFRF---ETEMLTCKYCYEFLPNDAEIIAD--------HCKFCSYK-----------LRPDKTYIFTCFA   72 (130)
Q Consensus        15 ~~~~~~~~~~~~~~---~~~~~~C~~C~~~~~~~~~l~~h--------~c~~C~~~-----------~~h~~~~~~~C~~   72 (130)
                      ..++|.+|. ++|-   ..+.+.|..||+.|.+...|..|        .|.+||+.           ++|+|||||.|..
T Consensus       142 T~snLsrHk-Q~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~h  220 (279)
T KOG2462|consen  142 TSSNLSRHK-QTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPH  220 (279)
T ss_pred             cccccchhh-cccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCCccCCc
Confidence            444455552 3332   23445555566555555555444        45555555           9999999999999


Q ss_pred             CCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHHHhh
Q psy4407          73 CEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLTKHM  115 (130)
Q Consensus        73 C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~  115 (130)
                      |++.|...++|+.|+++|.+.|+|.|..|++.|...+.|++|.
T Consensus       221 C~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  221 CGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             ccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhh
Confidence            9999999999999999999999999999999999999999998


No 3  
>KOG3623|consensus
Probab=99.66  E-value=1.6e-17  Score=121.30  Aligned_cols=82  Identities=24%  Similarity=0.562  Sum_probs=79.1

Q ss_pred             cccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhc
Q psy4407          27 RFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAA  106 (130)
Q Consensus        27 ~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~  106 (130)
                      .+++..|.|+.|+|.|...+.|.+|.       -.|+|.+||+|.+|.+.|..+-+|..|++.|.|+|||.|..|+++|.
T Consensus       889 kte~gmyaCDqCDK~FqKqSSLaRHK-------YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFS  961 (1007)
T KOG3623|consen  889 KTEDGMYACDQCDKAFQKQSSLARHK-------YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFS  961 (1007)
T ss_pred             cCccccchHHHHHHHHHhhHHHHHhh-------hhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcc
Confidence            45778899999999999999999998       89999999999999999999999999999999999999999999999


Q ss_pred             CcchHHHhh
Q psy4407         107 KKSNLTKHM  115 (130)
Q Consensus       107 ~~~~l~~h~  115 (130)
                      ...++..||
T Consensus       962 HSGSYSQHM  970 (1007)
T KOG3623|consen  962 HSGSYSQHM  970 (1007)
T ss_pred             cccchHhhh
Confidence            999999999


No 4  
>KOG1074|consensus
Probab=99.65  E-value=5.5e-17  Score=119.79  Aligned_cols=54  Identities=35%  Similarity=0.626  Sum_probs=51.7

Q ss_pred             eeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHHHhhhhcCCC
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLTKHMSKKHPS  121 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~~h~g  121 (130)
                      |..|.+|-++..-.+.|+.|.++|+|++||+|.+||+.|..+..|+.|+ .+|..
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka  658 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKA  658 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc-ccccc
Confidence            5789999999999999999999999999999999999999999999999 88886


No 5  
>KOG1074|consensus
Probab=99.60  E-value=9.2e-16  Score=113.44  Aligned_cols=57  Identities=33%  Similarity=0.611  Sum_probs=52.9

Q ss_pred             eeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHHHhhhhcCCCCCCCCc
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLTKHMSKKHPSSYEDPF  127 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~~h~g~~e~~~  127 (130)
                      ..|.+||+.|.+.+.|..|+++|+++|||.|..|++.|.....|+.|| ..|.+  ..|+
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHM-gtH~w--~q~~  936 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHM-GTHMW--VQPP  936 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhh-ccccc--cCCC
Confidence            689999999999999999999999999999999999999999999999 68877  5543


No 6  
>KOG3576|consensus
Probab=99.56  E-value=2.4e-16  Score=99.89  Aligned_cols=89  Identities=22%  Similarity=0.398  Sum_probs=81.4

Q ss_pred             hcccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhh
Q psy4407          26 FRFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKA  105 (130)
Q Consensus        26 ~~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f  105 (130)
                      .-.+.-.|.|..|++.|.-..-|.+|.       .-|+..+.+.|..||++|...-.|.+|+++|+|.+||+|..|++.|
T Consensus       111 sssd~d~ftCrvCgK~F~lQRmlnrh~-------kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaf  183 (267)
T KOG3576|consen  111 SSSDQDSFTCRVCGKKFGLQRMLNRHL-------KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAF  183 (267)
T ss_pred             CCCCCCeeeeehhhhhhhHHHHHHHHh-------hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHH
Confidence            344566799999999999889999998       7888899999999999999999999999999999999999999999


Q ss_pred             cCcchHHHhhhhcCCC
Q psy4407         106 AKKSNLTKHMSKKHPS  121 (130)
Q Consensus       106 ~~~~~l~~h~~~~h~g  121 (130)
                      .+..+|..|++++|..
T Consensus       184 tqrcsleshl~kvhgv  199 (267)
T KOG3576|consen  184 TQRCSLESHLKKVHGV  199 (267)
T ss_pred             HhhccHHHHHHHHcCc
Confidence            9999999999888863


No 7  
>KOG3608|consensus
Probab=99.54  E-value=2.4e-15  Score=102.29  Aligned_cols=115  Identities=17%  Similarity=0.453  Sum_probs=89.5

Q ss_pred             eeccccceehhhhhcccCcceecccccccccCccccccc--------------------------------------cCC
Q psy4407          13 LFYSSGLKVSEVDFRFETEMLTCKYCYEFLPNDAEIIAD--------------------------------------HCK   54 (130)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h--------------------------------------~c~   54 (130)
                      +..+..|+.| +++|+++|.-.|+.||..|.++..|..|                                      .|+
T Consensus       189 ~~~k~~LreH-~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCp  267 (467)
T KOG3608|consen  189 MGNKYRLREH-IRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCP  267 (467)
T ss_pred             hccHHHHHHH-HHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhccccc
Confidence            3466677777 6999999999999999999988887777                                      577


Q ss_pred             CCCCc------------ccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeeccc--ChhhhcCcchHHHhhhhcCC
Q psy4407          55 FCSYK------------LRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLL--CEYKAAKKSNLTKHMSKKHP  120 (130)
Q Consensus        55 ~C~~~------------~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~--C~~~f~~~~~l~~h~~~~h~  120 (130)
                      .|.++            ..|+.++||+|+.|+..+...+.|++|...|. +-.|.|.-  |...+.....++.|.+.+|.
T Consensus       268 lCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhE  346 (467)
T KOG3608|consen  268 LCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHE  346 (467)
T ss_pred             ccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhcc
Confidence            77666            55677888888888888888888888888776 56678855  88888888888888877787


Q ss_pred             CCCCCCccC
Q psy4407         121 SSYEDPFFV  129 (130)
Q Consensus       121 g~~e~~~~C  129 (130)
                      |..+-+|.|
T Consensus       347 g~np~~Y~C  355 (467)
T KOG3608|consen  347 GNNPILYAC  355 (467)
T ss_pred             CCCCCceee
Confidence            744555765


No 8  
>KOG3623|consensus
Probab=99.41  E-value=5.5e-14  Score=103.15  Aligned_cols=65  Identities=28%  Similarity=0.671  Sum_probs=62.1

Q ss_pred             CCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHHHhhhhcCCCCCCCCccCC
Q psy4407          63 DKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLTKHMSKKHPSSYEDPFFVS  130 (130)
Q Consensus        63 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~~h~g~~e~~~~C~  130 (130)
                      +.+.+|.|+.|++.|...+.|.+|.-.|+|.+||.|.+|.+.|..+.+|..|+ +.|.|  ||||.|+
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHk-RLHSG--EKPfQCd  954 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHK-RLHSG--EKPFQCD  954 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhh-hhccC--CCcchhh
Confidence            45668999999999999999999999999999999999999999999999999 99999  9999996


No 9  
>KOG3576|consensus
Probab=99.27  E-value=4.2e-13  Score=85.33  Aligned_cols=94  Identities=17%  Similarity=0.389  Sum_probs=80.5

Q ss_pred             ceehhhhhcccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHH-hhc------
Q psy4407          19 LKVSEVDFRFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIR-QHT------   91 (130)
Q Consensus        19 ~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~-~h~------   91 (130)
                      |.+| ++-|...+.+.|..||+.|....+|++|.       ++|+|.+||+|..|++.|...-.|..|++ .|.      
T Consensus       133 lnrh-~kch~~vkr~lct~cgkgfndtfdlkrh~-------rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~ya  204 (267)
T KOG3576|consen  133 LNRH-LKCHSDVKRHLCTFCGKGFNDTFDLKRHT-------RTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYA  204 (267)
T ss_pred             HHHH-hhhccHHHHHHHhhccCcccchhhhhhhh-------ccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHH
Confidence            4444 68899999999999999999999999999       99999999999999999999999999976 342      


Q ss_pred             ----CCCCeecccChhhhcCcchHHHhhhhcCC
Q psy4407          92 ----GEKPFSCLLCEYKAAKKSNLTKHMSKKHP  120 (130)
Q Consensus        92 ----~~k~~~C~~C~~~f~~~~~l~~h~~~~h~  120 (130)
                          .++.|.|.+||..-.....+-.|++..|.
T Consensus       205 ykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  205 YKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             HHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence                25779999999988888788888844333


No 10 
>PHA00733 hypothetical protein
Probab=99.16  E-value=1.6e-11  Score=74.35  Aligned_cols=90  Identities=20%  Similarity=0.278  Sum_probs=72.1

Q ss_pred             hcccCcceecccccccccCccccccc--cCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChh
Q psy4407          26 FRFETEMLTCKYCYEFLPNDAEIIAD--HCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEY  103 (130)
Q Consensus        26 ~~~~~~~~~C~~C~~~~~~~~~l~~h--~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~  103 (130)
                      .-.+.+++.|..|+..|.....|..+  .-..    ..+.+++||.|..||+.|.+...|..|++.+  +.++.|..|++
T Consensus        34 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~----~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK  107 (128)
T PHA00733         34 LTPEQKRLIRAVVKTLIYNPQLLDESSYLYKL----LTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGK  107 (128)
T ss_pred             CChhhhhHHHHHHhhhccChhhhcchHHHHhh----cccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCC
Confidence            44567889999999988877766655  0000    2334588999999999999999999999876  35799999999


Q ss_pred             hhcCcchHHHhhhhcCCC
Q psy4407         104 KAAKKSNLTKHMSKKHPS  121 (130)
Q Consensus       104 ~f~~~~~l~~h~~~~h~g  121 (130)
                      .|.....|..|+.+.|+.
T Consensus       108 ~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        108 EFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             ccCCHHHHHHHHHHhcCc
Confidence            999999999999777764


No 11 
>KOG3608|consensus
Probab=99.10  E-value=4.5e-11  Score=81.81  Aligned_cols=108  Identities=15%  Similarity=0.266  Sum_probs=91.1

Q ss_pred             cceeeeeeeccccceehhhhhcccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCC--CCCcccCchhH
Q psy4407           6 RSYYVLFLFYSSGLKVSEVDFRFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFA--CEYHSAKRSHI   83 (130)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~--C~~~f~~~~~l   83 (130)
                      .|..-+-....+.|..|.+..|..++||+|+.|++.+...++|..|.       .+|+ +..|.|..  |...+.+..++
T Consensus       266 CplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~-------~~HS-~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  266 CPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHV-------QVHS-KTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             ccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHH-------Hhcc-ccceecCCCCCcHHHHHHHHH
Confidence            34444556678889999777799999999999999999999999997       7776 66799987  99999999999


Q ss_pred             HHHHHhhc-C--CCCeecccChhhhcCcchHHHhhhhcCCC
Q psy4407          84 KEHIRQHT-G--EKPFSCLLCEYKAAKKSNLTKHMSKKHPS  121 (130)
Q Consensus        84 ~~h~~~h~-~--~k~~~C~~C~~~f~~~~~l~~h~~~~h~g  121 (130)
                      ..|++.+. |  ..+|.|..|++-|..-..|..|+.+-|.-
T Consensus       338 ~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  338 RRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             HHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcc
Confidence            99988654 4  35699999999999999999999776653


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=98.98  E-value=2.4e-10  Score=58.33  Aligned_cols=44  Identities=18%  Similarity=0.357  Sum_probs=39.0

Q ss_pred             eeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHH
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLT  112 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~  112 (130)
                      .|.|++||+.|...++|..|+++|+  ++++|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3789999999999999999999998  7899999999998776664


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.77  E-value=5e-09  Score=45.87  Aligned_cols=26  Identities=38%  Similarity=0.929  Sum_probs=23.2

Q ss_pred             hHHHHHHhhcCCCCeecccChhhhcC
Q psy4407          82 HIKEHIRQHTGEKPFSCLLCEYKAAK  107 (130)
Q Consensus        82 ~l~~h~~~h~~~k~~~C~~C~~~f~~  107 (130)
                      +|..|+++|++++||.|..|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999998863


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.65  E-value=2.2e-08  Score=73.50  Aligned_cols=59  Identities=10%  Similarity=0.202  Sum_probs=41.2

Q ss_pred             ceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcC----------cchHHHhhhhcCCCCCCCCccCC
Q psy4407          66 YIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAK----------KSNLTKHMSKKHPSSYEDPFFVS  130 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~----------~~~l~~h~~~~h~g~~e~~~~C~  130 (130)
                      +++.|+ ||..+ ....|..|+.+|...+++.|..|++.+..          ...|..|. .++ |  .+++.|+
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE-~~C-G--~rt~~C~  545 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHE-SIC-G--SRTAPCD  545 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHH-Hhc-C--CcceEcc
Confidence            567787 87644 55777788777777788888888877742          23677777 543 6  7777773


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.62  E-value=5.4e-09  Score=53.36  Aligned_cols=44  Identities=14%  Similarity=0.203  Sum_probs=38.6

Q ss_pred             ceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHH
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIK   84 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~   84 (130)
                      .|+|+.||+.|...++|..|+       ++|+  ++++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~-------r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHL-------RKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHH-------HhcC--CcccCCcccceecccceeE
Confidence            489999999999999999999       8988  6899999999998666543


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.59  E-value=3.8e-08  Score=72.29  Aligned_cols=93  Identities=17%  Similarity=0.280  Sum_probs=69.7

Q ss_pred             eccccceehhhhhcccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccC----------chhH
Q psy4407          14 FYSSGLKVSEVDFRFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAK----------RSHI   83 (130)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~----------~~~l   83 (130)
                      +....|..|. +.+.  +++.|+ ||+.+ ....|..|.       .++.+.+++.|..|+..+..          ...|
T Consensus       463 f~~s~LekH~-~~~H--kpv~Cp-Cg~~~-~R~~L~~H~-------~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~L  530 (567)
T PLN03086        463 FQQGEMEKHM-KVFH--EPLQCP-CGVVL-EKEQMVQHQ-------ASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGM  530 (567)
T ss_pred             cchHHHHHHH-HhcC--CCccCC-CCCCc-chhHHHhhh-------hccCCCCceeCCCCCCccccCccccchhhhhhhH
Confidence            4455666663 4543  778888 88655 457788887       77888999999999998842          3478


Q ss_pred             HHHHHhhcCCCCeecccChhhhcCcchHHHhhhhcCC
Q psy4407          84 KEHIRQHTGEKPFSCLLCEYKAAKKSNLTKHMSKKHP  120 (130)
Q Consensus        84 ~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~~h~  120 (130)
                      ..|...+ |.+++.|..|++.+. ...+..|+..+|.
T Consensus       531 t~HE~~C-G~rt~~C~~Cgk~Vr-lrdm~~H~~~~h~  565 (567)
T PLN03086        531 SEHESIC-GSRTAPCDSCGRSVM-LKEMDIHQIAVHQ  565 (567)
T ss_pred             HHHHHhc-CCcceEccccCCeee-ehhHHHHHHHhhc
Confidence            9998886 889999999998764 4567778756664


No 17 
>KOG3993|consensus
Probab=98.57  E-value=1.2e-08  Score=71.53  Aligned_cols=80  Identities=24%  Similarity=0.468  Sum_probs=65.9

Q ss_pred             eecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhc--------CC-----------
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHT--------GE-----------   93 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~--------~~-----------   93 (130)
                      |.|..|...|.+...|.+|.|+-    .+ .  .-|.|++|+++|.-..+|..|.++|-        +.           
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~R----IV-~--vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~ra  340 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPR----IV-H--VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRA  340 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCe----eE-E--eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhh
Confidence            88999999999999999997643    22 2  23899999999999999999999872        11           


Q ss_pred             --------------CCeecccChhhhcCcchHHHhhhhcCC
Q psy4407          94 --------------KPFSCLLCEYKAAKKSNLTKHMSKKHP  120 (130)
Q Consensus        94 --------------k~~~C~~C~~~f~~~~~l~~h~~~~h~  120 (130)
                                    -.|.|..|++.|.....|+.|+ ..|.
T Consensus       341 e~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq-lthq  380 (500)
T KOG3993|consen  341 EVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ-LTHQ  380 (500)
T ss_pred             hhhhccccCCcccCceeecHHhhhhhHHHHHHHHhH-Hhhh
Confidence                          1389999999999999999997 4443


No 18 
>PHA00733 hypothetical protein
Probab=98.53  E-value=4.9e-08  Score=59.17  Aligned_cols=57  Identities=9%  Similarity=0.153  Sum_probs=48.5

Q ss_pred             cccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcC
Q psy4407          27 RFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTG   92 (130)
Q Consensus        27 ~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~   92 (130)
                      +.+++||.|+.||+.|.+...|..|.       ..+  +.++.|..|++.|.....|..|+....+
T Consensus        68 ~~~~kPy~C~~Cgk~Fss~s~L~~H~-------r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         68 SKAVSPYVCPLCLMPFSSSVSLKQHI-------RYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCccCCCCCCcCCCHHHHHHHH-------hcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            34588999999999999999999996       554  4569999999999999999999876543


No 19 
>PHA00616 hypothetical protein
Probab=98.51  E-value=4.1e-08  Score=47.81  Aligned_cols=31  Identities=16%  Similarity=0.403  Sum_probs=17.6

Q ss_pred             eeCCCCCCcccCchhHHHHHHhhcCCCCeec
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQHTGEKPFSC   98 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C   98 (130)
                      |+|..||..|.....+..|++.|++++++.|
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            4555555555555555555555555555544


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.49  E-value=3.8e-08  Score=43.04  Aligned_cols=24  Identities=17%  Similarity=0.376  Sum_probs=20.5

Q ss_pred             ceehhhhhcccCcceeccccccccc
Q psy4407          19 LKVSEVDFRFETEMLTCKYCYEFLP   43 (130)
Q Consensus        19 ~~~~~~~~~~~~~~~~C~~C~~~~~   43 (130)
                      |..| +++|++++||.|+.|++.|.
T Consensus         2 l~~H-~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRH-MRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHH-HHHHSSSSSEEESSSSEEES
T ss_pred             HHHH-hhhcCCCCCCCCCCCcCeeC
Confidence            5566 58999999999999999885


No 21 
>PHA00616 hypothetical protein
Probab=98.38  E-value=1.2e-07  Score=46.20  Aligned_cols=33  Identities=18%  Similarity=0.371  Sum_probs=28.8

Q ss_pred             CeecccChhhhcCcchHHHhhhhcCCCCCCCCccCC
Q psy4407          95 PFSCLLCEYKAAKKSNLTKHMSKKHPSSYEDPFFVS  130 (130)
Q Consensus        95 ~~~C~~C~~~f~~~~~l~~h~~~~h~g~~e~~~~C~  130 (130)
                      ||.|..||+.|.+.+.|+.|+ +.|+|  ++|+.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~-r~~hg--~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHL-LSVHK--QNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHH-HHhcC--CCcccee
Confidence            588999999999999999999 77888  8988774


No 22 
>PHA00732 hypothetical protein
Probab=98.08  E-value=2.9e-06  Score=47.08  Aligned_cols=47  Identities=15%  Similarity=0.231  Sum_probs=29.4

Q ss_pred             ceecccccccccCccccccccCCCCCCccc-CCCCceeeCCCCCCcccCchhHHHHHHhhc
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSYKLR-PDKTYIFTCFACEYHSAKRSHIKEHIRQHT   91 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~-h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~   91 (130)
                      ||.|..||+.|.+...|..|.       .. |.+   +.|..||+.|.   .+..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~-------r~~H~~---~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHA-------RRNHTL---TKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHh-------hcccCC---CccCCCCCEeC---ChhhhhcccC
Confidence            466777777777777777775       42 332   36777777775   3566665443


No 23 
>PHA00732 hypothetical protein
Probab=97.89  E-value=6.9e-06  Score=45.56  Aligned_cols=43  Identities=28%  Similarity=0.632  Sum_probs=36.5

Q ss_pred             eeeCCCCCCcccCchhHHHHHHh-hcCCCCeecccChhhhcCcchHHHhh
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIRQ-HTGEKPFSCLLCEYKAAKKSNLTKHM  115 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~~-h~~~k~~~C~~C~~~f~~~~~l~~h~  115 (130)
                      ||.|..|++.|.+...|..|++. |++   +.|..|++.|.   .+..|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhh
Confidence            57899999999999999999984 653   58999999997   467777


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.80  E-value=1.6e-05  Score=33.41  Aligned_cols=22  Identities=27%  Similarity=0.699  Sum_probs=13.3

Q ss_pred             eeCCCCCCcccCchhHHHHHHh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQ   89 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~   89 (130)
                      |.|..|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666554


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.64  E-value=0.00011  Score=37.79  Aligned_cols=48  Identities=29%  Similarity=0.624  Sum_probs=33.1

Q ss_pred             eeCCCCCCcccCchhHHHHHHh-hcC-CCCeecccChhhhcCcchHHHhhhhc
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQ-HTG-EKPFSCLLCEYKAAKKSNLTKHMSKK  118 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~-h~~-~k~~~C~~C~~~f~~~~~l~~h~~~~  118 (130)
                      |.|+.|++ ..+...|..|... |.. .+.+.|++|...+.  ..|..|+...
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            67888888 4566788888664 544 35688888887544  3777887433


No 26 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.47  E-value=6.7e-05  Score=32.74  Aligned_cols=23  Identities=35%  Similarity=0.634  Sum_probs=12.1

Q ss_pred             eeCCCCCCcccCchhHHHHHHhh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      |.|..|+..|.+...|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            45555555555555555555443


No 27 
>KOG3993|consensus
Probab=97.46  E-value=3.6e-05  Score=54.56  Aligned_cols=76  Identities=14%  Similarity=0.210  Sum_probs=52.8

Q ss_pred             ccccceehhhhhcccCcceecccccccccCcccccccc-----CCCCC-------C--------------cccCCCCcee
Q psy4407          15 YSSGLKVSEVDFRFETEMLTCKYCYEFLPNDAEIIADH-----CKFCS-------Y--------------KLRPDKTYIF   68 (130)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h~-----c~~C~-------~--------------~~~h~~~~~~   68 (130)
                      +...|..| .-...--..|+|++|+|.|....+|..|.     =++-+       +              ....+.+..|
T Consensus       279 D~F~LAQH-rC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~  357 (500)
T KOG3993|consen  279 DAFALAQH-RCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIF  357 (500)
T ss_pred             hHHHHhhc-cCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCcee
Confidence            44455555 34444556799999999999999999881     00000       0              0111334579


Q ss_pred             eCCCCCCcccCchhHHHHHHhhc
Q psy4407          69 TCFACEYHSAKRSHIKEHIRQHT   91 (130)
Q Consensus        69 ~C~~C~~~f~~~~~l~~h~~~h~   91 (130)
                      .|..|++.|.....|+.|+.+|.
T Consensus       358 ~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  358 SCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             ecHHhhhhhHHHHHHHHhHHhhh
Confidence            99999999999999999987774


No 28 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.40  E-value=9.1e-05  Score=38.06  Aligned_cols=51  Identities=14%  Similarity=0.329  Sum_probs=36.3

Q ss_pred             ceecccccccccCccccccccCCCCCCcccCCC-CceeeCCCCCCcccCchhHHHHHHhhc
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDK-TYIFTCFACEYHSAKRSHIKEHIRQHT   91 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~-~~~~~C~~C~~~f~~~~~l~~h~~~h~   91 (130)
                      .|.|+.|++. .+...|..|.=      ..|.. .+.+.|++|...+.  .+|..|+....
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~------~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCE------DEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHH------hHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            5899999994 55678888820      34443 35689999998644  48888887543


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.39  E-value=0.00018  Score=30.14  Aligned_cols=23  Identities=30%  Similarity=0.735  Sum_probs=13.3

Q ss_pred             eeCCCCCCcccCchhHHHHHHhh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      |.|+.|+..|.+...+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666544


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.37  E-value=4.3e-05  Score=32.05  Aligned_cols=21  Identities=38%  Similarity=0.808  Sum_probs=19.5

Q ss_pred             eecccChhhhcCcchHHHhhh
Q psy4407          96 FSCLLCEYKAAKKSNLTKHMS  116 (130)
Q Consensus        96 ~~C~~C~~~f~~~~~l~~h~~  116 (130)
                      |.|..|++.|.....|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            689999999999999999993


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.30  E-value=0.00016  Score=49.68  Aligned_cols=51  Identities=20%  Similarity=0.484  Sum_probs=36.7

Q ss_pred             CceeeCCC--CCCcccCchhHHHHHHhh-------------------cCCCCeecccChhhhcCcchHHHhh
Q psy4407          65 TYIFTCFA--CEYHSAKRSHIKEHIRQH-------------------TGEKPFSCLLCEYKAAKKSNLTKHM  115 (130)
Q Consensus        65 ~~~~~C~~--C~~~f~~~~~l~~h~~~h-------------------~~~k~~~C~~C~~~f~~~~~l~~h~  115 (130)
                      +|||+|++  |.+.+.....|.-|+...                   ..+|||+|.+|++++.....|+.|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            36666655  666666666666665421                   2358999999999999999998887


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.24  E-value=0.00017  Score=31.45  Aligned_cols=25  Identities=32%  Similarity=0.563  Sum_probs=22.5

Q ss_pred             CeecccChhhhcCcchHHHhhhhcCC
Q psy4407          95 PFSCLLCEYKAAKKSNLTKHMSKKHP  120 (130)
Q Consensus        95 ~~~C~~C~~~f~~~~~l~~h~~~~h~  120 (130)
                      +|.|..|++.|.....|..|+ +.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~-~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHK-RSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHH-CTTT
T ss_pred             CCCCCccCCccCChhHHHHHh-HHhc
Confidence            689999999999999999999 6654


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.08  E-value=0.00089  Score=33.53  Aligned_cols=33  Identities=18%  Similarity=0.308  Sum_probs=18.3

Q ss_pred             CCCceeeCCCCCCcccCchhHHHHHHhhcCCCC
Q psy4407          63 DKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKP   95 (130)
Q Consensus        63 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~   95 (130)
                      .++.|..|++|+..+....+|..|+....+.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346667777777777777777777766555444


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.02  E-value=0.00033  Score=29.25  Aligned_cols=23  Identities=35%  Similarity=0.688  Sum_probs=18.4

Q ss_pred             eecccChhhhcCcchHHHhhhhc
Q psy4407          96 FSCLLCEYKAAKKSNLTKHMSKK  118 (130)
Q Consensus        96 ~~C~~C~~~f~~~~~l~~h~~~~  118 (130)
                      |.|..|++.|.....|..|++..
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999443


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=96.97  E-value=0.00084  Score=42.27  Aligned_cols=39  Identities=23%  Similarity=0.540  Sum_probs=33.6

Q ss_pred             ceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCc
Q psy4407          66 YIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKK  108 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~  108 (130)
                      -+|.|. |+.   ....+..|.++++++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            579997 987   567789999999999999999999987654


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.89  E-value=0.00033  Score=48.20  Aligned_cols=59  Identities=14%  Similarity=0.197  Sum_probs=43.1

Q ss_pred             Ccceeccc--ccccccCcccccccc----CCCCCC--------cccCCCCceeeCCCCCCcccCchhHHHHHH
Q psy4407          30 TEMLTCKY--CYEFLPNDAEIIADH----CKFCSY--------KLRPDKTYIFTCFACEYHSAKRSHIKEHIR   88 (130)
Q Consensus        30 ~~~~~C~~--C~~~~~~~~~l~~h~----c~~C~~--------~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~   88 (130)
                      ++||+|+.  |.|.|.....|+-|+    |..--.        .......|||.|.+|++.+.....|.-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            59999986  999999999998882    111000        011234689999999999999888887754


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.76  E-value=0.0012  Score=37.86  Aligned_cols=18  Identities=17%  Similarity=0.604  Sum_probs=0.0

Q ss_pred             ecccccccccCccccccc
Q psy4407          34 TCKYCYEFLPNDAEIIAD   51 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h   51 (130)
                      +|..|+..|.+...|..|
T Consensus         1 ~C~~C~~~f~~~~~l~~H   18 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQH   18 (100)
T ss_dssp             ------------------
T ss_pred             Cccccccccccccccccc
Confidence            477777777777777777


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.74  E-value=0.0014  Score=27.68  Aligned_cols=22  Identities=36%  Similarity=0.665  Sum_probs=12.3

Q ss_pred             eCCCCCCcccCchhHHHHHHhh
Q psy4407          69 TCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        69 ~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      .|..|+..|.....+..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4555555555555555555543


No 39 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.62  E-value=0.0015  Score=37.34  Aligned_cols=23  Identities=26%  Similarity=0.609  Sum_probs=18.5

Q ss_pred             CeecccChhhhcCcchHHHhhhh
Q psy4407          95 PFSCLLCEYKAAKKSNLTKHMSK  117 (130)
Q Consensus        95 ~~~C~~C~~~f~~~~~l~~h~~~  117 (130)
                      .+.|..|+..|.....|..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            47899999999999999999953


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.34  E-value=0.0025  Score=27.02  Aligned_cols=22  Identities=23%  Similarity=0.634  Sum_probs=13.8

Q ss_pred             eeCCCCCCcccCchhHHHHHHh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQ   89 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~   89 (130)
                      |.|..|+..|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666553


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.30  E-value=0.002  Score=27.14  Aligned_cols=25  Identities=32%  Similarity=0.624  Sum_probs=21.4

Q ss_pred             eecccChhhhcCcchHHHhhhhcCCC
Q psy4407          96 FSCLLCEYKAAKKSNLTKHMSKKHPS  121 (130)
Q Consensus        96 ~~C~~C~~~f~~~~~l~~h~~~~h~g  121 (130)
                      |.|..|++.|.....|..|+ ..|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~-~~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHM-RTHXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHH-HHhcc
Confidence            57999999999999999999 56653


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.92  E-value=0.0039  Score=31.27  Aligned_cols=33  Identities=24%  Similarity=0.559  Sum_probs=22.4

Q ss_pred             cCCCCeecccChhhhcCcchHHHhhhhcCCCCCCCC
Q psy4407          91 TGEKPFSCLLCEYKAAKKSNLTKHMSKKHPSSYEDP  126 (130)
Q Consensus        91 ~~~k~~~C~~C~~~f~~~~~l~~h~~~~h~g~~e~~  126 (130)
                      ..+.|-.|++|+..+.+..+|+.|+ .++.+  -||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHl-e~~H~--~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHL-EIRHF--KKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHH-HHHTT--TS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHH-HHHhc--ccC
Confidence            3567899999999999999999999 65555  565


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.58  E-value=0.013  Score=24.49  Aligned_cols=22  Identities=32%  Similarity=0.991  Sum_probs=12.4

Q ss_pred             eeCCCCCCcccCchhHHHHHHhh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      |.|..|+.... ...|..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666666665 66666666653


No 44 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=95.51  E-value=0.013  Score=30.33  Aligned_cols=26  Identities=15%  Similarity=0.354  Sum_probs=13.7

Q ss_pred             ecccccccccCccccccccCCCCCCc
Q psy4407          34 TCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      .|..||...........+.|+.||..
T Consensus        11 ~CtSCg~~i~p~e~~v~F~CPnCGe~   36 (61)
T COG2888          11 VCTSCGREIAPGETAVKFPCPNCGEV   36 (61)
T ss_pred             eeccCCCEeccCCceeEeeCCCCCce
Confidence            46666666544444444455555533


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.28  E-value=0.0035  Score=27.21  Aligned_cols=20  Identities=30%  Similarity=0.692  Sum_probs=9.8

Q ss_pred             eeCCCCCCcccCchhHHHHH
Q psy4407          68 FTCFACEYHSAKRSHIKEHI   87 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~   87 (130)
                      |.|..|++.|.+...+..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            34555555555555544443


No 46 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=95.11  E-value=0.027  Score=29.19  Aligned_cols=26  Identities=15%  Similarity=0.309  Sum_probs=10.7

Q ss_pred             eecccccccccCccccccccCCCCCC
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      ..|..||....-...-....|+.||.
T Consensus         8 ~~CtSCg~~i~~~~~~~~F~CPnCG~   33 (59)
T PRK14890          8 PKCTSCGIEIAPREKAVKFLCPNCGE   33 (59)
T ss_pred             ccccCCCCcccCCCccCEeeCCCCCC
Confidence            34555555543323223333444433


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=94.40  E-value=0.017  Score=36.48  Aligned_cols=39  Identities=15%  Similarity=0.302  Sum_probs=30.8

Q ss_pred             cceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCc
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKR   80 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~   80 (130)
                      -+|.|. |+.   ....+..|.       ++++++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~-------ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHN-------RVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHH-------HHhcCCccEECCCCCceeEEe
Confidence            468897 987   456777787       888999999999999877543


No 48 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.19  E-value=0.048  Score=23.20  Aligned_cols=21  Identities=14%  Similarity=0.384  Sum_probs=14.0

Q ss_pred             eeCCCCCCcccCchhHHHHHHh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQ   89 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~   89 (130)
                      ..|+.||+.| ....|..|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577788777 56667777653


No 49 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=93.29  E-value=0.061  Score=26.45  Aligned_cols=27  Identities=22%  Similarity=0.501  Sum_probs=15.3

Q ss_pred             ceecccccccccCccccccccCCCCCC
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      .|.|+.||..+........-.|+.||.
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~   29 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGY   29 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCC
Confidence            578888888775433322233444444


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.91  E-value=0.094  Score=23.86  Aligned_cols=22  Identities=18%  Similarity=0.472  Sum_probs=17.2

Q ss_pred             eeeCCCCCCcccCchhHHHHHH
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIR   88 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~   88 (130)
                      +|.|..|+..|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4778888888887777777765


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.86  E-value=0.16  Score=23.12  Aligned_cols=9  Identities=33%  Similarity=1.165  Sum_probs=4.4

Q ss_pred             CCeecccCh
Q psy4407          94 KPFSCLLCE  102 (130)
Q Consensus        94 k~~~C~~C~  102 (130)
                      .++.|++|+
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            344555554


No 52 
>KOG2186|consensus
Probab=91.28  E-value=0.12  Score=34.78  Aligned_cols=45  Identities=22%  Similarity=0.550  Sum_probs=19.7

Q ss_pred             eeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHHHhh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLTKHM  115 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h~  115 (130)
                      |.|..||.... ...+..|+...++ .-|.|..|+..|.. .++..|.
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            34444444332 2333444444443 34555555555544 3344444


No 53 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.16  E-value=0.2  Score=29.53  Aligned_cols=17  Identities=12%  Similarity=0.204  Sum_probs=10.5

Q ss_pred             CCceeeCCCCCCcccCc
Q psy4407          64 KTYIFTCFACEYHSAKR   80 (130)
Q Consensus        64 ~~~~~~C~~C~~~f~~~   80 (130)
                      +..|..|+.||..|...
T Consensus        23 nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   23 NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCCCccCCCCCCccCcc
Confidence            34556677777666544


No 54 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=91.16  E-value=0.26  Score=23.03  Aligned_cols=11  Identities=18%  Similarity=0.268  Sum_probs=6.1

Q ss_pred             eeeCCCCCCcc
Q psy4407          67 IFTCFACEYHS   77 (130)
Q Consensus        67 ~~~C~~C~~~f   77 (130)
                      ...|+.|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            45566665544


No 55 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=91.10  E-value=0.17  Score=24.41  Aligned_cols=16  Identities=13%  Similarity=0.150  Sum_probs=11.6

Q ss_pred             ceecccccccccCccc
Q psy4407          32 MLTCKYCYEFLPNDAE   47 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~   47 (130)
                      .|.|..||..|.....
T Consensus         5 ey~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQS   20 (42)
T ss_pred             EEEeCCCCCEEEEEEE
Confidence            4889999988865433


No 56 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.79  E-value=0.087  Score=37.62  Aligned_cols=54  Identities=33%  Similarity=0.650  Sum_probs=34.4

Q ss_pred             eeeCCCCCCcccCchhHHHHHH--hhcCC--CCeecc--cChhhhcCcchHHHhhhhcCCC
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIR--QHTGE--KPFSCL--LCEYKAAKKSNLTKHMSKKHPS  121 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~--~h~~~--k~~~C~--~C~~~f~~~~~l~~h~~~~h~g  121 (130)
                      ++.|..|...|.....+..|.+  .|+++  +++.|.  .|++.|.....+..|. .+|.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~  348 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI-LLHTS  348 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc-ccccC
Confidence            4556666666666666666666  56666  666666  5666666666666666 55555


No 57 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=90.76  E-value=0.17  Score=33.56  Aligned_cols=48  Identities=19%  Similarity=0.414  Sum_probs=29.5

Q ss_pred             CcceecccccccccCccccccc------cCCCCCCcccCCCCce-----eeCCCCCCcccCc
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIAD------HCKFCSYKLRPDKTYI-----FTCFACEYHSAKR   80 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h------~c~~C~~~~~h~~~~~-----~~C~~C~~~f~~~   80 (130)
                      ++...|+.|++.|.++.-+...      .-+.|   ....+..|     +.|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~---~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFC---PRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCc---cccCCCCCeeeeEEECCCCCCccccc
Confidence            4678999999999876544333      12222   11123333     6899999877644


No 58 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.66  E-value=0.15  Score=36.47  Aligned_cols=62  Identities=18%  Similarity=0.224  Sum_probs=51.0

Q ss_pred             cceecccccccccCccccccccCCCCCCcc--cCCCC--ceeeCC--CCCCcccCchhHHHHHHhhcCCCCeecc
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHCKFCSYKL--RPDKT--YIFTCF--ACEYHSAKRSHIKEHIRQHTGEKPFSCL   99 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~h~~~h~~~k~~~C~   99 (130)
                      .++.|..|...|.....|..|.       +  .|.++  +++.|+  .|+..|.....+..|...|++..++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~-------~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHL-------RSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccc-------cccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            4678888888888888888887       6  68888  899998  7999999888888888888877666553


No 59 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=90.36  E-value=0.16  Score=25.40  Aligned_cols=30  Identities=20%  Similarity=0.425  Sum_probs=20.4

Q ss_pred             CcceecccccccccCccccccccCCCCCCc
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      ...|.|..||+.+........-.|+.||..
T Consensus         4 ~~~Y~C~~Cg~~~~~~~~~~~irCp~Cg~r   33 (49)
T COG1996           4 MMEYKCARCGREVELDQETRGIRCPYCGSR   33 (49)
T ss_pred             eEEEEhhhcCCeeehhhccCceeCCCCCcE
Confidence            456999999999854444444467777654


No 60 
>PHA00626 hypothetical protein
Probab=90.23  E-value=0.35  Score=24.77  Aligned_cols=13  Identities=23%  Similarity=0.774  Sum_probs=8.8

Q ss_pred             ceeeCCCCCCccc
Q psy4407          66 YIFTCFACEYHSA   78 (130)
Q Consensus        66 ~~~~C~~C~~~f~   78 (130)
                      ..|.|..||..|.
T Consensus        22 nrYkCkdCGY~ft   34 (59)
T PHA00626         22 DDYVCCDCGYNDS   34 (59)
T ss_pred             cceEcCCCCCeec
Confidence            4577777777664


No 61 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.14  E-value=0.36  Score=22.48  Aligned_cols=13  Identities=15%  Similarity=0.381  Sum_probs=7.2

Q ss_pred             eecccccccccCc
Q psy4407          33 LTCKYCYEFLPND   45 (130)
Q Consensus        33 ~~C~~C~~~~~~~   45 (130)
                      ..|+.|+..|.-.
T Consensus         3 ~~CP~C~~~~~v~   15 (38)
T TIGR02098         3 IQCPNCKTSFRVV   15 (38)
T ss_pred             EECCCCCCEEEeC
Confidence            4566666665443


No 62 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.12  E-value=0.47  Score=22.04  Aligned_cols=14  Identities=36%  Similarity=0.553  Sum_probs=7.7

Q ss_pred             ecccccccccCccc
Q psy4407          34 TCKYCYEFLPNDAE   47 (130)
Q Consensus        34 ~C~~C~~~~~~~~~   47 (130)
                      .|+.|+..|.-...
T Consensus         4 ~Cp~C~~~y~i~d~   17 (36)
T PF13717_consen    4 TCPNCQAKYEIDDE   17 (36)
T ss_pred             ECCCCCCEEeCCHH
Confidence            46666666654433


No 63 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.10  E-value=0.22  Score=23.55  Aligned_cols=14  Identities=14%  Similarity=0.209  Sum_probs=10.5

Q ss_pred             ceecccccccccCc
Q psy4407          32 MLTCKYCYEFLPND   45 (130)
Q Consensus        32 ~~~C~~C~~~~~~~   45 (130)
                      .|+|..||..|...
T Consensus         5 ~y~C~~Cg~~fe~~   18 (41)
T smart00834        5 EYRCEDCGHTFEVL   18 (41)
T ss_pred             EEEcCCCCCEEEEE
Confidence            47899999887543


No 64 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=89.73  E-value=0.39  Score=37.55  Aligned_cols=9  Identities=22%  Similarity=0.575  Sum_probs=5.6

Q ss_pred             ccccccccc
Q psy4407          35 CKYCYEFLP   43 (130)
Q Consensus        35 C~~C~~~~~   43 (130)
                      |..||..+.
T Consensus       438 C~~Cg~v~~  446 (730)
T COG1198         438 CRDCGYIAE  446 (730)
T ss_pred             cccCCCccc
Confidence            666666653


No 65 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=88.29  E-value=0.5  Score=26.56  Aligned_cols=29  Identities=28%  Similarity=0.512  Sum_probs=16.0

Q ss_pred             ccCCCCCCcc-cCCCCceeeCCCCCCcccC
Q psy4407          51 DHCKFCSYKL-RPDKTYIFTCFACEYHSAK   79 (130)
Q Consensus        51 h~c~~C~~~~-~h~~~~~~~C~~C~~~f~~   79 (130)
                      |.|+.|+... ...+...|.|..||..|.-
T Consensus        36 ~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          36 HVCPFCGRTTVKRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CcCCCCCCcceeeeccCeEEcCCCCCeecc
Confidence            3455555441 1123445888888877753


No 66 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.26  E-value=0.37  Score=23.53  Aligned_cols=26  Identities=19%  Similarity=0.384  Sum_probs=15.0

Q ss_pred             ceecccccccccCccccccccCCCCCC
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      .|.|..||..+... ....-.|+.||.
T Consensus         2 ~Y~C~~Cg~~~~~~-~~~~irC~~CG~   27 (44)
T smart00659        2 IYICGECGRENEIK-SKDVVRCRECGY   27 (44)
T ss_pred             EEECCCCCCEeecC-CCCceECCCCCc
Confidence            47888888877543 222224555554


No 67 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=88.20  E-value=0.28  Score=29.79  Aligned_cols=28  Identities=18%  Similarity=0.408  Sum_probs=22.1

Q ss_pred             ceecccccccccCccccccccCCCCCCc
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      |++|..||+.|.+-+.-..--|+.||..
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~GCP~CGg~   28 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILSGCPECGGN   28 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHccCcccCCc
Confidence            5789999999987664444569999887


No 68 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=88.04  E-value=0.52  Score=20.23  Aligned_cols=9  Identities=33%  Similarity=0.770  Sum_probs=4.8

Q ss_pred             eCCCCCCcc
Q psy4407          69 TCFACEYHS   77 (130)
Q Consensus        69 ~C~~C~~~f   77 (130)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            455555554


No 69 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=87.58  E-value=0.59  Score=21.16  Aligned_cols=11  Identities=18%  Similarity=0.365  Sum_probs=7.2

Q ss_pred             eeccccccccc
Q psy4407          33 LTCKYCYEFLP   43 (130)
Q Consensus        33 ~~C~~C~~~~~   43 (130)
                      |.|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            56777777765


No 70 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.24  E-value=0.43  Score=23.91  Aligned_cols=14  Identities=14%  Similarity=0.173  Sum_probs=10.9

Q ss_pred             ceecccccccccCc
Q psy4407          32 MLTCKYCYEFLPND   45 (130)
Q Consensus        32 ~~~C~~C~~~~~~~   45 (130)
                      .|+|..||..|...
T Consensus         5 ey~C~~Cg~~fe~~   18 (52)
T TIGR02605         5 EYRCTACGHRFEVL   18 (52)
T ss_pred             EEEeCCCCCEeEEE
Confidence            48899999988643


No 71 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=87.13  E-value=0.3  Score=28.27  Aligned_cols=28  Identities=25%  Similarity=0.524  Sum_probs=23.5

Q ss_pred             ceecccccccccCccccccccCCCCCCc
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      |+.|..||..|.+-+.+...-|+.||..
T Consensus         2 pH~CtrCG~vf~~g~~~il~GCp~CG~n   29 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEILSGCPKCGCN   29 (112)
T ss_pred             CceecccccccccccHHHHccCccccch
Confidence            6789999999988666666779999887


No 72 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=86.45  E-value=1.1  Score=18.87  Aligned_cols=7  Identities=43%  Similarity=1.198  Sum_probs=3.2

Q ss_pred             eeCCCCC
Q psy4407          68 FTCFACE   74 (130)
Q Consensus        68 ~~C~~C~   74 (130)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4444444


No 73 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=85.69  E-value=0.46  Score=24.34  Aligned_cols=28  Identities=18%  Similarity=0.374  Sum_probs=16.7

Q ss_pred             CCCCceeeCCCCCCcccCchhHHHHHHh
Q psy4407          62 PDKTYIFTCFACEYHSAKRSHIKEHIRQ   89 (130)
Q Consensus        62 h~~~~~~~C~~C~~~f~~~~~l~~h~~~   89 (130)
                      ..|+..+.|+.||..|.....+..|...
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            3455566666666666666666665543


No 74 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=83.90  E-value=1  Score=20.60  Aligned_cols=10  Identities=20%  Similarity=0.434  Sum_probs=5.8

Q ss_pred             eecccccccc
Q psy4407          33 LTCKYCYEFL   42 (130)
Q Consensus        33 ~~C~~C~~~~   42 (130)
                      |.|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            5566666554


No 75 
>KOG2893|consensus
Probab=82.59  E-value=0.51  Score=31.72  Aligned_cols=42  Identities=21%  Similarity=0.459  Sum_probs=24.7

Q ss_pred             ecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHH
Q psy4407          34 TCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEH   86 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h   86 (130)
                      .|..|.+.|....-|.+|+           ..|.|+|.+|-+-..+-..|..|
T Consensus        12 wcwycnrefddekiliqhq-----------kakhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQ-----------KAKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhh-----------hhccceeeeehhhhccCCCceee
Confidence            3556777776666665552           34556777776555555555555


No 76 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.00  E-value=1.2  Score=26.97  Aligned_cols=28  Identities=7%  Similarity=-0.152  Sum_probs=14.9

Q ss_pred             CCCCCCcccCCCCceeeCCCCCCcccCc
Q psy4407          53 CKFCSYKLRPDKTYIFTCFACEYHSAKR   80 (130)
Q Consensus        53 c~~C~~~~~h~~~~~~~C~~C~~~f~~~   80 (130)
                      |+.||..+--.+..|..|+.||..+...
T Consensus        12 Cp~cg~kFYDLnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        12 CPNTGSKFYDLNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCCcCccccccCCCCccCCCcCCccCcc
Confidence            3333333333344566777777776544


No 77 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=81.90  E-value=1.6  Score=32.76  Aligned_cols=9  Identities=33%  Similarity=0.770  Sum_probs=5.2

Q ss_pred             ecccccccc
Q psy4407          34 TCKYCYEFL   42 (130)
Q Consensus        34 ~C~~C~~~~   42 (130)
                      .|..||...
T Consensus       215 ~C~~Cg~~~  223 (505)
T TIGR00595       215 LCRSCGYIL  223 (505)
T ss_pred             EhhhCcCcc
Confidence            466666554


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=81.74  E-value=0.8  Score=28.46  Aligned_cols=40  Identities=15%  Similarity=0.114  Sum_probs=26.2

Q ss_pred             cccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcc
Q psy4407          27 RFETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHS   77 (130)
Q Consensus        27 ~~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f   77 (130)
                      -.+...|.|+.|+..|.....+..-          .. ...|.|+.||...
T Consensus        94 e~~~~~Y~Cp~C~~~y~~~ea~~~~----------d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       94 ETNNAYYKCPNCQSKYTFLEANQLL----------DM-DGTFTCPRCGEEL  133 (147)
T ss_pred             ccCCcEEECcCCCCEeeHHHHHHhc----------CC-CCcEECCCCCCEE
Confidence            3455679999999998765543321          11 3338898888655


No 79 
>KOG2893|consensus
Probab=80.02  E-value=0.4  Score=32.22  Aligned_cols=45  Identities=22%  Similarity=0.505  Sum_probs=28.4

Q ss_pred             CceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhcCcchHHHh
Q psy4407          65 TYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAAKKSNLTKH  114 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~~~~~l~~h  114 (130)
                      .|+| |=.|++.|....-|.+|++    .|.|+|.+|-+...+-..|..|
T Consensus         9 ~kpw-cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            4454 4467788887777777765    3557888877765554444433


No 80 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=78.77  E-value=2.2  Score=33.31  Aligned_cols=9  Identities=22%  Similarity=0.538  Sum_probs=5.3

Q ss_pred             ecccccccc
Q psy4407          34 TCKYCYEFL   42 (130)
Q Consensus        34 ~C~~C~~~~   42 (130)
                      .|..||..+
T Consensus       385 ~C~~Cg~~~  393 (665)
T PRK14873        385 ACARCRTPA  393 (665)
T ss_pred             EhhhCcCee
Confidence            466666554


No 81 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=78.26  E-value=3.1  Score=24.70  Aligned_cols=87  Identities=14%  Similarity=0.190  Sum_probs=45.8

Q ss_pred             cceecccccccccCccccccccC---CCCCCcccCCC--CceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhh
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHC---KFCSYKLRPDK--TYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKA  105 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c---~~C~~~~~h~~--~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f  105 (130)
                      -|-.|+.||-.......|.+..-   +.-........  ...-.|..|...|........  ..-.....|.|..|...|
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCcc
Confidence            35566777766666555554410   00000001000  011248888887765431110  001223468999999988


Q ss_pred             cCcchHHHhhhhcCC
Q psy4407         106 AKKSNLTKHMSKKHP  120 (130)
Q Consensus       106 ~~~~~l~~h~~~~h~  120 (130)
                      --.-+.-.|. .+|+
T Consensus        92 C~dCD~fiHe-~Lh~  105 (112)
T TIGR00622        92 CVDCDVFVHE-SLHC  105 (112)
T ss_pred             ccccchhhhh-hccC
Confidence            8777777787 6665


No 82 
>KOG2907|consensus
Probab=77.92  E-value=1.2  Score=26.30  Aligned_cols=38  Identities=18%  Similarity=0.459  Sum_probs=19.4

Q ss_pred             eeCCCCCCcccCchhHHHHHHhhcC-CCCeecccChhhhc
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQHTG-EKPFSCLLCEYKAA  106 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h~~-~k~~~C~~C~~~f~  106 (130)
                      ..|+.||..-.+-..++.- ..+-| ..-|.|..|++.|.
T Consensus        75 ~kCpkCghe~m~Y~T~QlR-SADEGQTVFYTC~kC~~k~~  113 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQLR-SADEGQTVFYTCPKCKYKFT  113 (116)
T ss_pred             ccCcccCCchhhhhhhhcc-cccCCceEEEEcCccceeee
Confidence            5788887533222222211 01222 23488888887765


No 83 
>KOG4173|consensus
Probab=76.98  E-value=0.61  Score=30.64  Aligned_cols=82  Identities=18%  Similarity=0.372  Sum_probs=56.2

Q ss_pred             Ccceeccc--ccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHh-h---------cCCCCee
Q psy4407          30 TEMLTCKY--CYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQ-H---------TGEKPFS   97 (130)
Q Consensus        30 ~~~~~C~~--C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~-h---------~~~k~~~   97 (130)
                      ...+.|..  |-..|.+......|.       .+-.   ...|..|.+.|.+.--|..|+.. |         .|.--|.
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY-------~~~h---~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~  146 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHY-------HTLH---GNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQ  146 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhh-------hhcc---cchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHH
Confidence            34466765  667776666555553       2211   13799999999999888888753 3         2334588


Q ss_pred             ccc--ChhhhcCcchHHHhhhhcCCC
Q psy4407          98 CLL--CEYKAAKKSNLTKHMSKKHPS  121 (130)
Q Consensus        98 C~~--C~~~f~~~~~l~~h~~~~h~g  121 (130)
                      |.+  |+..|........|+-.+|.-
T Consensus       147 ClvEgCt~KFkT~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  147 CLVEGCTEKFKTSRDRKDHMIRMHKY  172 (253)
T ss_pred             HHHHhhhhhhhhhhhhhhHHHHhccC
Confidence            854  999999888888888666653


No 84 
>PF12773 DZR:  Double zinc ribbon
Probab=76.72  E-value=2.4  Score=20.89  Aligned_cols=8  Identities=25%  Similarity=0.501  Sum_probs=3.4

Q ss_pred             eeCCCCCC
Q psy4407          68 FTCFACEY   75 (130)
Q Consensus        68 ~~C~~C~~   75 (130)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            34444443


No 85 
>KOG1146|consensus
Probab=76.38  E-value=1.5  Score=36.42  Aligned_cols=55  Identities=25%  Similarity=0.596  Sum_probs=42.4

Q ss_pred             CCCCceeeCCCCCCcccCchhHHHHHHh-hc------------------------CCCCeecccChhhhcCcchHHHhhh
Q psy4407          62 PDKTYIFTCFACEYHSAKRSHIKEHIRQ-HT------------------------GEKPFSCLLCEYKAAKKSNLTKHMS  116 (130)
Q Consensus        62 h~~~~~~~C~~C~~~f~~~~~l~~h~~~-h~------------------------~~k~~~C~~C~~~f~~~~~l~~h~~  116 (130)
                      ++..+.+.|+.|+..|.....|..|++. |.                        +.++|.|..|...+.....|..|+.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            3344678888888888888888888876 11                        1367899999999999899988884


No 86 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=76.34  E-value=2.2  Score=24.26  Aligned_cols=15  Identities=27%  Similarity=0.505  Sum_probs=10.4

Q ss_pred             CceeeCCCCCCcccC
Q psy4407          65 TYIFTCFACEYHSAK   79 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~   79 (130)
                      ...|.|..|++.|.-
T Consensus        52 ~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         52 VGIWRCKGCKKTVAG   66 (90)
T ss_pred             eEEEEcCCCCCEEeC
Confidence            455788888877654


No 87 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=76.31  E-value=1.6  Score=27.49  Aligned_cols=23  Identities=9%  Similarity=0.209  Sum_probs=17.1

Q ss_pred             hcccCcceecccccccccCcccc
Q psy4407          26 FRFETEMLTCKYCYEFLPNDAEI   48 (130)
Q Consensus        26 ~~~~~~~~~C~~C~~~~~~~~~l   48 (130)
                      ......-|.|+.|+..|.....+
T Consensus       103 ~e~~~~~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       103 FETNNMFFICPNMCVRFTFNEAM  125 (158)
T ss_pred             hccCCCeEECCCCCcEeeHHHHH
Confidence            34556779999999888766654


No 88 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=75.63  E-value=1.9  Score=27.15  Aligned_cols=19  Identities=16%  Similarity=0.289  Sum_probs=13.0

Q ss_pred             eeeCCCCCCcccCchhHHH
Q psy4407          67 IFTCFACEYHSAKRSHIKE   85 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~   85 (130)
                      .+.|+.||..|.+...+..
T Consensus        28 ~~~c~~c~~~f~~~e~~~~   46 (154)
T PRK00464         28 RRECLACGKRFTTFERVEL   46 (154)
T ss_pred             eeeccccCCcceEeEeccC
Confidence            3778888888876655443


No 89 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=75.49  E-value=4.4  Score=20.02  Aligned_cols=12  Identities=33%  Similarity=0.885  Sum_probs=6.7

Q ss_pred             eeeCCCCCCccc
Q psy4407          67 IFTCFACEYHSA   78 (130)
Q Consensus        67 ~~~C~~C~~~f~   78 (130)
                      .+.|+.||..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            456666665443


No 90 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=74.36  E-value=2.3  Score=27.12  Aligned_cols=10  Identities=40%  Similarity=0.952  Sum_probs=5.6

Q ss_pred             CCCeecccCh
Q psy4407          93 EKPFSCLLCE  102 (130)
Q Consensus        93 ~k~~~C~~C~  102 (130)
                      +-|-+|++||
T Consensus       147 e~P~~CPiCg  156 (166)
T COG1592         147 EAPEVCPICG  156 (166)
T ss_pred             CCCCcCCCCC
Confidence            4455565555


No 91 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=74.36  E-value=3  Score=21.38  Aligned_cols=43  Identities=14%  Similarity=0.215  Sum_probs=23.1

Q ss_pred             cceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCC
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEY   75 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~   75 (130)
                      +.|+|..||-.|.-...--  .+.+++-+..-.-.-.+.|++||.
T Consensus         2 ~~~~C~~CG~vYd~e~Gdp--~~gi~pgT~fedlPd~w~CP~Cg~   44 (55)
T COG1773           2 KRWRCSVCGYVYDPEKGDP--RCGIAPGTPFEDLPDDWVCPECGV   44 (55)
T ss_pred             CceEecCCceEeccccCCc--cCCCCCCCchhhCCCccCCCCCCC
Confidence            3588999999886543322  233333221111112378888884


No 92 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=74.23  E-value=1.9  Score=27.81  Aligned_cols=21  Identities=14%  Similarity=0.256  Sum_probs=15.4

Q ss_pred             ccCcceecccccccccCcccc
Q psy4407          28 FETEMLTCKYCYEFLPNDAEI   48 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~~~l   48 (130)
                      ....-|.|+.|+..|.....+
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHHh
Confidence            345678999999888766554


No 93 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=74.15  E-value=2.3  Score=24.24  Aligned_cols=15  Identities=40%  Similarity=0.536  Sum_probs=10.0

Q ss_pred             CceeeCCCCCCcccC
Q psy4407          65 TYIFTCFACEYHSAK   79 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~   79 (130)
                      ...|.|..|+..|.-
T Consensus        51 ~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        51 TGIWTCRKCGAKFAG   65 (91)
T ss_pred             eEEEEcCCCCCEEeC
Confidence            445778888777653


No 94 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=74.13  E-value=4.2  Score=20.13  Aligned_cols=14  Identities=14%  Similarity=0.368  Sum_probs=10.3

Q ss_pred             eecccccccccCcc
Q psy4407          33 LTCKYCYEFLPNDA   46 (130)
Q Consensus        33 ~~C~~C~~~~~~~~   46 (130)
                      |+|..||..|....
T Consensus         2 y~C~~CgyvYd~~~   15 (47)
T PF00301_consen    2 YQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEETTTSBEEETTT
T ss_pred             cCCCCCCEEEcCCc
Confidence            78888888776543


No 95 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=74.00  E-value=1  Score=19.71  Aligned_cols=19  Identities=26%  Similarity=0.592  Sum_probs=8.7

Q ss_pred             eecccChhhhcCcchHHHhh
Q psy4407          96 FSCLLCEYKAAKKSNLTKHM  115 (130)
Q Consensus        96 ~~C~~C~~~f~~~~~l~~h~  115 (130)
                      |.|..|++.| ....++.|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            3566666666 333444444


No 96 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=73.72  E-value=2.1  Score=21.86  Aligned_cols=24  Identities=21%  Similarity=0.580  Sum_probs=13.3

Q ss_pred             eecccccccccCccccccccCCCCCC
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      ..|..||+.|....++.  .|+.|+.
T Consensus         6 ~~C~~Cg~~~~~~dDiV--vCp~Cga   29 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIV--VCPECGA   29 (54)
T ss_pred             ccChhhCCcccCCCCEE--ECCCCCC
Confidence            45777777775443332  3555554


No 97 
>KOG3408|consensus
Probab=73.67  E-value=2.3  Score=25.52  Aligned_cols=27  Identities=19%  Similarity=0.341  Sum_probs=23.6

Q ss_pred             CCCceeeCCCCCCcccCchhHHHHHHh
Q psy4407          63 DKTYIFTCFACEYHSAKRSHIKEHIRQ   89 (130)
Q Consensus        63 ~~~~~~~C~~C~~~f~~~~~l~~h~~~   89 (130)
                      .|-..|.|..|.+.|.+...+..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            456679999999999999999999874


No 98 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=73.01  E-value=1.6  Score=29.87  Aligned_cols=21  Identities=24%  Similarity=0.676  Sum_probs=13.6

Q ss_pred             cCcceecccccccccCccccc
Q psy4407          29 ETEMLTCKYCYEFLPNDAEII   49 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~~l~   49 (130)
                      |-+.|+|..|...+.....+.
T Consensus       139 GGrif~CsfC~~flCEDDQFE  159 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQFE  159 (314)
T ss_pred             CCeEEEeecCCCeeeccchhh
Confidence            456678888877766554443


No 99 
>KOG1146|consensus
Probab=72.83  E-value=1.7  Score=36.15  Aligned_cols=66  Identities=15%  Similarity=0.295  Sum_probs=48.4

Q ss_pred             hhhcccCcceecccccccccCccccccccCC--------CCCCc----------ccCCCCceeeCCCCCCcccCchhHHH
Q psy4407          24 VDFRFETEMLTCKYCYEFLPNDAEIIADHCK--------FCSYK----------LRPDKTYIFTCFACEYHSAKRSHIKE   85 (130)
Q Consensus        24 ~~~~~~~~~~~C~~C~~~~~~~~~l~~h~c~--------~C~~~----------~~h~~~~~~~C~~C~~~f~~~~~l~~   85 (130)
                      .-.+...+.+.|+.|+..|.....|..|+=.        .|-..          ....+.++|.|..|...+.....|..
T Consensus       457 ~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsi  536 (1406)
T KOG1146|consen  457 VVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSI  536 (1406)
T ss_pred             eeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHH
Confidence            3456677999999999999998999888411        22111          11123568999999999999999999


Q ss_pred             HHHh
Q psy4407          86 HIRQ   89 (130)
Q Consensus        86 h~~~   89 (130)
                      |+..
T Consensus       537 hlqS  540 (1406)
T KOG1146|consen  537 HLQS  540 (1406)
T ss_pred             HHHH
Confidence            9864


No 100
>PRK04023 DNA polymerase II large subunit; Validated
Probab=71.13  E-value=5.3  Score=32.65  Aligned_cols=35  Identities=20%  Similarity=0.549  Sum_probs=21.6

Q ss_pred             CcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCC
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACE   74 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~   74 (130)
                      .....|+.||...      ....|+.||..    .+..+.|+.|+
T Consensus       624 Vg~RfCpsCG~~t------~~frCP~CG~~----Te~i~fCP~CG  658 (1121)
T PRK04023        624 IGRRKCPSCGKET------FYRRCPFCGTH----TEPVYRCPRCG  658 (1121)
T ss_pred             ccCccCCCCCCcC------CcccCCCCCCC----CCcceeCcccc
Confidence            3456799999873      23468888764    12335566664


No 101
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=71.06  E-value=4.4  Score=20.30  Aligned_cols=9  Identities=33%  Similarity=1.014  Sum_probs=4.6

Q ss_pred             eeCCCCCCc
Q psy4407          68 FTCFACEYH   76 (130)
Q Consensus        68 ~~C~~C~~~   76 (130)
                      +.|..||..
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            455555543


No 102
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=70.74  E-value=3.6  Score=19.67  Aligned_cols=11  Identities=18%  Similarity=0.250  Sum_probs=4.3

Q ss_pred             eeCCCCCCccc
Q psy4407          68 FTCFACEYHSA   78 (130)
Q Consensus        68 ~~C~~C~~~f~   78 (130)
                      ..|..|+..+.
T Consensus        17 a~C~~C~~~~~   27 (45)
T PF02892_consen   17 AKCKYCGKVIK   27 (45)
T ss_dssp             EEETTTTEE--
T ss_pred             EEeCCCCeEEe
Confidence            44555554433


No 103
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=70.39  E-value=3.2  Score=32.71  Aligned_cols=41  Identities=20%  Similarity=0.492  Sum_probs=23.1

Q ss_pred             ceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCc
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYH   76 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~   76 (130)
                      ..+|+.|+..+.-...-..-.|-.||..    ...|..|+.||..
T Consensus       444 v~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~----~~~p~~Cp~Cgs~  484 (730)
T COG1198         444 IAECPNCDSPLTLHKATGQLRCHYCGYQ----EPIPQSCPECGSE  484 (730)
T ss_pred             cccCCCCCcceEEecCCCeeEeCCCCCC----CCCCCCCCCCCCC
Confidence            3668888876543222222246666442    4566778888755


No 104
>PRK05580 primosome assembly protein PriA; Validated
Probab=70.16  E-value=5  Score=31.44  Aligned_cols=21  Identities=24%  Similarity=0.719  Sum_probs=10.8

Q ss_pred             cCCCCCCcccCCCCceeeCCCCCCc
Q psy4407          52 HCKFCSYKLRPDKTYIFTCFACEYH   76 (130)
Q Consensus        52 ~c~~C~~~~~h~~~~~~~C~~C~~~   76 (130)
                      .|..||..    ...+..|+.||..
T Consensus       410 ~Ch~Cg~~----~~~~~~Cp~Cg~~  430 (679)
T PRK05580        410 RCHHCGYQ----EPIPKACPECGST  430 (679)
T ss_pred             ECCCCcCC----CCCCCCCCCCcCC
Confidence            35555432    2334567777654


No 105
>PF14353 CpXC:  CpXC protein
Probab=69.93  E-value=2.6  Score=25.40  Aligned_cols=12  Identities=25%  Similarity=0.454  Sum_probs=8.0

Q ss_pred             ecccccccccCc
Q psy4407          34 TCKYCYEFLPND   45 (130)
Q Consensus        34 ~C~~C~~~~~~~   45 (130)
                      .|+.|+..|...
T Consensus         3 tCP~C~~~~~~~   14 (128)
T PF14353_consen    3 TCPHCGHEFEFE   14 (128)
T ss_pred             CCCCCCCeeEEE
Confidence            577788776543


No 106
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=69.89  E-value=1.6  Score=23.42  Aligned_cols=25  Identities=20%  Similarity=0.588  Sum_probs=16.1

Q ss_pred             eecccccccccCccccccccCCCCCCc
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      |.| .||.....+..-..+.| .||..
T Consensus         4 frC-~Cgr~lya~e~~kTkkC-~CG~~   28 (68)
T PF09082_consen    4 FRC-DCGRYLYAKEGAKTKKC-VCGKT   28 (68)
T ss_dssp             EEE-TTS--EEEETT-SEEEE-TTTEE
T ss_pred             EEe-cCCCEEEecCCcceeEe-cCCCe
Confidence            678 58887777777777777 77775


No 107
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=69.26  E-value=4.1  Score=19.22  Aligned_cols=15  Identities=13%  Similarity=0.494  Sum_probs=12.6

Q ss_pred             ceecccccccccCcc
Q psy4407          32 MLTCKYCYEFLPNDA   46 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~   46 (130)
                      ||.|..|+..|....
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            789999999998764


No 108
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=69.14  E-value=6.6  Score=27.71  Aligned_cols=43  Identities=19%  Similarity=0.389  Sum_probs=21.5

Q ss_pred             Ccceeccccccccc-------CccccccccCCCCCCcccCCCCceeeCCCCCC
Q psy4407          30 TEMLTCKYCYEFLP-------NDAEIIADHCKFCSYKLRPDKTYIFTCFACEY   75 (130)
Q Consensus        30 ~~~~~C~~C~~~~~-------~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~   75 (130)
                      +..-.|+.||..=.       ....++.-.|..|+..   +.-....|+.||.
T Consensus       185 ~~~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~te---W~~~R~~C~~Cg~  234 (309)
T PRK03564        185 EQRQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESE---WHVVRVKCSNCEQ  234 (309)
T ss_pred             cCCCCCCCCCCcchhheeeccCCCCceEEEcCCCCCc---ccccCccCCCCCC
Confidence            34456888885421       1122222257777442   2233356777775


No 109
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=69.05  E-value=2.3  Score=18.89  Aligned_cols=7  Identities=29%  Similarity=0.970  Sum_probs=2.9

Q ss_pred             eeCCCCC
Q psy4407          68 FTCFACE   74 (130)
Q Consensus        68 ~~C~~C~   74 (130)
                      +.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444443


No 110
>KOG2186|consensus
Probab=68.45  E-value=2.1  Score=29.09  Aligned_cols=51  Identities=22%  Similarity=0.397  Sum_probs=33.9

Q ss_pred             eecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcCC
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGE   93 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~   93 (130)
                      |.|..||..... -.+..|+       ..-.+ .-|.|..|+..|-. ..+..|...-+..
T Consensus         4 FtCnvCgEsvKK-p~vekH~-------srCrn-~~fSCIDC~k~F~~-~sYknH~kCITEa   54 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHM-------SRCRN-AYFSCIDCGKTFER-VSYKNHTKCITEA   54 (276)
T ss_pred             Eehhhhhhhccc-cchHHHH-------HhccC-CeeEEeeccccccc-chhhhhhhhcchH
Confidence            678888887754 4455563       22233 45889999999887 6677787655443


No 111
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=68.42  E-value=4  Score=18.73  Aligned_cols=17  Identities=12%  Similarity=0.223  Sum_probs=8.3

Q ss_pred             ecccccccccCcccccc
Q psy4407          34 TCKYCYEFLPNDAEIIA   50 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~   50 (130)
                      .|..|++.|..+.-+..
T Consensus         5 ~C~eC~~~f~dSyL~~~   21 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLNN   21 (34)
T ss_dssp             E-TTT--EES-SSCCCC
T ss_pred             hHhHhCCHHHHHHHHHh
Confidence            68899999876444333


No 112
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=68.38  E-value=3.5  Score=23.45  Aligned_cols=15  Identities=33%  Similarity=0.479  Sum_probs=9.8

Q ss_pred             CceeeCCCCCCcccC
Q psy4407          65 TYIFTCFACEYHSAK   79 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~   79 (130)
                      ...|.|..|+..|.-
T Consensus        52 ~GIW~C~~C~~~~AG   66 (90)
T PRK03976         52 TGIWECRKCGAKFAG   66 (90)
T ss_pred             EEEEEcCCCCCEEeC
Confidence            345777777776653


No 113
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=67.70  E-value=1.9  Score=24.54  Aligned_cols=12  Identities=33%  Similarity=0.675  Sum_probs=8.5

Q ss_pred             eeeCCCCCCccc
Q psy4407          67 IFTCFACEYHSA   78 (130)
Q Consensus        67 ~~~C~~C~~~f~   78 (130)
                      .|.|..|+..|.
T Consensus        53 IW~C~~C~~~~A   64 (90)
T PF01780_consen   53 IWKCKKCGKKFA   64 (90)
T ss_dssp             EEEETTTTEEEE
T ss_pred             EeecCCCCCEEe
Confidence            377888877665


No 114
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=67.37  E-value=6.1  Score=24.22  Aligned_cols=26  Identities=15%  Similarity=0.558  Sum_probs=20.2

Q ss_pred             ccCcceecccccccccCccccccccC
Q psy4407          28 FETEMLTCKYCYEFLPNDAEIIADHC   53 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~~~l~~h~c   53 (130)
                      .+.+-|+|..|.+....+..|+.-.|
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLKPneC  101 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLKPNEC  101 (140)
T ss_pred             cCCCceeccCcccccchhhcCCcccc
Confidence            34578999999999888777776643


No 115
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=66.83  E-value=5.9  Score=18.34  Aligned_cols=11  Identities=18%  Similarity=0.401  Sum_probs=7.4

Q ss_pred             ecccccccccC
Q psy4407          34 TCKYCYEFLPN   44 (130)
Q Consensus        34 ~C~~C~~~~~~   44 (130)
                      .|+.||..|..
T Consensus         3 ~C~~Cg~~Yh~   13 (36)
T PF05191_consen    3 ICPKCGRIYHI   13 (36)
T ss_dssp             EETTTTEEEET
T ss_pred             CcCCCCCcccc
Confidence            57777777753


No 116
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=66.54  E-value=4.7  Score=20.60  Aligned_cols=11  Identities=18%  Similarity=0.483  Sum_probs=7.8

Q ss_pred             eeccccccccc
Q psy4407          33 LTCKYCYEFLP   43 (130)
Q Consensus        33 ~~C~~C~~~~~   43 (130)
                      |.|+.||..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            57888887654


No 117
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=66.49  E-value=4.2  Score=19.53  Aligned_cols=23  Identities=17%  Similarity=0.228  Sum_probs=13.7

Q ss_pred             cceecccccccccCcc-ccccccC
Q psy4407          31 EMLTCKYCYEFLPNDA-EIIADHC   53 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~-~l~~h~c   53 (130)
                      -++.|..|++.|.... ....|.|
T Consensus        12 ~~~~C~~C~~~FC~~Hr~~e~H~C   35 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKHRLPEDHNC   35 (43)
T ss_dssp             SHEE-TTTS-EE-TTTHSTTTCT-
T ss_pred             CCeECCCCCcccCccccCccccCC
Confidence            5899999999998764 3444544


No 118
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=66.07  E-value=5.3  Score=20.06  Aligned_cols=13  Identities=15%  Similarity=0.444  Sum_probs=9.6

Q ss_pred             eecccccccccCc
Q psy4407          33 LTCKYCYEFLPND   45 (130)
Q Consensus        33 ~~C~~C~~~~~~~   45 (130)
                      |+|..||..|...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            6788888877643


No 119
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=65.99  E-value=3.1  Score=28.90  Aligned_cols=48  Identities=15%  Similarity=0.336  Sum_probs=15.5

Q ss_pred             cCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChh
Q psy4407          52 HCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEY  103 (130)
Q Consensus        52 ~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~  103 (130)
                      .|..|+..   +.-....|+.||..-.....+.. .....+.+...|..|+.
T Consensus       199 ~Cs~C~t~---W~~~R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~C~~C~~  246 (290)
T PF04216_consen  199 HCSLCGTE---WRFVRIKCPYCGNTDHEKLEYFT-VEGEPAYRVEVCESCGS  246 (290)
T ss_dssp             EETTT--E---EE--TTS-TTT---SS-EEE---------SEEEEEETTTTE
T ss_pred             EcCCCCCe---eeecCCCCcCCCCCCCcceeeEe-cCCCCcEEEEECCcccc
Confidence            46666543   11112356666655443333211 11122344566666654


No 120
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=64.60  E-value=5.8  Score=18.16  Aligned_cols=8  Identities=38%  Similarity=1.161  Sum_probs=4.2

Q ss_pred             eeCCCCCC
Q psy4407          68 FTCFACEY   75 (130)
Q Consensus        68 ~~C~~C~~   75 (130)
                      +.|+.||.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555553


No 121
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=64.46  E-value=4.6  Score=23.97  Aligned_cols=27  Identities=15%  Similarity=0.314  Sum_probs=15.0

Q ss_pred             CcceecccccccccCccccccccCCCCCC
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      .....|..||..|......  ..|+.||.
T Consensus        68 p~~~~C~~Cg~~~~~~~~~--~~CP~Cgs   94 (113)
T PRK12380         68 PAQAWCWDCSQVVEIHQHD--AQCPHCHG   94 (113)
T ss_pred             CcEEEcccCCCEEecCCcC--ccCcCCCC
Confidence            3456788888776543211  12666654


No 122
>PRK12496 hypothetical protein; Provisional
Probab=64.30  E-value=5.5  Score=25.33  Aligned_cols=25  Identities=32%  Similarity=0.664  Sum_probs=15.3

Q ss_pred             eecccccccccCccccccccCCCCCCc
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      |.|.-|++.|....  ..-.|+.||..
T Consensus       128 ~~C~gC~~~~~~~~--~~~~C~~CG~~  152 (164)
T PRK12496        128 KVCKGCKKKYPEDY--PDDVCEICGSP  152 (164)
T ss_pred             EECCCCCccccCCC--CCCcCCCCCCh
Confidence            66888888885321  12247777654


No 123
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=64.05  E-value=5.7  Score=18.40  Aligned_cols=10  Identities=20%  Similarity=0.577  Sum_probs=5.2

Q ss_pred             CceeeCCCCC
Q psy4407          65 TYIFTCFACE   74 (130)
Q Consensus        65 ~~~~~C~~C~   74 (130)
                      +..+.|..||
T Consensus        23 dG~~yC~~cG   32 (36)
T PF11781_consen   23 DGFYYCDRCG   32 (36)
T ss_pred             CCEEEhhhCc
Confidence            3445565555


No 124
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=63.73  E-value=8  Score=16.41  Aligned_cols=19  Identities=21%  Similarity=0.445  Sum_probs=10.9

Q ss_pred             eCCCCCCcccCchhHHHHHH
Q psy4407          69 TCFACEYHSAKRSHIKEHIR   88 (130)
Q Consensus        69 ~C~~C~~~f~~~~~l~~h~~   88 (130)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666665 4455555554


No 125
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=62.59  E-value=8.6  Score=20.29  Aligned_cols=27  Identities=22%  Similarity=0.621  Sum_probs=15.4

Q ss_pred             cCCCCCCcccC-CCCceeeCCCCCCccc
Q psy4407          52 HCKFCSYKLRP-DKTYIFTCFACEYHSA   78 (130)
Q Consensus        52 ~c~~C~~~~~h-~~~~~~~C~~C~~~f~   78 (130)
                      .|+.||..... .....+.|+.||....
T Consensus        30 ~C~~CG~~~~~~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   30 TCPRCGHRNKKRRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             CccCcccccccccccceEEcCCCCCEEC
Confidence            46666654222 3455677777776543


No 126
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=62.16  E-value=8.7  Score=19.22  Aligned_cols=39  Identities=15%  Similarity=0.305  Sum_probs=22.5

Q ss_pred             CceeeCCCCCCcccCchhHHHHHHhhc-CCCCeecccChh
Q psy4407          65 TYIFTCFACEYHSAKRSHIKEHIRQHT-GEKPFSCLLCEY  103 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l~~h~~~h~-~~k~~~C~~C~~  103 (130)
                      ++.+.|..||..|.-...-+..-..-. ...|-.|..|-.
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR~   41 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCRQ   41 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHHH
Confidence            456788888877776655444433211 124566766643


No 127
>PRK00420 hypothetical protein; Validated
Probab=61.76  E-value=8.6  Score=22.87  Aligned_cols=27  Identities=19%  Similarity=0.155  Sum_probs=14.9

Q ss_pred             CCCCCCcccCCCCceeeCCCCCCcccC
Q psy4407          53 CKFCSYKLRPDKTYIFTCFACEYHSAK   79 (130)
Q Consensus        53 c~~C~~~~~h~~~~~~~C~~C~~~f~~   79 (130)
                      |+.||............|+.||....-
T Consensus        26 CP~Cg~pLf~lk~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         26 CPVCGLPLFELKDGEVVCPVHGKVYIV   52 (112)
T ss_pred             CCCCCCcceecCCCceECCCCCCeeee
Confidence            555655433222334678888875553


No 128
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=61.71  E-value=5.9  Score=29.13  Aligned_cols=30  Identities=17%  Similarity=0.424  Sum_probs=20.5

Q ss_pred             cCCCCCCcccCCCCceeeCCCCCCcccCch
Q psy4407          52 HCKFCSYKLRPDKTYIFTCFACEYHSAKRS   81 (130)
Q Consensus        52 ~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~   81 (130)
                      .|+.||......|.+-|.|..||..+....
T Consensus       352 ~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSAGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhcCCCCcccccccccCCccc
Confidence            577777765555555788888887776543


No 129
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=61.13  E-value=6.1  Score=19.54  Aligned_cols=21  Identities=24%  Similarity=0.592  Sum_probs=10.7

Q ss_pred             eeCCCCCCcccCc-----hhHHHHHH
Q psy4407          68 FTCFACEYHSAKR-----SHIKEHIR   88 (130)
Q Consensus        68 ~~C~~C~~~f~~~-----~~l~~h~~   88 (130)
                      -.|..|++.+...     ++|..|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666555332     34555544


No 130
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=61.04  E-value=8.8  Score=22.39  Aligned_cols=24  Identities=21%  Similarity=0.674  Sum_probs=19.7

Q ss_pred             eeC----CCCCCcccCchhHHHHHHhhc
Q psy4407          68 FTC----FACEYHSAKRSHIKEHIRQHT   91 (130)
Q Consensus        68 ~~C----~~C~~~f~~~~~l~~h~~~h~   91 (130)
                      |.|    ..|+....+...+..|.+.+.
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            788    888888888888888887654


No 131
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.98  E-value=2.4  Score=23.21  Aligned_cols=13  Identities=15%  Similarity=0.301  Sum_probs=10.0

Q ss_pred             ceecccccccccC
Q psy4407          32 MLTCKYCYEFLPN   44 (130)
Q Consensus        32 ~~~C~~C~~~~~~   44 (130)
                      .|+|..||..|.-
T Consensus        12 ~Y~c~~cg~~~dv   24 (82)
T COG2331          12 SYECTECGNRFDV   24 (82)
T ss_pred             EEeecccchHHHH
Confidence            4889999988743


No 132
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=60.95  E-value=2.9  Score=22.77  Aligned_cols=19  Identities=11%  Similarity=0.228  Sum_probs=10.2

Q ss_pred             CceeeCC--CCCCcccCchhH
Q psy4407          65 TYIFTCF--ACEYHSAKRSHI   83 (130)
Q Consensus        65 ~~~~~C~--~C~~~f~~~~~l   83 (130)
                      +.-+.|.  +||..|.+...+
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEEE
Confidence            3345565  666666554443


No 133
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=60.88  E-value=5.6  Score=22.65  Aligned_cols=14  Identities=21%  Similarity=0.292  Sum_probs=9.8

Q ss_pred             cceecccccccccC
Q psy4407          31 EMLTCKYCYEFLPN   44 (130)
Q Consensus        31 ~~~~C~~C~~~~~~   44 (130)
                      .|-.|..||..|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45667778877754


No 134
>KOG4167|consensus
Probab=59.64  E-value=2.4  Score=33.18  Aligned_cols=25  Identities=32%  Similarity=0.432  Sum_probs=21.4

Q ss_pred             CeecccChhhhcCcchHHHhhhhcCC
Q psy4407          95 PFSCLLCEYKAAKKSNLTKHMSKKHP  120 (130)
Q Consensus        95 ~~~C~~C~~~f~~~~~l~~h~~~~h~  120 (130)
                      -|.|.+|++.|....+++.|| +.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHM-K~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHM-KTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHH-HHHH
Confidence            489999999999999999999 5553


No 135
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=59.43  E-value=9.1  Score=18.24  Aligned_cols=8  Identities=25%  Similarity=0.837  Sum_probs=3.6

Q ss_pred             eeCCCCCC
Q psy4407          68 FTCFACEY   75 (130)
Q Consensus        68 ~~C~~C~~   75 (130)
                      +.|..||.
T Consensus        20 ~vC~~CG~   27 (43)
T PF08271_consen   20 LVCPNCGL   27 (43)
T ss_dssp             EEETTT-B
T ss_pred             EECCCCCC
Confidence            45555553


No 136
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=59.31  E-value=5.4  Score=16.85  Aligned_cols=6  Identities=33%  Similarity=0.944  Sum_probs=3.1

Q ss_pred             cccccc
Q psy4407          35 CKYCYE   40 (130)
Q Consensus        35 C~~C~~   40 (130)
                      |+.||.
T Consensus         5 Cp~Cg~   10 (26)
T PF13248_consen    5 CPNCGA   10 (26)
T ss_pred             CcccCC
Confidence            555554


No 137
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=59.25  E-value=8.2  Score=24.09  Aligned_cols=13  Identities=23%  Similarity=0.508  Sum_probs=8.9

Q ss_pred             Ccceecccccccc
Q psy4407          30 TEMLTCKYCYEFL   42 (130)
Q Consensus        30 ~~~~~C~~C~~~~   42 (130)
                      ...|.|..||...
T Consensus       110 ~G~l~C~~Cg~~~  122 (146)
T PF07295_consen  110 PGTLVCENCGHEV  122 (146)
T ss_pred             CceEecccCCCEE
Confidence            3457788888654


No 138
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=58.98  E-value=9.2  Score=22.21  Aligned_cols=20  Identities=15%  Similarity=0.276  Sum_probs=13.5

Q ss_pred             cCcceecccccccccCcccc
Q psy4407          29 ETEMLTCKYCYEFLPNDAEI   48 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~~l   48 (130)
                      -++.|.|+.||..-...-.+
T Consensus        19 L~k~FtCp~Cghe~vs~ctv   38 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTV   38 (104)
T ss_pred             CCceEecCccCCeeeeEEEE
Confidence            56779999999765443333


No 139
>KOG3183|consensus
Probab=58.67  E-value=9.2  Score=25.88  Aligned_cols=25  Identities=16%  Similarity=0.385  Sum_probs=18.6

Q ss_pred             cCcceecccccccccCcc-ccccccC
Q psy4407          29 ETEMLTCKYCYEFLPNDA-EIIADHC   53 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~-~l~~h~c   53 (130)
                      .--||.|..|+..|.... ....|.|
T Consensus        20 DFLPf~Cd~C~~~FC~eHrsye~H~C   45 (250)
T KOG3183|consen   20 DFLPFKCDGCSGIFCLEHRSYESHHC   45 (250)
T ss_pred             cccceeeCCccchhhhccchHhhcCC
Confidence            456899999999998774 4566643


No 140
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=58.61  E-value=7.7  Score=18.96  Aligned_cols=24  Identities=25%  Similarity=0.816  Sum_probs=19.4

Q ss_pred             eeeCCCCCCcccCchhHHHHHHhh
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      .|+|-+|.....-+++|-.|++..
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHHH
Confidence            378888988888888888888754


No 141
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=57.56  E-value=7.3  Score=23.27  Aligned_cols=30  Identities=30%  Similarity=0.485  Sum_probs=16.2

Q ss_pred             cCcceecccccccccCccccccccCCCCCCc
Q psy4407          29 ETEMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      ..-.+.|..||..|....... -.|+.||..
T Consensus        68 vp~~~~C~~Cg~~~~~~~~~~-~~CP~Cgs~   97 (117)
T PRK00564         68 EKVELECKDCSHVFKPNALDY-GVCEKCHSK   97 (117)
T ss_pred             cCCEEEhhhCCCccccCCccC-CcCcCCCCC
Confidence            344577888887765432211 126666543


No 142
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.97  E-value=5.4  Score=23.61  Aligned_cols=29  Identities=17%  Similarity=0.237  Sum_probs=15.5

Q ss_pred             cCcceecccccccccCccccccccCCCCCCc
Q psy4407          29 ETEMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      ..-.+.|..||..|......  -.|+.||..
T Consensus        67 ~p~~~~C~~Cg~~~~~~~~~--~~CP~Cgs~   95 (113)
T PF01155_consen   67 VPARARCRDCGHEFEPDEFD--FSCPRCGSP   95 (113)
T ss_dssp             E--EEEETTTS-EEECHHCC--HH-SSSSSS
T ss_pred             cCCcEECCCCCCEEecCCCC--CCCcCCcCC
Confidence            34457788899888654332  247777654


No 143
>KOG2593|consensus
Probab=56.11  E-value=7.2  Score=28.68  Aligned_cols=25  Identities=8%  Similarity=0.071  Sum_probs=18.7

Q ss_pred             hhcccCcceecccccccccCccccc
Q psy4407          25 DFRFETEMLTCKYCYEFLPNDAEII   49 (130)
Q Consensus        25 ~~~~~~~~~~C~~C~~~~~~~~~l~   49 (130)
                      +..+....|.|+.|.+.|.....+.
T Consensus       121 ~d~t~~~~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  121 RDDTNVAGYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             hhccccccccCCccccchhhhHHHH
Confidence            3455567799999999998776654


No 144
>KOG4167|consensus
Probab=55.35  E-value=2.1  Score=33.55  Aligned_cols=28  Identities=29%  Similarity=0.412  Sum_probs=24.6

Q ss_pred             CceeeCCCCCCcccCchhHHHHHHhhcC
Q psy4407          65 TYIFTCFACEYHSAKRSHIKEHIRQHTG   92 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~   92 (130)
                      ...|.|.+|++.|.....+..||++|..
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3459999999999999999999999864


No 145
>PRK10220 hypothetical protein; Provisional
Probab=54.79  E-value=12  Score=22.10  Aligned_cols=12  Identities=17%  Similarity=0.578  Sum_probs=6.6

Q ss_pred             eeeCCCCCCccc
Q psy4407          67 IFTCFACEYHSA   78 (130)
Q Consensus        67 ~~~C~~C~~~f~   78 (130)
                      .|.|++|+.-..
T Consensus        20 ~~vCpeC~hEW~   31 (111)
T PRK10220         20 MYICPECAHEWN   31 (111)
T ss_pred             eEECCcccCcCC
Confidence            466666664443


No 146
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=54.15  E-value=12  Score=24.93  Aligned_cols=28  Identities=14%  Similarity=0.297  Sum_probs=21.7

Q ss_pred             CCCceeeCCCCCCcccCchhHHHHHHhh
Q psy4407          63 DKTYIFTCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        63 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      ..+..|.|..|++.|.......+|+..-
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nK  100 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNK  100 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhc
Confidence            3456699999999999999999998753


No 147
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=54.02  E-value=9.5  Score=22.47  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=5.9

Q ss_pred             eeeCCCCCCcc
Q psy4407          67 IFTCFACEYHS   77 (130)
Q Consensus        67 ~~~C~~C~~~f   77 (130)
                      .|.|++|+...
T Consensus        19 ~~iCpeC~~EW   29 (109)
T TIGR00686        19 QLICPSCLYEW   29 (109)
T ss_pred             eeECccccccc
Confidence            35666665444


No 148
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=53.69  E-value=13  Score=16.12  Aligned_cols=11  Identities=18%  Similarity=1.162  Sum_probs=3.9

Q ss_pred             ceeeCCCCCCc
Q psy4407          66 YIFTCFACEYH   76 (130)
Q Consensus        66 ~~~~C~~C~~~   76 (130)
                      ..|.|.+|+..
T Consensus        14 ~~Y~C~~Cdf~   24 (30)
T PF07649_consen   14 WFYRCSECDFD   24 (30)
T ss_dssp             -EEE-TTT---
T ss_pred             ceEECccCCCc
Confidence            45666666543


No 149
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=53.22  E-value=3.4  Score=19.08  Aligned_cols=13  Identities=15%  Similarity=0.455  Sum_probs=5.9

Q ss_pred             cccccccccCccc
Q psy4407          35 CKYCYEFLPNDAE   47 (130)
Q Consensus        35 C~~C~~~~~~~~~   47 (130)
                      |+.|.+.+....+
T Consensus         2 C~~C~~Ey~~p~~   14 (35)
T PF07503_consen    2 CDDCLKEYFDPSN   14 (35)
T ss_dssp             -HHHHHHHCSTTS
T ss_pred             CHHHHHHHcCCCC
Confidence            4455555544444


No 150
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=53.06  E-value=19  Score=17.40  Aligned_cols=7  Identities=43%  Similarity=1.303  Sum_probs=3.0

Q ss_pred             eeCCCCC
Q psy4407          68 FTCFACE   74 (130)
Q Consensus        68 ~~C~~C~   74 (130)
                      |.|..|+
T Consensus        38 ~~C~~C~   44 (46)
T PF12760_consen   38 YRCKACR   44 (46)
T ss_pred             EECCCCC
Confidence            4444443


No 151
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=51.52  E-value=6.2  Score=23.14  Aligned_cols=28  Identities=14%  Similarity=0.179  Sum_probs=23.3

Q ss_pred             cCCCCceeeCCCCCCcccCchhHHHHHH
Q psy4407          61 RPDKTYIFTCFACEYHSAKRSHIKEHIR   88 (130)
Q Consensus        61 ~h~~~~~~~C~~C~~~f~~~~~l~~h~~   88 (130)
                      .-.|-..+.|.+|.+.|.+...|..|.+
T Consensus        49 ~lPGlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          49 ELPGLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCCCCceeeeehhHHHHHHHHHHHHHhc
Confidence            3355667899999999999999999976


No 152
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=51.14  E-value=12  Score=17.49  Aligned_cols=9  Identities=22%  Similarity=0.910  Sum_probs=5.2

Q ss_pred             eeCCCCCCc
Q psy4407          68 FTCFACEYH   76 (130)
Q Consensus        68 ~~C~~C~~~   76 (130)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            566666543


No 153
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=51.06  E-value=7.5  Score=27.90  Aligned_cols=38  Identities=29%  Similarity=0.497  Sum_probs=27.2

Q ss_pred             eeccccceehhhhhcccCccee----cccccccccCccccccc
Q psy4407          13 LFYSSGLKVSEVDFRFETEMLT----CKYCYEFLPNDAEIIAD   51 (130)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~----C~~C~~~~~~~~~l~~h   51 (130)
                      +|++..|..|. ..-..+..|+    |..|...|.+...|..|
T Consensus       198 lF~~~~Lr~H~-~~G~~e~GFKGHP~C~FC~~~FYdDDEL~~H  239 (493)
T COG5236         198 LFRSSTLRDHK-NGGLEEEGFKGHPLCIFCKIYFYDDDELRRH  239 (493)
T ss_pred             eeecccccccc-cCCccccCcCCCchhhhccceecChHHHHHH
Confidence            46778888884 3333332343    99999999999999888


No 154
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=49.99  E-value=11  Score=22.34  Aligned_cols=28  Identities=21%  Similarity=0.415  Sum_probs=15.3

Q ss_pred             cCcceecccccccccCccccccccCCCCCC
Q psy4407          29 ETEMLTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      ..-...|..||..|.....  .-.|+.||.
T Consensus        67 ~p~~~~C~~Cg~~~~~~~~--~~~CP~Cgs   94 (115)
T TIGR00100        67 EPVECECEDCSEEVSPEID--LYRCPKCHG   94 (115)
T ss_pred             eCcEEEcccCCCEEecCCc--CccCcCCcC
Confidence            3444678888877654322  123666654


No 155
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=49.98  E-value=9  Score=22.16  Aligned_cols=19  Identities=11%  Similarity=0.076  Sum_probs=14.2

Q ss_pred             hhcccCcceecccccccccC
Q psy4407          25 DFRFETEMLTCKYCYEFLPN   44 (130)
Q Consensus        25 ~~~~~~~~~~C~~C~~~~~~   44 (130)
                      ..+.+ ++++|.+||..|.-
T Consensus        73 ~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          73 WLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEeCC-CceeCCCCCcEEEE
Confidence            34455 79999999998853


No 156
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=49.91  E-value=14  Score=22.66  Aligned_cols=23  Identities=35%  Similarity=0.831  Sum_probs=12.4

Q ss_pred             cCCCCCCc-ccCCCCceeeCCCCCCc
Q psy4407          52 HCKFCSYK-LRPDKTYIFTCFACEYH   76 (130)
Q Consensus        52 ~c~~C~~~-~~h~~~~~~~C~~C~~~   76 (130)
                      .|+.||.. +.++|+  ..|+.|+..
T Consensus        30 hCp~Cg~PLF~KdG~--v~CPvC~~~   53 (131)
T COG1645          30 HCPKCGTPLFRKDGE--VFCPVCGYR   53 (131)
T ss_pred             hCcccCCcceeeCCe--EECCCCCce
Confidence            36666655 223333  567777743


No 157
>PLN02294 cytochrome c oxidase subunit Vb
Probab=49.61  E-value=9  Score=24.53  Aligned_cols=15  Identities=13%  Similarity=0.563  Sum_probs=11.5

Q ss_pred             CcceecccccccccC
Q psy4407          30 TEMLTCKYCYEFLPN   44 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~   44 (130)
                      .++++|++||..|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            368889889988853


No 158
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=49.19  E-value=17  Score=16.41  Aligned_cols=10  Identities=20%  Similarity=0.404  Sum_probs=4.9

Q ss_pred             eeCCCCCCcc
Q psy4407          68 FTCFACEYHS   77 (130)
Q Consensus        68 ~~C~~C~~~f   77 (130)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            4455555443


No 159
>KOG2231|consensus
Probab=48.82  E-value=15  Score=28.83  Aligned_cols=48  Identities=21%  Similarity=0.359  Sum_probs=26.3

Q ss_pred             eeCCCCCCcccCchhHHHHHHhhcCCCCeecccC------hhhhcCcchHHHhhhhcC
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLC------EYKAAKKSNLTKHMSKKH  119 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C------~~~f~~~~~l~~h~~~~h  119 (130)
                      -.|..|...|.....+..|++.+.    |-|..|      +..|.....|..|-|.-|
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            356667777777777777766433    233333      223444556666664433


No 160
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.72  E-value=10  Score=22.38  Aligned_cols=16  Identities=0%  Similarity=-0.390  Sum_probs=10.0

Q ss_pred             CCCceeeCCCCCCccc
Q psy4407          63 DKTYIFTCFACEYHSA   78 (130)
Q Consensus        63 ~~~~~~~C~~C~~~f~   78 (130)
                      ....|..|+.||+.|.
T Consensus        22 LNrdPiVsPytG~s~P   37 (129)
T COG4530          22 LNRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCCCccccCcccccch
Confidence            3445567777777763


No 161
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=48.68  E-value=9.7  Score=20.05  Aligned_cols=25  Identities=20%  Similarity=0.404  Sum_probs=9.2

Q ss_pred             ceecccccccccCccccccccCCCCCC
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      .-.|..|++.|.-  ...+|.|..||.
T Consensus         9 ~~~C~~C~~~F~~--~~rrhhCr~CG~   33 (69)
T PF01363_consen    9 ASNCMICGKKFSL--FRRRHHCRNCGR   33 (69)
T ss_dssp             -SB-TTT--B-BS--SS-EEE-TTT--
T ss_pred             CCcCcCcCCcCCC--ceeeEccCCCCC
Confidence            3457788888832  345555666655


No 162
>KOG1280|consensus
Probab=48.37  E-value=28  Score=25.04  Aligned_cols=37  Identities=24%  Similarity=0.501  Sum_probs=25.4

Q ss_pred             ceeeCCCCCCcccCchhHHHHHHh-hcCCC-CeecccCh
Q psy4407          66 YIFTCFACEYHSAKRSHIKEHIRQ-HTGEK-PFSCLLCE  102 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~~~l~~h~~~-h~~~k-~~~C~~C~  102 (130)
                      .-|.|+.|+..-.+...+..|... |.... ...|..|.
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            458999999888889999999763 44322 13455554


No 163
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=48.22  E-value=29  Score=24.58  Aligned_cols=41  Identities=17%  Similarity=0.310  Sum_probs=21.3

Q ss_pred             eecccccccccC--------ccccccccCCCCCCcccCCCCceeeCCCCCCc
Q psy4407          33 LTCKYCYEFLPN--------DAEIIADHCKFCSYKLRPDKTYIFTCFACEYH   76 (130)
Q Consensus        33 ~~C~~C~~~~~~--------~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~   76 (130)
                      -.|+.||..=..        ...++.-.|..|+..   +.-....|+.||..
T Consensus       185 ~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~te---W~~~R~~C~~Cg~~  233 (305)
T TIGR01562       185 TLCPACGSPPVASMVRQGGKETGLRYLSCSLCATE---WHYVRVKCSHCEES  233 (305)
T ss_pred             CcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCc---ccccCccCCCCCCC
Confidence            468888854211        122222357777442   33334577777753


No 164
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=47.77  E-value=13  Score=24.07  Aligned_cols=23  Identities=30%  Similarity=0.761  Sum_probs=16.8

Q ss_pred             eecccccccccCccccccccCCCCCCc
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      +.|.-|++.|.    ...+.|+.||..
T Consensus       140 ~rC~GC~~~f~----~~~~~Cp~CG~~  162 (177)
T COG1439         140 LRCHGCKRIFP----EPKDFCPICGSP  162 (177)
T ss_pred             EEEecCceecC----CCCCcCCCCCCc
Confidence            66888999997    233468888765


No 165
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=47.67  E-value=4  Score=31.97  Aligned_cols=66  Identities=18%  Similarity=0.314  Sum_probs=38.6

Q ss_pred             ecccccccccCccccccc----cCCCCCCc----------ccCCCCce-eeCCCCCCcccCchhHHHHHHhhcCCCCeec
Q psy4407          34 TCKYCYEFLPNDAEIIAD----HCKFCSYK----------LRPDKTYI-FTCFACEYHSAKRSHIKEHIRQHTGEKPFSC   98 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h----~c~~C~~~----------~~h~~~~~-~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C   98 (130)
                      .|+.|-+.+.++.+..-+    .|..||-.          +.++.=+. -.|+.|.+-+....+-+-|      .+|..|
T Consensus       103 ~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~aC  176 (750)
T COG0068         103 TCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIAC  176 (750)
T ss_pred             hhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccccccc------cccccC
Confidence            477777666655554433    57777765          33332222 2577787777666554433      356788


Q ss_pred             ccChhhh
Q psy4407          99 LLCEYKA  105 (130)
Q Consensus        99 ~~C~~~f  105 (130)
                      +.||...
T Consensus       177 p~CGP~~  183 (750)
T COG0068         177 PKCGPHL  183 (750)
T ss_pred             cccCCCe
Confidence            8888743


No 166
>KOG2785|consensus
Probab=47.62  E-value=19  Score=26.20  Aligned_cols=51  Identities=22%  Similarity=0.404  Sum_probs=41.3

Q ss_pred             ceeeCCCCCCcccCchhHHHHHHhhcCC-----------------------CCeecccCh---hhhcCcchHHHhhh
Q psy4407          66 YIFTCFACEYHSAKRSHIKEHIRQHTGE-----------------------KPFSCLLCE---YKAAKKSNLTKHMS  116 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~-----------------------k~~~C~~C~---~~f~~~~~l~~h~~  116 (130)
                      .|-.|..|+..+.+......||..++|-                       +.+.|..|.   +.|.+....+.||.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            3567888999999988888998876652                       346888888   89999999999994


No 167
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=47.43  E-value=19  Score=24.66  Aligned_cols=53  Identities=13%  Similarity=0.221  Sum_probs=29.9

Q ss_pred             cccCcceecccccccccCcccccc--ccCCCCCCc------ccCCCCceeeCCCCCCcccC
Q psy4407          27 RFETEMLTCKYCYEFLPNDAEIIA--DHCKFCSYK------LRPDKTYIFTCFACEYHSAK   79 (130)
Q Consensus        27 ~~~~~~~~C~~C~~~~~~~~~l~~--h~c~~C~~~------~~h~~~~~~~C~~C~~~f~~   79 (130)
                      -..++.|.|..|+..+-..-.-..  ..|..|.+.      ..-.|-.-|.|+.|+..|..
T Consensus       107 p~~drqFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  107 PSVDRQFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cccceeeeccccchHHHhccCcccccccccccccccCCCccccccceeeeecccccccchh
Confidence            344578999999865432211111  156666554      12234445888888887764


No 168
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=47.38  E-value=26  Score=16.51  Aligned_cols=9  Identities=22%  Similarity=0.855  Sum_probs=4.9

Q ss_pred             eeCCCCCCc
Q psy4407          68 FTCFACEYH   76 (130)
Q Consensus        68 ~~C~~C~~~   76 (130)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            555555543


No 169
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=46.84  E-value=21  Score=30.28  Aligned_cols=35  Identities=17%  Similarity=0.433  Sum_probs=23.4

Q ss_pred             eecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcc
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHS   77 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f   77 (130)
                      +.|+.||..-..      ..|+.||...    +.++.|+.||...
T Consensus       668 rkCPkCG~~t~~------~fCP~CGs~t----e~vy~CPsCGaev  702 (1337)
T PRK14714        668 RRCPSCGTETYE------NRCPDCGTHT----EPVYVCPDCGAEV  702 (1337)
T ss_pred             EECCCCCCcccc------ccCcccCCcC----CCceeCccCCCcc
Confidence            789999985321      1688887743    2246888888653


No 170
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=45.85  E-value=13  Score=22.80  Aligned_cols=24  Identities=29%  Similarity=0.677  Sum_probs=15.4

Q ss_pred             eeeCCCCCCcccCchhHHHHHHhhcCC
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIRQHTGE   93 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~~h~~~   93 (130)
                      -..|-+||+.|..   |..|++.|.|-
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eeEEccCCcccch---HHHHHHHccCC
Confidence            3689999998865   58999998664


No 171
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=45.32  E-value=17  Score=22.16  Aligned_cols=16  Identities=13%  Similarity=0.316  Sum_probs=11.0

Q ss_pred             CceeeCCCCCCcccCc
Q psy4407          65 TYIFTCFACEYHSAKR   80 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~   80 (130)
                      ...|.|..|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4557788888777644


No 172
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=44.41  E-value=36  Score=15.92  Aligned_cols=18  Identities=17%  Similarity=0.222  Sum_probs=9.6

Q ss_pred             eeeCCCCCCcccCchhHH
Q psy4407          67 IFTCFACEYHSAKRSHIK   84 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~   84 (130)
                      ...|..|+-.+.....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            355666665555544443


No 173
>PRK05978 hypothetical protein; Provisional
Probab=44.05  E-value=14  Score=23.09  Aligned_cols=27  Identities=26%  Similarity=0.289  Sum_probs=14.5

Q ss_pred             eecccccccccCccccccc-cCCCCCCc
Q psy4407          33 LTCKYCYEFLPNDAEIIAD-HCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h-~c~~C~~~   59 (130)
                      -+|+.||+.---...|+-+ .|+.||..
T Consensus        34 grCP~CG~G~LF~g~Lkv~~~C~~CG~~   61 (148)
T PRK05978         34 GRCPACGEGKLFRAFLKPVDHCAACGED   61 (148)
T ss_pred             CcCCCCCCCcccccccccCCCccccCCc
Confidence            3577887543223344333 46777665


No 174
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=43.97  E-value=18  Score=18.12  Aligned_cols=24  Identities=21%  Similarity=0.440  Sum_probs=12.3

Q ss_pred             ecccccccccCccccccccCCCCCCc
Q psy4407          34 TCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      .|..|++.|..  ....|.|..||..
T Consensus         4 ~C~~C~~~F~~--~~rk~~Cr~Cg~~   27 (57)
T cd00065           4 SCMGCGKPFTL--TRRRHHCRNCGRI   27 (57)
T ss_pred             cCcccCccccC--CccccccCcCcCC
Confidence            35666666653  3334445555443


No 175
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=43.70  E-value=16  Score=19.39  Aligned_cols=9  Identities=22%  Similarity=0.497  Sum_probs=4.9

Q ss_pred             eeccccccc
Q psy4407          33 LTCKYCYEF   41 (130)
Q Consensus        33 ~~C~~C~~~   41 (130)
                      |.|+.||..
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            456666643


No 176
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=43.54  E-value=12  Score=19.68  Aligned_cols=25  Identities=16%  Similarity=0.460  Sum_probs=10.9

Q ss_pred             ecccccccccCccccccccCCCCCC
Q psy4407          34 TCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      .|.-|++.......+..|.|..|+.
T Consensus        32 lCNDC~~~s~v~fH~lg~KC~~C~S   56 (61)
T PF14599_consen   32 LCNDCNAKSEVPFHFLGHKCSHCGS   56 (61)
T ss_dssp             EESSS--EEEEE--TT----TTTS-
T ss_pred             ECCCCCCccceeeeHhhhcCCCCCC
Confidence            3777888766666666667777753


No 177
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=43.23  E-value=20  Score=19.42  Aligned_cols=39  Identities=21%  Similarity=0.484  Sum_probs=18.8

Q ss_pred             cceecccccccccCccccccccCCCCCCc---ccCCCCceeeCCCCC
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHCKFCSYK---LRPDKTYIFTCFACE   74 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c~~C~~~---~~h~~~~~~~C~~C~   74 (130)
                      ..|.|..|++.|....     .|+.|+..   ...-|...|.|..|.
T Consensus        16 ~~~~C~~C~~~~~~~a-----~CPdC~~~Le~LkACGAvdYFC~~c~   57 (70)
T PF07191_consen   16 GHYHCEACQKDYKKEA-----FCPDCGQPLEVLKACGAVDYFCNHCH   57 (70)
T ss_dssp             TEEEETTT--EEEEEE-----E-TTT-SB-EEEEETTEEEEE-TTTT
T ss_pred             CEEECccccccceecc-----cCCCcccHHHHHHHhcccceeeccCC
Confidence            4677888887764322     37777766   112234456666554


No 178
>PRK11823 DNA repair protein RadA; Provisional
Probab=43.13  E-value=19  Score=26.83  Aligned_cols=26  Identities=19%  Similarity=0.336  Sum_probs=19.3

Q ss_pred             CcceecccccccccCccccccccCCCCCCc
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      ...|.|..||........    .|+.|+..
T Consensus         5 ~~~y~C~~Cg~~~~~~~g----~Cp~C~~w   30 (446)
T PRK11823          5 KTAYVCQECGAESPKWLG----RCPECGAW   30 (446)
T ss_pred             CCeEECCcCCCCCcccCe----eCcCCCCc
Confidence            346999999988765443    58888776


No 179
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=43.01  E-value=26  Score=18.83  Aligned_cols=57  Identities=14%  Similarity=0.317  Sum_probs=26.4

Q ss_pred             ceecccccccccCc---cccccccCCCCCCcccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChh
Q psy4407          32 MLTCKYCYEFLPND---AEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEY  103 (130)
Q Consensus        32 ~~~C~~C~~~~~~~---~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~  103 (130)
                      ..+++-|++.|.-.   ..+..|.       ..........|..|+........       ..+ ..+.|+.|+.
T Consensus        10 ~~~~~cC~~~y~C~~CHde~~~H~-------~~~~~~~~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~   69 (71)
T PF05495_consen   10 AIRFPCCGKYYPCRFCHDELEDHP-------FDRWPVKRVICGKCRTEQPIDEY-------SCG-ADYFCPICGL   69 (71)
T ss_dssp             EEEETTTTEEESSHHHHHHCSSS----------TTT--EEEETTT--EEES-SB-------TT---SEEETTTTE
T ss_pred             EEECCcccCeecHHHHHHHhccCc-------cccccccCeECCCCCCccChhhh-------hcC-CCccCcCcCC
Confidence            45566677766533   2334443       33334446778888766554433       111 4567777764


No 180
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=42.31  E-value=17  Score=18.91  Aligned_cols=25  Identities=24%  Similarity=0.717  Sum_probs=15.2

Q ss_pred             CCceeeCCCCCCcccCc---hhHHHHHH
Q psy4407          64 KTYIFTCFACEYHSAKR---SHIKEHIR   88 (130)
Q Consensus        64 ~~~~~~C~~C~~~f~~~---~~l~~h~~   88 (130)
                      ....|.|..||..+-..   .+...|.+
T Consensus         8 ~~~lw~CL~Cg~~~C~~~~~~Ha~~H~~   35 (63)
T PF02148_consen    8 NSNLWLCLTCGYVGCGRYSNGHALKHYK   35 (63)
T ss_dssp             SSSEEEETTTS-EEETTTSTSHHHHHHH
T ss_pred             CCceEEeCCCCcccccCCcCcHHHHhhc
Confidence            35578888888777664   34444543


No 181
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=42.18  E-value=19  Score=19.98  Aligned_cols=27  Identities=26%  Similarity=0.603  Sum_probs=16.1

Q ss_pred             eeccccccc-ccCccccccccCCCCCCc
Q psy4407          33 LTCKYCYEF-LPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~-~~~~~~l~~h~c~~C~~~   59 (130)
                      |.|+-||.. |.....-.-.+|+.|.+.
T Consensus         2 ~~CPCCg~~Tl~~~~~~~ydIC~VC~WE   29 (78)
T PF14206_consen    2 YPCPCCGYYTLEERGEGTYDICPVCFWE   29 (78)
T ss_pred             ccCCCCCcEEeccCCCcCceECCCCCcc
Confidence            578888854 333333224478888776


No 182
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=42.10  E-value=20  Score=22.63  Aligned_cols=19  Identities=11%  Similarity=0.078  Sum_probs=12.6

Q ss_pred             CceeeCCCCCCcccCchhH
Q psy4407          65 TYIFTCFACEYHSAKRSHI   83 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l   83 (130)
                      +.|..|..||+.|......
T Consensus        66 ~~PsYC~~CGkpyPWt~~~   84 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTENA   84 (158)
T ss_pred             CCChhHHhCCCCCchHHHH
Confidence            4667777777777765443


No 183
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=42.09  E-value=23  Score=27.80  Aligned_cols=36  Identities=22%  Similarity=0.523  Sum_probs=20.3

Q ss_pred             ecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCccc
Q psy4407          34 TCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSA   78 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~   78 (130)
                      -|..||..+..      -.|+.||.. ...+.+  .|+.||....
T Consensus        17 FC~~CG~~l~~------~~Cp~CG~~-~~~~~~--fC~~CG~~~~   52 (645)
T PRK14559         17 FCQKCGTSLTH------KPCPQCGTE-VPVDEA--HCPNCGAETG   52 (645)
T ss_pred             cccccCCCCCC------CcCCCCCCC-CCcccc--cccccCCccc
Confidence            36677666532      247777763 333332  6777775543


No 184
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=41.92  E-value=17  Score=27.09  Aligned_cols=25  Identities=20%  Similarity=0.395  Sum_probs=18.2

Q ss_pred             cceecccccccccCccccccccCCCCCCc
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      ..|.|..||........    +|+.|+..
T Consensus         6 ~~y~C~~Cg~~~~~~~g----~Cp~C~~w   30 (454)
T TIGR00416         6 SKFVCQHCGADSPKWQG----KCPACHAW   30 (454)
T ss_pred             CeEECCcCCCCCccccE----ECcCCCCc
Confidence            35999999988755433    58888766


No 185
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=41.71  E-value=30  Score=16.42  Aligned_cols=23  Identities=26%  Similarity=0.349  Sum_probs=12.5

Q ss_pred             eeCCCCCCcccCc--hhHHHHHHhh
Q psy4407          68 FTCFACEYHSAKR--SHIKEHIRQH   90 (130)
Q Consensus        68 ~~C~~C~~~f~~~--~~l~~h~~~h   90 (130)
                      -.|+.||..+...  .....|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            4677777555432  3445555544


No 186
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=41.57  E-value=14  Score=18.70  Aligned_cols=22  Identities=14%  Similarity=0.403  Sum_probs=11.5

Q ss_pred             CcceecccccccccCccccccc
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIAD   51 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h   51 (130)
                      ...|+|+.|+..|...-++-.|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTT
T ss_pred             CCeEECCCCCCccccCcChhhh
Confidence            4679999999999876555444


No 187
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=40.74  E-value=13  Score=22.77  Aligned_cols=10  Identities=20%  Similarity=0.550  Sum_probs=4.7

Q ss_pred             eeCCCCCCcc
Q psy4407          68 FTCFACEYHS   77 (130)
Q Consensus        68 ~~C~~C~~~f   77 (130)
                      +.|..||..|
T Consensus        71 ~~C~~CG~~~   80 (135)
T PRK03824         71 LKCRNCGNEW   80 (135)
T ss_pred             EECCCCCCEE
Confidence            4455554444


No 188
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=40.62  E-value=20  Score=21.65  Aligned_cols=16  Identities=19%  Similarity=0.048  Sum_probs=10.4

Q ss_pred             cCcceecccccccccCc
Q psy4407          29 ETEMLTCKYCYEFLPND   45 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~~   45 (130)
                      -...+.| .||..|...
T Consensus        67 vp~~~~C-~Cg~~~~~~   82 (124)
T PRK00762         67 IPVEIEC-ECGYEGVVD   82 (124)
T ss_pred             cCeeEEe-eCcCccccc
Confidence            3445778 888776543


No 189
>PHA02942 putative transposase; Provisional
Probab=40.61  E-value=32  Score=25.08  Aligned_cols=29  Identities=24%  Similarity=0.557  Sum_probs=16.8

Q ss_pred             ccCCCCCCcccCCCCceeeCCCCCCcccC
Q psy4407          51 DHCKFCSYKLRPDKTYIFTCFACEYHSAK   79 (130)
Q Consensus        51 h~c~~C~~~~~h~~~~~~~C~~C~~~f~~   79 (130)
                      ..|+.||......+.+.|.|..||.....
T Consensus       326 q~Cs~CG~~~~~l~~r~f~C~~CG~~~dr  354 (383)
T PHA02942        326 VSCPKCGHKMVEIAHRYFHCPSCGYENDR  354 (383)
T ss_pred             ccCCCCCCccCcCCCCEEECCCCCCEeCc
Confidence            35777776432223456777777765543


No 190
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=40.57  E-value=17  Score=16.59  Aligned_cols=9  Identities=33%  Similarity=1.058  Sum_probs=4.2

Q ss_pred             eCCCCCCcc
Q psy4407          69 TCFACEYHS   77 (130)
Q Consensus        69 ~C~~C~~~f   77 (130)
                      .|..|+..+
T Consensus        22 ~C~~C~Y~~   30 (35)
T PF02150_consen   22 ACRTCGYEE   30 (35)
T ss_dssp             EESSSS-EE
T ss_pred             CCCCCCCcc
Confidence            455555443


No 191
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=39.84  E-value=21  Score=22.36  Aligned_cols=17  Identities=12%  Similarity=0.313  Sum_probs=11.3

Q ss_pred             eeCCCCCCcccCchhHH
Q psy4407          68 FTCFACEYHSAKRSHIK   84 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~   84 (130)
                      =.|..|++.|.+...+.
T Consensus        29 ReC~~C~~RFTTyErve   45 (147)
T TIGR00244        29 RECLECHERFTTFERAE   45 (147)
T ss_pred             ccCCccCCccceeeecc
Confidence            36778888877665543


No 192
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=39.83  E-value=18  Score=26.26  Aligned_cols=23  Identities=22%  Similarity=0.381  Sum_probs=14.9

Q ss_pred             eecccccccccCccccccccCCCCCCc
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      |.|..||.....+..    +|+.|+..
T Consensus         1 ~~c~~cg~~~~~~~g----~cp~c~~w   23 (372)
T cd01121           1 YVCSECGYVSPKWLG----KCPECGEW   23 (372)
T ss_pred             CCCCCCCCCCCCccE----ECcCCCCc
Confidence            567888877654333    57777665


No 193
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=39.52  E-value=23  Score=17.86  Aligned_cols=9  Identities=22%  Similarity=0.475  Sum_probs=3.9

Q ss_pred             CCeecccCh
Q psy4407          94 KPFSCLLCE  102 (130)
Q Consensus        94 k~~~C~~C~  102 (130)
                      ....|+.||
T Consensus        45 ~i~~Cp~Cg   53 (56)
T PF02591_consen   45 EIVFCPNCG   53 (56)
T ss_pred             CeEECcCCC
Confidence            334444444


No 194
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.48  E-value=8.1  Score=26.07  Aligned_cols=17  Identities=12%  Similarity=0.487  Sum_probs=9.1

Q ss_pred             CcceecccccccccCcc
Q psy4407          30 TEMLTCKYCYEFLPNDA   46 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~   46 (130)
                      ++...|++|+-.|....
T Consensus        17 kk~ieCPvC~tkFkkee   33 (267)
T COG1655          17 KKTIECPVCNTKFKKEE   33 (267)
T ss_pred             hceeccCcccchhhhhh
Confidence            44555666666555433


No 195
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=38.88  E-value=26  Score=17.94  Aligned_cols=9  Identities=22%  Similarity=0.837  Sum_probs=4.7

Q ss_pred             ceeeCCCCC
Q psy4407          66 YIFTCFACE   74 (130)
Q Consensus        66 ~~~~C~~C~   74 (130)
                      -|..|+.|-
T Consensus        27 fPlyCpKCK   35 (55)
T PF14205_consen   27 FPLYCPKCK   35 (55)
T ss_pred             ccccCCCCC
Confidence            345555554


No 196
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=38.70  E-value=29  Score=16.57  Aligned_cols=22  Identities=32%  Similarity=0.629  Sum_probs=9.4

Q ss_pred             CCCCCCcccCCCCceeeCCCCC
Q psy4407          53 CKFCSYKLRPDKTYIFTCFACE   74 (130)
Q Consensus        53 c~~C~~~~~h~~~~~~~C~~C~   74 (130)
                      |+.|+.......+....|..|+
T Consensus        20 Cp~C~~PL~~~k~g~~~Cv~C~   41 (41)
T PF06677_consen   20 CPDCGTPLMRDKDGKIYCVSCG   41 (41)
T ss_pred             cCCCCCeeEEecCCCEECCCCC
Confidence            5555544222222234566553


No 197
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=38.53  E-value=24  Score=18.34  Aligned_cols=29  Identities=14%  Similarity=0.360  Sum_probs=15.3

Q ss_pred             eecccccccccCccccccccCCCCCCcccCCCCceeeCCCCC
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACE   74 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~   74 (130)
                      |.|+ ||..|...  |.          ....|+..-.|+.|.
T Consensus        23 yPCP-CGDRFeIs--Le----------Dl~~GE~VArCPSCS   51 (67)
T COG5216          23 YPCP-CGDRFEIS--LE----------DLRNGEVVARCPSCS   51 (67)
T ss_pred             ecCC-CCCEeEEE--HH----------HhhCCceEEEcCCce
Confidence            5564 77777432  21          223455555666654


No 198
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=38.28  E-value=22  Score=21.12  Aligned_cols=13  Identities=15%  Similarity=0.572  Sum_probs=6.9

Q ss_pred             cceeccccccccc
Q psy4407          31 EMLTCKYCYEFLP   43 (130)
Q Consensus        31 ~~~~C~~C~~~~~   43 (130)
                      ..+.|..||..|.
T Consensus        69 ~~~~C~~Cg~~~~   81 (114)
T PRK03681         69 AECWCETCQQYVT   81 (114)
T ss_pred             cEEEcccCCCeee
Confidence            3355666665543


No 199
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=38.25  E-value=25  Score=15.50  Aligned_cols=10  Identities=20%  Similarity=0.574  Sum_probs=4.1

Q ss_pred             ceeeCCCCCC
Q psy4407          66 YIFTCFACEY   75 (130)
Q Consensus        66 ~~~~C~~C~~   75 (130)
                      ..-.|+.|+.
T Consensus        20 ~~r~C~~Cg~   29 (32)
T PF09297_consen   20 WARRCPSCGH   29 (32)
T ss_dssp             S-EEESSSS-
T ss_pred             CEeECCCCcC
Confidence            3345555553


No 200
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=37.58  E-value=56  Score=18.74  Aligned_cols=29  Identities=21%  Similarity=0.311  Sum_probs=18.4

Q ss_pred             CcceecccccccccCc---cccccccCCCCCCc
Q psy4407          30 TEMLTCKYCYEFLPND---AEIIADHCKFCSYK   59 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~---~~l~~h~c~~C~~~   59 (130)
                      ...|.|..||......   +....| |+.|-..
T Consensus         2 ~~~F~C~~CG~~V~p~~~g~~~RNH-CP~CL~S   33 (92)
T PF12647_consen    2 NESFTCVHCGLTVSPLAAGSAHRNH-CPSCLSS   33 (92)
T ss_pred             CcccCccccCCCcccCCCCCCccCc-Ccccccc
Confidence            3568999999866432   223444 7777665


No 201
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=36.98  E-value=11  Score=24.59  Aligned_cols=30  Identities=17%  Similarity=0.248  Sum_probs=23.2

Q ss_pred             CcceecccccccccCccccccccCCCCCCc
Q psy4407          30 TEMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        30 ~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      .++-+|..||..|.....+...-++.|+..
T Consensus         4 ~k~rKCKvCg~~F~P~~s~q~vCSpeCa~a   33 (189)
T PF05766_consen    4 PKRRKCKVCGEWFVPARSNQKVCSPECAIA   33 (189)
T ss_pred             CCCCcCcccCCccccCCCceeeeCHHHHhH
Confidence            356789999999987777776667888853


No 202
>KOG3507|consensus
Probab=36.60  E-value=27  Score=18.16  Aligned_cols=14  Identities=21%  Similarity=0.551  Sum_probs=8.7

Q ss_pred             CCeecccChhhhcC
Q psy4407          94 KPFSCLLCEYKAAK  107 (130)
Q Consensus        94 k~~~C~~C~~~f~~  107 (130)
                      -.+.|.+||....+
T Consensus        36 D~irCReCG~RIly   49 (62)
T KOG3507|consen   36 DVIRCRECGYRILY   49 (62)
T ss_pred             CcEehhhcchHHHH
Confidence            35677777765543


No 203
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=36.52  E-value=38  Score=19.96  Aligned_cols=23  Identities=17%  Similarity=0.157  Sum_probs=15.9

Q ss_pred             CceeeCCCCCCcccCchhHHHHH
Q psy4407          65 TYIFTCFACEYHSAKRSHIKEHI   87 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l~~h~   87 (130)
                      ..-+.|..||..+.+........
T Consensus        29 ~~~~~C~~CGe~~~~~e~~~~~~   51 (127)
T TIGR03830        29 VPGWYCPACGEELLDPEESKRNS   51 (127)
T ss_pred             eeeeECCCCCCEEEcHHHHHHHH
Confidence            34478999998888776655443


No 204
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=36.48  E-value=6.3  Score=25.92  Aligned_cols=18  Identities=17%  Similarity=0.179  Sum_probs=12.8

Q ss_pred             ccCcceecccccccccCc
Q psy4407          28 FETEMLTCKYCYEFLPND   45 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~   45 (130)
                      .++-||.|..|.+.|.+.
T Consensus       192 ~e~IPF~C~iCKkdy~sp  209 (259)
T COG5152         192 GEKIPFLCGICKKDYESP  209 (259)
T ss_pred             CCCCceeehhchhhccch
Confidence            345678888888887654


No 205
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=36.38  E-value=26  Score=26.09  Aligned_cols=25  Identities=20%  Similarity=0.413  Sum_probs=19.4

Q ss_pred             cceecccccccccCccccccccCCCCCCc
Q psy4407          31 EMLTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        31 ~~~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      ..|.|..||.....+..    +|+.|+..
T Consensus         6 t~f~C~~CG~~s~KW~G----kCp~Cg~W   30 (456)
T COG1066           6 TAFVCQECGYVSPKWLG----KCPACGAW   30 (456)
T ss_pred             cEEEcccCCCCCccccc----cCCCCCCc
Confidence            56999999988765444    69999876


No 206
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=35.26  E-value=18  Score=22.34  Aligned_cols=18  Identities=11%  Similarity=0.213  Sum_probs=13.4

Q ss_pred             hcccCcceecccccccccC
Q psy4407          26 FRFETEMLTCKYCYEFLPN   44 (130)
Q Consensus        26 ~~~~~~~~~C~~C~~~~~~   44 (130)
                      .+.+ ++.+|+.||..|.-
T Consensus       107 l~~g-~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFKL  124 (136)
T ss_dssp             EETT-SEEEETTTEEEEEE
T ss_pred             EeCC-CccCCCCCCeEEEE
Confidence            3444 58899999998863


No 207
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=34.70  E-value=56  Score=15.75  Aligned_cols=15  Identities=13%  Similarity=0.341  Sum_probs=8.9

Q ss_pred             CCceeeCCCCCCccc
Q psy4407          64 KTYIFTCFACEYHSA   78 (130)
Q Consensus        64 ~~~~~~C~~C~~~f~   78 (130)
                      ......|..|+..|.
T Consensus        11 ~~~~i~C~~C~~~~H   25 (51)
T PF00628_consen   11 DGDMIQCDSCNRWYH   25 (51)
T ss_dssp             TSSEEEBSTTSCEEE
T ss_pred             CCCeEEcCCCChhhC
Confidence            344566777776654


No 208
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=34.51  E-value=32  Score=15.90  Aligned_cols=11  Identities=18%  Similarity=0.585  Sum_probs=5.0

Q ss_pred             CCCceeeCCCC
Q psy4407          63 DKTYIFTCFAC   73 (130)
Q Consensus        63 ~~~~~~~C~~C   73 (130)
                      .|...|.|..|
T Consensus        25 ~G~qryrC~~C   35 (36)
T PF03811_consen   25 SGHQRYRCKDC   35 (36)
T ss_pred             CCCEeEecCcC
Confidence            34444555444


No 209
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=34.46  E-value=21  Score=22.10  Aligned_cols=23  Identities=22%  Similarity=0.493  Sum_probs=15.9

Q ss_pred             ecccccccccCccccccccCCCCCCc
Q psy4407          34 TCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        34 ~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      -|+.||+.|...   ..-.|+.|...
T Consensus         5 nC~~CgklF~~~---~~~iCp~C~~~   27 (137)
T TIGR03826         5 NCPKCGRLFVKT---GRDVCPSCYEE   27 (137)
T ss_pred             cccccchhhhhc---CCccCHHHhHH
Confidence            488899988762   22358888765


No 210
>PRK11032 hypothetical protein; Provisional
Probab=33.94  E-value=35  Score=21.70  Aligned_cols=12  Identities=33%  Similarity=0.700  Sum_probs=6.5

Q ss_pred             cceecccccccc
Q psy4407          31 EMLTCKYCYEFL   42 (130)
Q Consensus        31 ~~~~C~~C~~~~   42 (130)
                      ....|..||...
T Consensus       123 G~LvC~~Cg~~~  134 (160)
T PRK11032        123 GNLVCEKCHHHL  134 (160)
T ss_pred             ceEEecCCCCEE
Confidence            335566666543


No 211
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=33.69  E-value=11  Score=27.04  Aligned_cols=9  Identities=44%  Similarity=0.807  Sum_probs=3.6

Q ss_pred             eeccccccc
Q psy4407          33 LTCKYCYEF   41 (130)
Q Consensus        33 ~~C~~C~~~   41 (130)
                      +.|..|...
T Consensus       253 v~C~~C~yt  261 (344)
T PF09332_consen  253 VTCKQCKYT  261 (344)
T ss_dssp             EEETTT--E
T ss_pred             EEcCCCCCc
Confidence            445555543


No 212
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=33.38  E-value=46  Score=19.11  Aligned_cols=10  Identities=30%  Similarity=0.607  Sum_probs=7.2

Q ss_pred             CeecccChhh
Q psy4407          95 PFSCLLCEYK  104 (130)
Q Consensus        95 ~~~C~~C~~~  104 (130)
                      ...|..||..
T Consensus        62 ~~~Cp~Cg~~   71 (104)
T TIGR01384        62 RVECPKCGHK   71 (104)
T ss_pred             cCCCCCCCCC
Confidence            3688888864


No 213
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=33.19  E-value=25  Score=16.74  Aligned_cols=12  Identities=25%  Similarity=0.597  Sum_probs=8.3

Q ss_pred             cceecccccccc
Q psy4407          31 EMLTCKYCYEFL   42 (130)
Q Consensus        31 ~~~~C~~C~~~~   42 (130)
                      ++-.|+.||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            456788887765


No 214
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=31.96  E-value=12  Score=22.23  Aligned_cols=14  Identities=14%  Similarity=0.150  Sum_probs=7.8

Q ss_pred             cceecccccccccC
Q psy4407          31 EMLTCKYCYEFLPN   44 (130)
Q Consensus        31 ~~~~C~~C~~~~~~   44 (130)
                      ....|..|+..|..
T Consensus        53 ~~~~C~~C~~~fg~   66 (118)
T PF02318_consen   53 GERHCARCGKPFGF   66 (118)
T ss_dssp             CCSB-TTTS-BCSC
T ss_pred             CCcchhhhCCcccc
Confidence            34568888887653


No 215
>KOG2906|consensus
Probab=31.61  E-value=43  Score=19.44  Aligned_cols=15  Identities=27%  Similarity=0.569  Sum_probs=10.2

Q ss_pred             ceeeCCCCCCcccCc
Q psy4407          66 YIFTCFACEYHSAKR   80 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~   80 (130)
                      ..+.|..|+..|.-+
T Consensus        20 ~rf~C~tCpY~~~I~   34 (105)
T KOG2906|consen   20 NRFSCRTCPYVFPIS   34 (105)
T ss_pred             eeEEcCCCCceeeEe
Confidence            457788888776644


No 216
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=31.29  E-value=34  Score=17.62  Aligned_cols=9  Identities=33%  Similarity=0.685  Sum_probs=5.3

Q ss_pred             eeccccccc
Q psy4407          33 LTCKYCYEF   41 (130)
Q Consensus        33 ~~C~~C~~~   41 (130)
                      ..|+.||..
T Consensus        28 ~~C~~CG~~   36 (57)
T PRK12286         28 VECPNCGEP   36 (57)
T ss_pred             eECCCCCCc
Confidence            446666654


No 217
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=30.94  E-value=23  Score=19.65  Aligned_cols=42  Identities=14%  Similarity=0.334  Sum_probs=14.5

Q ss_pred             ccCcceecccccccccCccccccccCCCCCCcccCCCCceeeCCCCCCcccCc
Q psy4407          28 FETEMLTCKYCYEFLPNDAEIIADHCKFCSYKLRPDKTYIFTCFACEYHSAKR   80 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~~~h~~~~~~~C~~C~~~f~~~   80 (130)
                      .-++.|.|+.|+-.-.-.-.+           ....+.....|..|+..|...
T Consensus        18 ~l~~~F~CPfC~~~~sV~v~i-----------dkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   18 KLPKVFDCPFCNHEKSVSVKI-----------DKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             --SS----TTT--SS-EEEEE-----------ETTTTEEEEEESSS--EEEEE
T ss_pred             CCCceEcCCcCCCCCeEEEEE-----------EccCCEEEEEecCCCCeEEEc
Confidence            344668888887321111111           112333446777777666543


No 218
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=30.91  E-value=30  Score=16.98  Aligned_cols=13  Identities=23%  Similarity=0.679  Sum_probs=7.6

Q ss_pred             Ccceecccccccc
Q psy4407          30 TEMLTCKYCYEFL   42 (130)
Q Consensus        30 ~~~~~C~~C~~~~   42 (130)
                      ..+-.|..|++..
T Consensus         9 ~~~~~C~~C~~~i   21 (53)
T PF00130_consen    9 SKPTYCDVCGKFI   21 (53)
T ss_dssp             SSTEB-TTSSSBE
T ss_pred             CCCCCCcccCccc
Confidence            4555677777665


No 219
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=30.89  E-value=1.5e+02  Score=18.98  Aligned_cols=57  Identities=26%  Similarity=0.402  Sum_probs=34.6

Q ss_pred             eeeCCCCCCcccCchhHHHHHHhhcCCCCeeccc--Chhhhc-CcchHHHhhhhcCCCCCCCCcc
Q psy4407          67 IFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLL--CEYKAA-KKSNLTKHMSKKHPSSYEDPFF  128 (130)
Q Consensus        67 ~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~--C~~~f~-~~~~l~~h~~~~h~g~~e~~~~  128 (130)
                      ...|+.|--......... --+.+-..|+-.|..  |.  |. .-..|++|.|..|..  -+|-+
T Consensus        80 ~L~CPLCRG~V~GWtvve-~AR~~LN~K~RsC~~e~C~--F~GtY~eLrKHar~~HP~--~rP~~  139 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVVE-PARRFLNAKKRSCSQESCS--FSGTYSELRKHARSEHPS--ARPSE  139 (162)
T ss_pred             cccCccccCceeceEEch-HHHHHhccCCccCcccccc--cccCHHHHHHHHHhhCCC--CCCcc
Confidence            456777754433333332 244555567777754  54  44 455788999888888  77744


No 220
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=30.62  E-value=39  Score=15.83  Aligned_cols=12  Identities=17%  Similarity=0.362  Sum_probs=5.6

Q ss_pred             CCceeeCCCCCC
Q psy4407          64 KTYIFTCFACEY   75 (130)
Q Consensus        64 ~~~~~~C~~C~~   75 (130)
                      +.+.|.|..|+.
T Consensus        21 ~~~~w~C~~C~~   32 (40)
T PF04810_consen   21 GGKTWICNFCGT   32 (40)
T ss_dssp             TTTEEEETTT--
T ss_pred             CCCEEECcCCCC
Confidence            344566666654


No 221
>PF14149 YhfH:  YhfH-like protein
Probab=30.47  E-value=8  Score=18.11  Aligned_cols=11  Identities=18%  Similarity=0.516  Sum_probs=7.2

Q ss_pred             ecccccccccC
Q psy4407          34 TCKYCYEFLPN   44 (130)
Q Consensus        34 ~C~~C~~~~~~   44 (130)
                      .|..||+....
T Consensus        15 ~C~~CG~~i~E   25 (37)
T PF14149_consen   15 KCTECGKEIEE   25 (37)
T ss_pred             ccHHHHHHHHH
Confidence            47778876543


No 222
>PF14369 zf-RING_3:  zinc-finger
Probab=30.46  E-value=48  Score=15.13  Aligned_cols=10  Identities=20%  Similarity=0.384  Sum_probs=6.1

Q ss_pred             eCCCCCCccc
Q psy4407          69 TCFACEYHSA   78 (130)
Q Consensus        69 ~C~~C~~~f~   78 (130)
                      .|+.|+.+|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4666666653


No 223
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=30.40  E-value=68  Score=18.63  Aligned_cols=11  Identities=18%  Similarity=0.712  Sum_probs=7.6

Q ss_pred             Ccceecccccc
Q psy4407          30 TEMLTCKYCYE   40 (130)
Q Consensus        30 ~~~~~C~~C~~   40 (130)
                      ...|.|+.|+.
T Consensus        19 pt~f~CP~Cge   29 (99)
T PRK14892         19 PKIFECPRCGK   29 (99)
T ss_pred             CcEeECCCCCC
Confidence            34577888883


No 224
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=30.15  E-value=31  Score=21.73  Aligned_cols=14  Identities=14%  Similarity=0.418  Sum_probs=8.7

Q ss_pred             eCCCCCCcccCchh
Q psy4407          69 TCFACEYHSAKRSH   82 (130)
Q Consensus        69 ~C~~C~~~f~~~~~   82 (130)
                      .|..|+..|.+...
T Consensus        30 eC~~C~~RFTTfE~   43 (156)
T COG1327          30 ECLECGERFTTFER   43 (156)
T ss_pred             cccccccccchhhe
Confidence            56777766665543


No 225
>PF12907 zf-met2:  Zinc-binding
Probab=29.89  E-value=29  Score=16.54  Aligned_cols=9  Identities=22%  Similarity=0.681  Sum_probs=3.7

Q ss_pred             ecccChhhh
Q psy4407          97 SCLLCEYKA  105 (130)
Q Consensus        97 ~C~~C~~~f  105 (130)
                      .|.+|...|
T Consensus         3 ~C~iC~qtF   11 (40)
T PF12907_consen    3 ICKICRQTF   11 (40)
T ss_pred             CcHHhhHHH
Confidence            344444333


No 226
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=29.73  E-value=46  Score=21.02  Aligned_cols=34  Identities=29%  Similarity=0.649  Sum_probs=17.5

Q ss_pred             CceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChh
Q psy4407          65 TYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEY  103 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~  103 (130)
                      ..+|.|. |+..+.+.   +.|-..-.|+ .|.|..|+.
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-eEEeccCCc
Confidence            3456666 66655443   3333333444 566666654


No 227
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=29.47  E-value=95  Score=19.63  Aligned_cols=12  Identities=17%  Similarity=0.645  Sum_probs=3.1

Q ss_pred             CCCeecccChhh
Q psy4407          93 EKPFSCLLCEYK  104 (130)
Q Consensus        93 ~k~~~C~~C~~~  104 (130)
                      +-...|-.||-.
T Consensus        58 dt~leCy~Cg~~   69 (152)
T PF09416_consen   58 DTVLECYNCGSR   69 (152)
T ss_dssp             S-B---TTT---
T ss_pred             CcEEEEEecCCC
Confidence            344677777653


No 228
>PHA02998 RNA polymerase subunit; Provisional
Probab=29.26  E-value=62  Score=21.07  Aligned_cols=12  Identities=17%  Similarity=0.395  Sum_probs=8.0

Q ss_pred             eecccChhhhcC
Q psy4407          96 FSCLLCEYKAAK  107 (130)
Q Consensus        96 ~~C~~C~~~f~~  107 (130)
                      |.|..|+..|..
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            677777776643


No 229
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=29.01  E-value=83  Score=18.42  Aligned_cols=9  Identities=33%  Similarity=0.932  Sum_probs=5.1

Q ss_pred             ceecccccc
Q psy4407          32 MLTCKYCYE   40 (130)
Q Consensus        32 ~~~C~~C~~   40 (130)
                      |-.|+.||.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            445666664


No 230
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=28.67  E-value=64  Score=17.14  Aligned_cols=10  Identities=30%  Similarity=0.604  Sum_probs=6.2

Q ss_pred             eeeCCCCCCc
Q psy4407          67 IFTCFACEYH   76 (130)
Q Consensus        67 ~~~C~~C~~~   76 (130)
                      .+.|..|+..
T Consensus        27 ~v~C~~CgA~   36 (64)
T PRK09710         27 RAKCNGCESR   36 (64)
T ss_pred             EEEcCCCCcC
Confidence            3567777653


No 231
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=28.28  E-value=51  Score=19.47  Aligned_cols=13  Identities=15%  Similarity=0.243  Sum_probs=7.2

Q ss_pred             cCcceeccccccc
Q psy4407          29 ETEMLTCKYCYEF   41 (130)
Q Consensus        29 ~~~~~~C~~C~~~   41 (130)
                      |-..+.|+.||..
T Consensus        39 G~~~~~C~~Cg~~   51 (111)
T PF14319_consen   39 GFHRYRCEDCGHE   51 (111)
T ss_pred             CcceeecCCCCce
Confidence            4445666666654


No 232
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=28.04  E-value=76  Score=14.77  Aligned_cols=9  Identities=22%  Similarity=0.604  Sum_probs=4.9

Q ss_pred             ceeeCCCCC
Q psy4407          66 YIFTCFACE   74 (130)
Q Consensus        66 ~~~~C~~C~   74 (130)
                      ..+.|..|+
T Consensus        24 G~~~C~~Cg   32 (37)
T smart00778       24 GTWFCSVCG   32 (37)
T ss_pred             cCEEeCCCC
Confidence            345666554


No 233
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=27.94  E-value=30  Score=23.40  Aligned_cols=16  Identities=19%  Similarity=0.353  Sum_probs=12.7

Q ss_pred             cCcceecccccccccC
Q psy4407          29 ETEMLTCKYCYEFLPN   44 (130)
Q Consensus        29 ~~~~~~C~~C~~~~~~   44 (130)
                      +.++.+|++||..|.-
T Consensus       178 EGkpqRCpECGqVFKL  193 (268)
T PTZ00043        178 EGFLYRCGECDQIFML  193 (268)
T ss_pred             CCCCccCCCCCcEEEE
Confidence            4458899999999864


No 234
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=27.48  E-value=64  Score=16.15  Aligned_cols=34  Identities=18%  Similarity=0.494  Sum_probs=15.1

Q ss_pred             eeeCCC-CCCcccCchhHHHHHHhhcCCCCeeccc
Q psy4407          67 IFTCFA-CEYHSAKRSHIKEHIRQHTGEKPFSCLL  100 (130)
Q Consensus        67 ~~~C~~-C~~~f~~~~~l~~h~~~h~~~k~~~C~~  100 (130)
                      +..|+. |+..-.....|..|+...=..++..|..
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCcEECCC
Confidence            345555 3322223456666766433345556665


No 235
>KOG0782|consensus
Probab=26.87  E-value=15  Score=28.43  Aligned_cols=31  Identities=13%  Similarity=0.076  Sum_probs=20.6

Q ss_pred             ccceehhhhhcccCcceecccccccccCcccc
Q psy4407          17 SGLKVSEVDFRFETEMLTCKYCYEFLPNDAEI   48 (130)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l   48 (130)
                      +++..|| =.|.....-+|..||+.|..+..+
T Consensus       239 ~~fvrHH-WVHrrRqeGkC~~CgKgFQQKf~F  269 (1004)
T KOG0782|consen  239 SGFVRHH-WVHRRRQEGKCNTCGKGFQQKFFF  269 (1004)
T ss_pred             ccchHHh-HhhHhhhccccchhhhhhhhheee
Confidence            3566665 355555666788999888766543


No 236
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=26.72  E-value=53  Score=20.23  Aligned_cols=11  Identities=18%  Similarity=0.733  Sum_probs=5.4

Q ss_pred             eeeCCCCCCcc
Q psy4407          67 IFTCFACEYHS   77 (130)
Q Consensus        67 ~~~C~~C~~~f   77 (130)
                      .|.|..|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            34555555444


No 237
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=26.61  E-value=55  Score=24.69  Aligned_cols=18  Identities=11%  Similarity=0.137  Sum_probs=13.1

Q ss_pred             ccCcceecccccccccCc
Q psy4407          28 FETEMLTCKYCYEFLPND   45 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~   45 (130)
                      .....|+|..||..|...
T Consensus       421 ~~~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        421 DLGPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCCCeEEECCCCeEECCC
Confidence            355678899999887643


No 238
>KOG0978|consensus
Probab=26.41  E-value=6.7  Score=30.78  Aligned_cols=17  Identities=12%  Similarity=0.260  Sum_probs=9.9

Q ss_pred             CCeecccChhhhcCcch
Q psy4407          94 KPFSCLLCEYKAAKKSN  110 (130)
Q Consensus        94 k~~~C~~C~~~f~~~~~  110 (130)
                      +.-+|+.|+.+|.....
T Consensus       677 RqRKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDV  693 (698)
T ss_pred             hcCCCCCCCCCCCcccc
Confidence            34466777776665443


No 239
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=26.32  E-value=70  Score=13.79  Aligned_cols=8  Identities=25%  Similarity=0.957  Sum_probs=4.8

Q ss_pred             eeeCCCCC
Q psy4407          67 IFTCFACE   74 (130)
Q Consensus        67 ~~~C~~C~   74 (130)
                      .|.|..|+
T Consensus        15 ~Y~C~~c~   22 (30)
T PF03107_consen   15 FYHCSECC   22 (30)
T ss_pred             eEEeCCCC
Confidence            56666655


No 240
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=26.31  E-value=45  Score=19.99  Aligned_cols=25  Identities=16%  Similarity=0.226  Sum_probs=13.1

Q ss_pred             ceecccccccccCccccccccCCCCCC
Q psy4407          32 MLTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        32 ~~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      ..+|..|+..+.......  .|+.||.
T Consensus        70 ~~~C~~C~~~~~~e~~~~--~CP~C~s   94 (115)
T COG0375          70 ECWCLDCGQEVELEELDY--RCPKCGS   94 (115)
T ss_pred             EEEeccCCCeecchhhee--ECCCCCC
Confidence            366777866664432222  2555553


No 241
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=26.29  E-value=33  Score=17.31  Aligned_cols=13  Identities=23%  Similarity=0.698  Sum_probs=8.9

Q ss_pred             ceecccccccccC
Q psy4407          32 MLTCKYCYEFLPN   44 (130)
Q Consensus        32 ~~~C~~C~~~~~~   44 (130)
                      .++|..|++....
T Consensus         4 eiRC~~CnklLa~   16 (51)
T PF10122_consen    4 EIRCGHCNKLLAK   16 (51)
T ss_pred             ceeccchhHHHhh
Confidence            4678888877654


No 242
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=25.99  E-value=63  Score=17.29  Aligned_cols=10  Identities=30%  Similarity=0.723  Sum_probs=5.9

Q ss_pred             eeCCCCCCcc
Q psy4407          68 FTCFACEYHS   77 (130)
Q Consensus        68 ~~C~~C~~~f   77 (130)
                      ..|..||...
T Consensus        39 V~C~~CG~~l   48 (67)
T COG2051          39 VTCLICGTTL   48 (67)
T ss_pred             EEecccccEE
Confidence            4666666544


No 243
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=25.76  E-value=43  Score=17.07  Aligned_cols=9  Identities=44%  Similarity=1.087  Sum_probs=5.6

Q ss_pred             eeccccccc
Q psy4407          33 LTCKYCYEF   41 (130)
Q Consensus        33 ~~C~~C~~~   41 (130)
                      ..|+.||+.
T Consensus        27 ~~C~~cG~~   35 (55)
T TIGR01031        27 VVCPNCGEF   35 (55)
T ss_pred             eECCCCCCc
Confidence            447777764


No 244
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=25.64  E-value=37  Score=23.96  Aligned_cols=35  Identities=23%  Similarity=0.334  Sum_probs=19.0

Q ss_pred             cCCCCCCc--ccCCCCceeeCCCCCCcccCchhHHHH
Q psy4407          52 HCKFCSYK--LRPDKTYIFTCFACEYHSAKRSHIKEH   86 (130)
Q Consensus        52 ~c~~C~~~--~~h~~~~~~~C~~C~~~f~~~~~l~~h   86 (130)
                      .|+.|+..  .....+..+.|+.|+..|.....-+..
T Consensus        40 kc~~C~~~~~~~~l~~~~~vcp~c~~h~rltAreRI~   76 (296)
T CHL00174         40 QCENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIE   76 (296)
T ss_pred             ECCCccchhhHHHHHHcCCCCCCCCCCcCCCHHHHHH
Confidence            46666554  111223446788888877665443333


No 245
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=25.46  E-value=44  Score=14.31  Aligned_cols=9  Identities=22%  Similarity=0.729  Sum_probs=3.6

Q ss_pred             CceeeCCCC
Q psy4407          65 TYIFTCFAC   73 (130)
Q Consensus        65 ~~~~~C~~C   73 (130)
                      ..++.|+.|
T Consensus        19 r~~~~C~rC   27 (30)
T PF06827_consen   19 RSTYLCPRC   27 (30)
T ss_dssp             EEEEE-TTT
T ss_pred             CCCeECcCC
Confidence            334555544


No 247
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=25.27  E-value=51  Score=20.33  Aligned_cols=23  Identities=22%  Similarity=0.436  Sum_probs=15.5

Q ss_pred             eecccccccccCccccccccCCCCCCc
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSYK   59 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~~   59 (130)
                      -+|..||..|.-...    .|+.|+..
T Consensus        30 ~kC~~CG~v~~PPr~----~Cp~C~~~   52 (140)
T COG1545          30 TKCKKCGRVYFPPRA----YCPKCGSE   52 (140)
T ss_pred             EEcCCCCeEEcCCcc----cCCCCCCC
Confidence            458888887765544    47777664


No 248
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=24.89  E-value=35  Score=15.83  Aligned_cols=12  Identities=25%  Similarity=0.750  Sum_probs=6.2

Q ss_pred             cceecccccccc
Q psy4407          31 EMLTCKYCYEFL   42 (130)
Q Consensus        31 ~~~~C~~C~~~~   42 (130)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            457888888664


No 249
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=24.71  E-value=62  Score=16.62  Aligned_cols=13  Identities=23%  Similarity=0.526  Sum_probs=7.9

Q ss_pred             CceeeCCCCCCcc
Q psy4407          65 TYIFTCFACEYHS   77 (130)
Q Consensus        65 ~~~~~C~~C~~~f   77 (130)
                      ...|.|+.||..+
T Consensus        12 ~v~~~Cp~cGipt   24 (55)
T PF13824_consen   12 HVNFECPDCGIPT   24 (55)
T ss_pred             ccCCcCCCCCCcC
Confidence            4456777777544


No 251
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=24.64  E-value=38  Score=23.78  Aligned_cols=23  Identities=13%  Similarity=0.192  Sum_probs=12.9

Q ss_pred             eeCCCCCCcccCchhHHHHHHhh
Q psy4407          68 FTCFACEYHSAKRSHIKEHIRQH   90 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~l~~h~~~h   90 (130)
                      +.|+.|+..|.....-+...-.+
T Consensus        47 ~vc~~c~~h~rl~areRi~~L~D   69 (292)
T PRK05654         47 NVCPKCGHHMRISARERLDLLLD   69 (292)
T ss_pred             CCCCCCCCCeeCCHHHHHHHHcc
Confidence            56777777776554433333333


No 252
>KOG2071|consensus
Probab=24.35  E-value=56  Score=25.30  Aligned_cols=27  Identities=15%  Similarity=0.273  Sum_probs=21.2

Q ss_pred             CceeeCCCCCCcccCchhHHHHHHhhc
Q psy4407          65 TYIFTCFACEYHSAKRSHIKEHIRQHT   91 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~~~l~~h~~~h~   91 (130)
                      ..+..|..||..|........|+..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456889999999998888777776663


No 253
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=24.14  E-value=38  Score=15.87  Aligned_cols=14  Identities=29%  Similarity=0.456  Sum_probs=10.3

Q ss_pred             cceecccccccccC
Q psy4407          31 EMLTCKYCYEFLPN   44 (130)
Q Consensus        31 ~~~~C~~C~~~~~~   44 (130)
                      ..+.|+.||+.+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            44679999987754


No 254
>PF15199 DAOA:  D-amino acid oxidase activator
Probab=24.04  E-value=25  Score=18.59  Aligned_cols=7  Identities=43%  Similarity=0.923  Sum_probs=5.7

Q ss_pred             CCCCcce
Q psy4407           2 SSVPRSY    8 (130)
Q Consensus         2 ~~~~~~~    8 (130)
                      |.+||||
T Consensus        15 sylpqpy   21 (82)
T PF15199_consen   15 SYLPQPY   21 (82)
T ss_pred             hhCCchH
Confidence            6788888


No 255
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=24.03  E-value=55  Score=16.94  Aligned_cols=21  Identities=29%  Similarity=0.705  Sum_probs=11.8

Q ss_pred             eecccccccccCccccccccCCCCCC
Q psy4407          33 LTCKYCYEFLPNDAEIIADHCKFCSY   58 (130)
Q Consensus        33 ~~C~~C~~~~~~~~~l~~h~c~~C~~   58 (130)
                      -.|+.||+.-     |..+.|..||.
T Consensus        28 ~~c~~cG~~~-----l~Hrvc~~cg~   48 (57)
T COG0333          28 SVCPNCGEYK-----LPHRVCLKCGY   48 (57)
T ss_pred             eeccCCCCcc-----cCceEcCCCCC
Confidence            4577777652     33345666654


No 256
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=24.02  E-value=74  Score=15.98  Aligned_cols=7  Identities=29%  Similarity=0.989  Sum_probs=3.1

Q ss_pred             eeCCCCC
Q psy4407          68 FTCFACE   74 (130)
Q Consensus        68 ~~C~~C~   74 (130)
                      +.|..||
T Consensus        38 ~~CGkCg   44 (51)
T COG1998          38 WACGKCG   44 (51)
T ss_pred             eEecccc
Confidence            4444444


No 257
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=24.01  E-value=58  Score=16.83  Aligned_cols=11  Identities=18%  Similarity=0.582  Sum_probs=5.9

Q ss_pred             cccccccccCc
Q psy4407          35 CKYCYEFLPND   45 (130)
Q Consensus        35 C~~C~~~~~~~   45 (130)
                      |..||+.....
T Consensus        21 Cl~CGkIiC~~   31 (57)
T PF06221_consen   21 CLNCGKIICEQ   31 (57)
T ss_pred             ccccChhhccc
Confidence            55566555443


No 258
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=23.72  E-value=67  Score=21.63  Aligned_cols=12  Identities=17%  Similarity=0.254  Sum_probs=7.2

Q ss_pred             eeCCCCCCcccC
Q psy4407          68 FTCFACEYHSAK   79 (130)
Q Consensus        68 ~~C~~C~~~f~~   79 (130)
                      ..|+.||+.+..
T Consensus        36 ~~C~~Cg~~~~~   47 (236)
T PF04981_consen   36 TICPKCGRYRIG   47 (236)
T ss_pred             eECCCCCCEECC
Confidence            466777665543


No 259
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=23.71  E-value=35  Score=23.87  Aligned_cols=15  Identities=20%  Similarity=0.432  Sum_probs=8.5

Q ss_pred             eeCCCCCCcccCchh
Q psy4407          68 FTCFACEYHSAKRSH   82 (130)
Q Consensus        68 ~~C~~C~~~f~~~~~   82 (130)
                      +.|+.|+..|.....
T Consensus        46 ~vc~~c~~h~rl~ar   60 (285)
T TIGR00515        46 EVCPKCDHHMRMDAR   60 (285)
T ss_pred             CCCCCCCCcCcCCHH
Confidence            456666666554433


No 260
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=23.59  E-value=36  Score=17.00  Aligned_cols=11  Identities=18%  Similarity=0.383  Sum_probs=5.1

Q ss_pred             eCCCCCCcccC
Q psy4407          69 TCFACEYHSAK   79 (130)
Q Consensus        69 ~C~~C~~~f~~   79 (130)
                      .|+.|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            78888877754


No 261
>KOG1994|consensus
Probab=23.53  E-value=29  Score=23.44  Aligned_cols=26  Identities=12%  Similarity=0.340  Sum_probs=21.3

Q ss_pred             hcccCcceecccccccccCccccccc
Q psy4407          26 FRFETEMLTCKYCYEFLPNDAEIIAD   51 (130)
Q Consensus        26 ~~~~~~~~~C~~C~~~~~~~~~l~~h   51 (130)
                      ......-|-|-+||..|.+...|..|
T Consensus       233 ~~LR~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  233 IFLRSEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             HHHhccceEEEEeccccCCHHHHHHh
Confidence            34456668899999999999999887


No 262
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=23.24  E-value=65  Score=24.35  Aligned_cols=32  Identities=13%  Similarity=0.298  Sum_probs=26.0

Q ss_pred             cCCCCceeeCCCCCCcccCchhHHHHHH-hhcC
Q psy4407          61 RPDKTYIFTCFACEYHSAKRSHIKEHIR-QHTG   92 (130)
Q Consensus        61 ~h~~~~~~~C~~C~~~f~~~~~l~~h~~-~h~~   92 (130)
                      .+...+-+.|+.|.+.|.....+..|+. .|.+
T Consensus        51 ~n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   51 ENKSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             hcCceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3445567899999999999999999987 4654


No 263
>KOG2807|consensus
Probab=23.05  E-value=85  Score=22.61  Aligned_cols=25  Identities=16%  Similarity=0.315  Sum_probs=15.8

Q ss_pred             CCeecccChhhhcCcchHHHhhhhcC
Q psy4407          94 KPFSCLLCEYKAAKKSNLTKHMSKKH  119 (130)
Q Consensus        94 k~~~C~~C~~~f~~~~~l~~h~~~~h  119 (130)
                      ..|.|..|...|-...+.-.|. ..|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHe-sLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHE-SLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHh-hhh
Confidence            4577777777776655555555 444


No 264
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=22.55  E-value=73  Score=16.20  Aligned_cols=9  Identities=33%  Similarity=0.693  Sum_probs=5.4

Q ss_pred             eeccccccc
Q psy4407          33 LTCKYCYEF   41 (130)
Q Consensus        33 ~~C~~C~~~   41 (130)
                      -.|+.||..
T Consensus        27 ~~c~~cg~~   35 (56)
T PF01783_consen   27 VKCPNCGEP   35 (56)
T ss_dssp             EESSSSSSE
T ss_pred             eeeccCCCE
Confidence            456777744


No 265
>KOG4602|consensus
Probab=22.29  E-value=1.2e+02  Score=21.09  Aligned_cols=7  Identities=29%  Similarity=0.933  Sum_probs=3.2

Q ss_pred             cCCCCCC
Q psy4407          52 HCKFCSY   58 (130)
Q Consensus        52 ~c~~C~~   58 (130)
                      .|++||.
T Consensus       270 VCPiCGA  276 (318)
T KOG4602|consen  270 VCPICGA  276 (318)
T ss_pred             cCccccc
Confidence            3444444


No 266
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=22.07  E-value=65  Score=19.96  Aligned_cols=22  Identities=23%  Similarity=0.409  Sum_probs=11.5

Q ss_pred             eCCCCCCcccCchhHHHHHHhhcCC
Q psy4407          69 TCFACEYHSAKRSHIKEHIRQHTGE   93 (130)
Q Consensus        69 ~C~~C~~~f~~~~~l~~h~~~h~~~   93 (130)
                      .|-++|+.|.   .|.+|+.+|.+.
T Consensus        78 icLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             EEeccCcchH---HHHHHHhcccCC
Confidence            4555555553   355555555543


No 267
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=21.87  E-value=1e+02  Score=15.64  Aligned_cols=7  Identities=29%  Similarity=1.004  Sum_probs=3.5

Q ss_pred             eeCCCCC
Q psy4407          68 FTCFACE   74 (130)
Q Consensus        68 ~~C~~C~   74 (130)
                      |.|+.|+
T Consensus        45 y~C~~Cg   51 (54)
T PF10058_consen   45 YRCPYCG   51 (54)
T ss_pred             EEcCCCC
Confidence            4555544


No 268
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=21.80  E-value=44  Score=22.89  Aligned_cols=16  Identities=19%  Similarity=0.320  Sum_probs=6.7

Q ss_pred             CceeeCCCCCCcccCc
Q psy4407          65 TYIFTCFACEYHSAKR   80 (130)
Q Consensus        65 ~~~~~C~~C~~~f~~~   80 (130)
                      ..-|.|..|+..|..+
T Consensus        51 VaDF~C~~C~eeyELK   66 (254)
T PF06044_consen   51 VADFYCPNCNEEYELK   66 (254)
T ss_dssp             --EEE-TTT--EEEEE
T ss_pred             cceeECCCCchHHhhh
Confidence            4447777777666543


No 269
>KOG1813|consensus
Probab=21.65  E-value=84  Score=22.24  Aligned_cols=18  Identities=17%  Similarity=0.412  Sum_probs=13.6

Q ss_pred             ccCcceecccccccccCc
Q psy4407          28 FETEMLTCKYCYEFLPND   45 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~   45 (130)
                      .+.-||.|..|.+.|...
T Consensus       237 ~~~~Pf~c~icr~~f~~p  254 (313)
T KOG1813|consen  237 IELLPFKCFICRKYFYRP  254 (313)
T ss_pred             cccCCccccccccccccc
Confidence            355678899999888764


No 270
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=21.56  E-value=1.2e+02  Score=15.87  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=6.4

Q ss_pred             eeeCCCCCCcc
Q psy4407          67 IFTCFACEYHS   77 (130)
Q Consensus        67 ~~~C~~C~~~f   77 (130)
                      ...|..||...
T Consensus        30 ~V~C~~Cg~~L   40 (59)
T PRK00415         30 VVRCLVCGKTL   40 (59)
T ss_pred             EEECcccCCCc
Confidence            35666666554


No 271
>PRK04351 hypothetical protein; Provisional
Probab=21.54  E-value=84  Score=19.70  Aligned_cols=33  Identities=24%  Similarity=0.631  Sum_probs=21.3

Q ss_pred             ceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhhc
Q psy4407          66 YIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKAA  106 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f~  106 (130)
                      ..|.|..||..+....      + + ....|.|..|+..+.
T Consensus       111 y~Y~C~~Cg~~~~r~R------r-~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        111 YLYECQSCGQQYLRKR------R-I-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EEEECCCCCCEeeeee------e-c-CCCcEEeCCCCcEee
Confidence            4588888887665431      1 1 236688888886654


No 272
>KOG2923|consensus
Probab=21.33  E-value=52  Score=17.45  Aligned_cols=11  Identities=18%  Similarity=0.516  Sum_probs=6.6

Q ss_pred             eecccccccccC
Q psy4407          33 LTCKYCYEFLPN   44 (130)
Q Consensus        33 ~~C~~C~~~~~~   44 (130)
                      |.|+ ||..|.-
T Consensus        23 yPCp-CGDrf~I   33 (67)
T KOG2923|consen   23 YPCP-CGDRFQI   33 (67)
T ss_pred             cCCC-CCCeeee
Confidence            4454 7777653


No 273
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.12  E-value=51  Score=15.90  Aligned_cols=11  Identities=18%  Similarity=0.283  Sum_probs=8.1

Q ss_pred             eCCCCCCcccC
Q psy4407          69 TCFACEYHSAK   79 (130)
Q Consensus        69 ~C~~C~~~f~~   79 (130)
                      .|..|++.|.-
T Consensus        10 ~C~~C~rpf~W   20 (42)
T PF10013_consen   10 ICPVCGRPFTW   20 (42)
T ss_pred             cCcccCCcchH
Confidence            58888887754


No 274
>KOG4727|consensus
Probab=21.07  E-value=55  Score=21.13  Aligned_cols=23  Identities=17%  Similarity=0.345  Sum_probs=19.7

Q ss_pred             ceeeCCCCCCcccCchhHHHHHH
Q psy4407          66 YIFTCFACEYHSAKRSHIKEHIR   88 (130)
Q Consensus        66 ~~~~C~~C~~~f~~~~~l~~h~~   88 (130)
                      ..|.|.+|+-++..+.++..|+.
T Consensus        74 ~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             CceeeeecceeehhhHHHHHHhc
Confidence            34999999999999999888864


No 275
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=20.84  E-value=98  Score=15.42  Aligned_cols=11  Identities=18%  Similarity=0.491  Sum_probs=5.6

Q ss_pred             eeCCCCCCccc
Q psy4407          68 FTCFACEYHSA   78 (130)
Q Consensus        68 ~~C~~C~~~f~   78 (130)
                      +.|..||..+.
T Consensus        29 W~C~~Cgh~w~   39 (55)
T PF14311_consen   29 WKCPKCGHEWK   39 (55)
T ss_pred             EECCCCCCeeE
Confidence            45555554443


No 276
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=20.76  E-value=39  Score=17.25  Aligned_cols=25  Identities=12%  Similarity=0.307  Sum_probs=19.1

Q ss_pred             cccCcceecccccccccCccccccc
Q psy4407          27 RFETEMLTCKYCYEFLPNDAEIIAD   51 (130)
Q Consensus        27 ~~~~~~~~C~~C~~~~~~~~~l~~h   51 (130)
                      ....+-+-|-.||..|.+...|..+
T Consensus        22 YLR~~~~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   22 YLREEHNYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             HHHhhCceeeeeCCccCCHHHHHhC
Confidence            3445557799999999998888665


No 277
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=20.74  E-value=5.4  Score=20.03  Aligned_cols=11  Identities=27%  Similarity=0.809  Sum_probs=6.3

Q ss_pred             eeccccccccc
Q psy4407          33 LTCKYCYEFLP   43 (130)
Q Consensus        33 ~~C~~C~~~~~   43 (130)
                      |.|..|...+.
T Consensus         8 y~CDLCn~~~p   18 (57)
T PF14445_consen    8 YSCDLCNSSHP   18 (57)
T ss_pred             HhHHhhcccCc
Confidence            55666665553


No 278
>KOG0957|consensus
Probab=20.74  E-value=1e+02  Score=23.70  Aligned_cols=46  Identities=17%  Similarity=0.553  Sum_probs=26.2

Q ss_pred             ccCcceecccccccccCccccccccCCCCCCc-----------ccC--CCCceeeCCCCCCc
Q psy4407          28 FETEMLTCKYCYEFLPNDAEIIADHCKFCSYK-----------LRP--DKTYIFTCFACEYH   76 (130)
Q Consensus        28 ~~~~~~~C~~C~~~~~~~~~l~~h~c~~C~~~-----------~~h--~~~~~~~C~~C~~~   76 (130)
                      .....|.|..|.+.-..  .|.. .|+.|...           +..  +...-|+|.+|++.
T Consensus       540 ~~a~~ysCgiCkks~dQ--Hll~-~CDtC~lhYHlGCL~PPLTR~Pkk~kn~gWqCsECdk~  598 (707)
T KOG0957|consen  540 PKAMNYSCGICKKSTDQ--HLLT-QCDTCHLHYHLGCLSPPLTRLPKKNKNFGWQCSECDKN  598 (707)
T ss_pred             ccccceeeeeeccchhh--HHHh-hcchhhceeeccccCCccccCcccccCcceeecccccc
Confidence            34566999999887422  2221 46666554           111  12234889999643


No 279
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.65  E-value=1.3e+02  Score=20.83  Aligned_cols=24  Identities=21%  Similarity=0.635  Sum_probs=14.2

Q ss_pred             cCCCCCCcccCCCCceeeCCCCCCcccC
Q psy4407          52 HCKFCSYKLRPDKTYIFTCFACEYHSAK   79 (130)
Q Consensus        52 ~c~~C~~~~~h~~~~~~~C~~C~~~f~~   79 (130)
                      .|+.||.    .....+.|+.||.....
T Consensus       311 ~C~~cg~----~~~r~~~C~~cg~~~~r  334 (364)
T COG0675         311 TCPCCGH----LSGRLFKCPRCGFVHDR  334 (364)
T ss_pred             cccccCC----ccceeEECCCCCCeehh
Confidence            4666665    33445777777765443


No 280
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=20.50  E-value=59  Score=15.39  Aligned_cols=12  Identities=17%  Similarity=0.304  Sum_probs=7.0

Q ss_pred             ceeccccccccc
Q psy4407          32 MLTCKYCYEFLP   43 (130)
Q Consensus        32 ~~~C~~C~~~~~   43 (130)
                      +-.|..|++.+.
T Consensus        11 ~~~C~~C~~~i~   22 (50)
T cd00029          11 PTFCDVCRKSIW   22 (50)
T ss_pred             CCChhhcchhhh
Confidence            445666666553


No 281
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=20.50  E-value=1.3e+02  Score=15.21  Aligned_cols=8  Identities=25%  Similarity=0.729  Sum_probs=4.8

Q ss_pred             eeCCCCCC
Q psy4407          68 FTCFACEY   75 (130)
Q Consensus        68 ~~C~~C~~   75 (130)
                      ..|..||.
T Consensus        30 V~C~~Cga   37 (61)
T PF14354_consen   30 VECTDCGA   37 (61)
T ss_pred             EEcCCCCC
Confidence            44666764


No 282
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=20.38  E-value=1.2e+02  Score=20.03  Aligned_cols=13  Identities=15%  Similarity=0.363  Sum_probs=8.3

Q ss_pred             ceeeCCCCCCccc
Q psy4407          66 YIFTCFACEYHSA   78 (130)
Q Consensus        66 ~~~~C~~C~~~f~   78 (130)
                      ....|..||..+.
T Consensus        29 ~lvrC~eCG~V~~   41 (201)
T COG1326          29 PLVRCEECGTVHP   41 (201)
T ss_pred             eEEEccCCCcEee
Confidence            4567777776653


No 283
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=20.31  E-value=56  Score=20.01  Aligned_cols=10  Identities=20%  Similarity=0.677  Sum_probs=4.9

Q ss_pred             eeeCCCCCCc
Q psy4407          67 IFTCFACEYH   76 (130)
Q Consensus        67 ~~~C~~C~~~   76 (130)
                      .|.|..|+..
T Consensus        37 ~y~C~~C~~~   46 (146)
T PF08646_consen   37 SYRCEKCNKT   46 (146)
T ss_dssp             EEEETTTTEE
T ss_pred             EEECCCCCCc
Confidence            3555555543


No 284
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=20.25  E-value=80  Score=14.71  Aligned_cols=12  Identities=17%  Similarity=0.276  Sum_probs=7.1

Q ss_pred             ceeccccccccc
Q psy4407          32 MLTCKYCYEFLP   43 (130)
Q Consensus        32 ~~~C~~C~~~~~   43 (130)
                      +-.|..|++.+.
T Consensus        11 ~~~C~~C~~~i~   22 (49)
T smart00109       11 PTKCCVCRKSIW   22 (49)
T ss_pred             CCCccccccccC
Confidence            445666766653


No 285
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=20.04  E-value=83  Score=17.47  Aligned_cols=55  Identities=18%  Similarity=0.454  Sum_probs=17.9

Q ss_pred             cccccccCCCCCCc--ccCCCCceeeCCCCCCcccCchhHHHHHHhhcCCCCeecccChhhh
Q psy4407          46 AEIIADHCKFCSYK--LRPDKTYIFTCFACEYHSAKRSHIKEHIRQHTGEKPFSCLLCEYKA  105 (130)
Q Consensus        46 ~~l~~h~c~~C~~~--~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~k~~~C~~C~~~f  105 (130)
                      .+|..+.|.+||..  .+..|+.-.-|.+|++-.-.  ......+.   +-.-.|..|+-.|
T Consensus         5 k~~~~qiCqiCGD~VGl~~~Ge~FVAC~eC~fPvCr--~CyEYErk---eg~q~CpqCkt~y   61 (80)
T PF14569_consen    5 KNLNGQICQICGDDVGLTENGEVFVACHECAFPVCR--PCYEYERK---EGNQVCPQCKTRY   61 (80)
T ss_dssp             S--SS-B-SSS--B--B-SSSSB--S-SSS-----H--HHHHHHHH---TS-SB-TTT--B-
T ss_pred             hhcCCcccccccCccccCCCCCEEEEEcccCCccch--hHHHHHhh---cCcccccccCCCc
Confidence            34555677777776  44456655567777643321  12222222   2223677776444


Done!