Query         psy4412
Match_columns 39
No_of_seqs    111 out of 1995
Neff          12.7
Searched_HMMs 46136
Date          Sat Aug 17 00:52:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4412.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4412hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.7 1.8E-17 3.8E-22   63.7   2.7   38    1-38    210-247 (279)
  2 KOG3623|consensus               99.6 1.2E-15 2.6E-20   64.7   1.4   38    1-38    917-954 (1007)
  3 KOG2462|consensus               99.5 1.1E-14 2.4E-19   56.2   1.2   34    5-38    186-219 (279)
  4 PHA00616 hypothetical protein   99.4 9.2E-14   2E-18   41.7   1.1   33    6-38      1-33  (44)
  5 KOG3623|consensus               99.3   5E-13 1.1E-17   57.2   1.1   35    4-38    279-313 (1007)
  6 PHA02768 hypothetical protein;  99.2 3.3E-11 7.2E-16   37.6   2.1   30    6-37      5-34  (55)
  7 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.1E-09 2.4E-14   29.7   1.9   19   21-39      1-19  (26)
  8 KOG1074|consensus               98.9 5.5E-10 1.2E-14   48.7   1.1   33    1-33    628-660 (958)
  9 KOG3576|consensus               98.9 2.2E-10 4.7E-15   43.7  -0.2   33    6-38    145-177 (267)
 10 KOG1074|consensus               98.9 8.3E-10 1.8E-14   48.2   1.1   33    7-39    354-386 (958)
 11 PF13465 zf-H2C2_2:  Zinc-finge  98.8 1.1E-09 2.3E-14   29.8   0.7   17    1-17      9-25  (26)
 12 PF00096 zf-C2H2:  Zinc finger,  98.8 1.3E-08 2.7E-13   26.7   1.9   23    7-29      1-23  (23)
 13 PF13912 zf-C2H2_6:  C2H2-type   98.7 1.4E-08 3.1E-13   27.5   1.5   25    6-30      1-25  (27)
 14 PHA00733 hypothetical protein   98.6 1.1E-07 2.4E-12   34.1   2.6   34    3-38     70-103 (128)
 15 PF13894 zf-C2H2_4:  C2H2-type   98.4 3.9E-07 8.5E-12   23.6   2.1   23    7-29      1-23  (24)
 16 KOG3576|consensus               98.4 1.3E-07 2.8E-12   36.4   1.0   30    1-30    168-197 (267)
 17 smart00355 ZnF_C2H2 zinc finge  98.3 1.2E-06 2.5E-11   22.9   1.9   24    7-30      1-24  (26)
 18 PF09237 GAGA:  GAGA factor;  I  98.3   4E-06 8.7E-11   26.1   2.9   32    3-34     21-52  (54)
 19 KOG3608|consensus               98.1 4.2E-06 9.2E-11   34.7   2.0   37    1-38    287-323 (467)
 20 PF12874 zf-met:  Zinc-finger o  98.0 4.9E-06 1.1E-10   21.9   1.5   23    7-29      1-23  (25)
 21 PHA00732 hypothetical protein   98.0 6.2E-06 1.3E-10   27.6   2.0   26    6-31      1-27  (79)
 22 PRK04860 hypothetical protein;  97.8 4.2E-05 9.1E-10   28.6   2.6   29    6-38    119-147 (160)
 23 PF13909 zf-H2C2_5:  C2H2-type   97.5 0.00014 3.1E-09   18.9   1.7   22    7-29      1-22  (24)
 24 PF12171 zf-C2H2_jaz:  Zinc-fin  97.4 3.9E-05 8.4E-10   20.7  -0.1   22    7-28      2-23  (27)
 25 KOG3608|consensus               97.3 0.00032   7E-09   29.5   2.3   33    6-38    263-296 (467)
 26 PLN03086 PRLI-interacting fact  97.3 0.00037   8E-09   30.7   2.2   31    6-38    478-508 (567)
 27 smart00451 ZnF_U1 U1-like zinc  97.1 0.00056 1.2E-08   19.2   1.6   22    6-27      3-24  (35)
 28 PF05605 zf-Di19:  Drought indu  97.0  0.0018 3.8E-08   20.2   2.6   33    6-39      2-36  (54)
 29 PF12756 zf-C2H2_2:  C2H2 type   96.9  0.0018   4E-08   21.8   2.1   24    6-29     50-73  (100)
 30 COG5189 SFP1 Putative transcri  96.8  0.0003 6.5E-09   29.2  -0.2   24    3-26    395-418 (423)
 31 PLN03086 PRLI-interacting fact  96.5  0.0059 1.3E-07   27.3   2.6   36    2-38    500-545 (567)
 32 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0042 9.2E-08   16.5   1.5   20    7-27      3-22  (25)
 33 KOG3993|consensus               95.7  0.0067 1.5E-07   26.4   1.0   25    6-30    295-319 (500)
 34 PF04959 ARS2:  Arsenite-resist  95.3  0.0069 1.5E-07   24.0   0.4   28    4-31     75-102 (214)
 35 KOG3993|consensus               95.0   0.014   3E-07   25.5   0.9   26    5-30    355-380 (500)
 36 COG4049 Uncharacterized protei  95.0   0.019 4.1E-07   18.4   1.0   25    3-27     14-38  (65)
 37 PF12013 DUF3505:  Protein of u  94.0   0.091   2E-06   18.6   1.9   26    6-31     80-109 (109)
 38 PF05443 ROS_MUCR:  ROS/MUCR tr  93.6   0.076 1.6E-06   19.8   1.4   23    7-32     73-95  (132)
 39 PF08790 zf-LYAR:  LYAR-type C2  92.2    0.04 8.7E-07   15.2  -0.0   19    7-26      1-19  (28)
 40 KOG2482|consensus               91.5    0.19 4.2E-06   21.8   1.5   23    7-29    196-218 (423)
 41 cd00350 rubredoxin_like Rubred  91.3     0.2 4.2E-06   14.0   1.4    9    7-15      2-10  (33)
 42 KOG3408|consensus               90.3    0.26 5.6E-06   18.3   1.2   24    5-28     56-79  (129)
 43 COG1592 Rubrerythrin [Energy p  90.2    0.33 7.2E-06   18.9   1.5   10    6-15    134-143 (166)
 44 KOG4167|consensus               89.4    0.08 1.7E-06   25.0  -0.4   25    6-30    792-816 (907)
 45 COG5048 FOG: Zn-finger [Genera  88.4     0.2 4.4E-06   20.9   0.5   32    7-38    290-325 (467)
 46 smart00834 CxxC_CXXC_SSSS Puta  88.3    0.29 6.2E-06   14.0   0.7   15    6-20      5-19  (41)
 47 PF09723 Zn-ribbon_8:  Zinc rib  87.2    0.36 7.7E-06   14.3   0.6   16    6-21      5-20  (42)
 48 PF10571 UPF0547:  Uncharacteri  85.3    0.48   1E-05   12.7   0.5   10    8-17     16-25  (26)
 49 TIGR02605 CxxC_CxxC_SSSS putat  84.7    0.56 1.2E-05   14.3   0.6   15    6-20      5-19  (52)
 50 COG4957 Predicted transcriptio  84.5    0.83 1.8E-05   17.4   1.1   24    8-34     78-101 (148)
 51 PF01428 zf-AN1:  AN1-like Zinc  84.1     0.5 1.1E-05   14.0   0.4   15    5-19     12-26  (43)
 52 smart00154 ZnF_AN1 AN1-like Zi  83.6    0.76 1.6E-05   13.5   0.7   14    6-19     12-25  (39)
 53 smart00614 ZnF_BED BED zinc fi  82.9     1.2 2.5E-05   13.6   2.0   21    7-27     19-44  (50)
 54 cd00924 Cyt_c_Oxidase_Vb Cytoc  82.7    0.96 2.1E-05   16.1   0.9   13    5-17     78-90  (97)
 55 PLN02294 cytochrome c oxidase   81.7     1.1 2.4E-05   17.7   1.0   15    4-18    139-153 (174)
 56 PF09845 DUF2072:  Zn-ribbon co  81.6    0.72 1.6E-05   17.4   0.5   15    6-20      1-15  (131)
 57 PF07754 DUF1610:  Domain of un  81.0    0.99 2.2E-05   12.0   0.6    9    6-14     16-24  (24)
 58 PF09986 DUF2225:  Uncharacteri  80.8       1 2.2E-05   18.1   0.8   19    4-22      3-21  (214)
 59 PF13451 zf-trcl:  Probable zin  79.1     1.3 2.8E-05   13.9   0.7   17    4-20      2-18  (49)
 60 PF01286 XPA_N:  XPA protein N-  77.6     1.3 2.8E-05   12.8   0.5   12    8-19      5-16  (34)
 61 PF06397 Desulfoferrod_N:  Desu  77.5     1.3 2.7E-05   13.0   0.5   11    6-16      6-16  (36)
 62 PHA00626 hypothetical protein   76.4     2.2 4.8E-05   13.9   0.9   14    5-18     22-35  (59)
 63 PF11789 zf-Nse:  Zinc-finger o  76.0     2.4 5.2E-05   13.5   1.0   16    5-20     23-38  (57)
 64 KOG2071|consensus               75.8     3.2   7E-05   19.6   1.6   26    5-30    417-442 (579)
 65 cd00729 rubredoxin_SM Rubredox  75.8     1.9   4E-05   12.2   0.7   12    6-17      2-13  (34)
 66 KOG2893|consensus               74.9    0.42 9.2E-06   19.9  -0.9   17    7-23     35-51  (341)
 67 PF04423 Rad50_zn_hook:  Rad50   74.1     1.5 3.2E-05   13.6   0.4   12    8-19     22-33  (54)
 68 KOG0717|consensus               73.4     3.5 7.5E-05   19.1   1.4   21    7-27    293-313 (508)
 69 smart00734 ZnF_Rad18 Rad18-lik  73.2     2.2 4.7E-05   11.3   1.3   18    8-26      3-20  (26)
 70 PTZ00448 hypothetical protein;  72.5     3.9 8.5E-05   18.3   1.4   23    6-28    314-336 (373)
 71 PF02892 zf-BED:  BED zinc fing  72.4     2.8   6E-05   12.2   2.0   22    5-26     15-40  (45)
 72 COG2331 Uncharacterized protei  71.5     1.6 3.4E-05   15.1   0.2   12    6-17     12-23  (82)
 73 PF13878 zf-C2H2_3:  zinc-finge  70.7     3.2   7E-05   12.3   1.7   24    7-30     14-39  (41)
 74 PF10013 DUF2256:  Uncharacteri  70.0     2.3   5E-05   12.9   0.4   14    8-21     10-23  (42)
 75 COG3364 Zn-ribbon containing p  69.6     2.4 5.1E-05   15.5   0.5   14    6-19      2-15  (112)
 76 COG1773 Rubredoxin [Energy pro  69.3     2.6 5.7E-05   13.6   0.5   13    6-18      3-15  (55)
 77 TIGR00622 ssl1 transcription f  69.2     5.9 0.00013   14.7   1.6   24    6-29     81-104 (112)
 78 PF01215 COX5B:  Cytochrome c o  68.5     3.1 6.8E-05   15.9   0.7   14    5-18    111-124 (136)
 79 PLN02748 tRNA dimethylallyltra  68.3     5.5 0.00012   18.3   1.5   24    4-27    416-440 (468)
 80 PTZ00043 cytochrome c oxidase   67.5     3.7 8.1E-05   17.2   0.9   15    4-18    179-193 (268)
 81 PF07975 C1_4:  TFIIH C1-like d  67.2     0.7 1.5E-05   14.6  -0.9   23    5-27     20-42  (51)
 82 PF09538 FYDLN_acid:  Protein o  66.9     4.1 8.9E-05   14.9   0.9   17    3-19     23-39  (108)
 83 PRK06266 transcription initiat  66.0       5 0.00011   15.9   1.0   15    6-20    117-131 (178)
 84 PF00301 Rubredoxin:  Rubredoxi  66.0       4 8.6E-05   12.6   0.7   11    7-17      2-12  (47)
 85 PF01096 TFIIS_C:  Transcriptio  64.6     3.6 7.8E-05   12.0   0.5   10    7-16     29-38  (39)
 86 KOG2186|consensus               64.4     3.5 7.7E-05   17.5   0.5   21    6-27     29-49  (276)
 87 TIGR00373 conserved hypothetic  63.2     9.1  0.0002   14.8   1.5   17    6-22    109-125 (158)
 88 PF14353 CpXC:  CpXC protein     63.1     4.7  0.0001   14.7   0.7   15    6-20     38-52  (128)
 89 PF02148 zf-UBP:  Zn-finger in   63.0     4.4 9.6E-05   12.9   0.6   16    4-19      9-24  (63)
 90 KOG2785|consensus               62.8     8.8 0.00019   17.4   1.5   24    6-29    217-243 (390)
 91 COG2888 Predicted Zn-ribbon RN  62.3     5.2 0.00011   13.2   0.7    9    5-13     49-57  (61)
 92 cd00730 rubredoxin Rubredoxin;  61.9     3.7 8.1E-05   12.8   0.3   11    7-17      2-12  (50)
 93 smart00659 RPOLCX RNA polymera  61.8     5.5 0.00012   12.1   0.7   12    7-18      3-14  (44)
 94 PRK00464 nrdR transcriptional   61.7     4.1 8.9E-05   15.8   0.5   15    6-20     28-42  (154)
 95 TIGR00319 desulf_FeS4 desulfof  61.6       5 0.00011   11.1   0.7   11    6-16      7-17  (34)
 96 KOG1994|consensus               61.5     7.2 0.00016   16.5   1.1   22    6-27    239-260 (268)
 97 TIGR03831 YgiT_finger YgiT-typ  61.5     4.5 9.8E-05   11.6   0.5   11    7-17     33-43  (46)
 98 PF01927 Mut7-C:  Mut7-C RNAse   61.1     8.8 0.00019   14.6   1.3   15    7-21    125-139 (147)
 99 PF04780 DUF629:  Protein of un  60.5      10 0.00022   17.6   1.6   22    6-27     57-78  (466)
100 PRK00398 rpoP DNA-directed RNA  60.4     5.9 0.00013   11.8   0.7   12    6-17      3-14  (46)
101 cd00974 DSRD Desulforedoxin (D  60.0     5.4 0.00012   11.1   0.6   11    6-16      4-14  (34)
102 KOG1146|consensus               59.5      12 0.00025   20.0   1.7   25    4-28    516-540 (1406)
103 COG1655 Uncharacterized protei  59.3       1 2.2E-05   18.7  -1.2   27    5-31     18-44  (267)
104 PF13719 zinc_ribbon_5:  zinc-r  59.3       6 0.00013   11.3   1.0   11    6-16     25-35  (37)
105 PRK14890 putative Zn-ribbon RN  57.7       7 0.00015   12.8   0.7    9    5-13     47-55  (59)
106 PF14369 zf-RING_3:  zinc-finge  56.9     5.6 0.00012   11.4   0.4   10    8-17     23-32  (35)
107 KOG2857|consensus               56.9     6.9 0.00015   15.3   0.7   22    6-27     17-38  (157)
108 smart00440 ZnF_C2C2 C2C2 Zinc   56.4     7.3 0.00016   11.4   0.7   10    7-16     29-38  (40)
109 PRK08222 hydrogenase 4 subunit  55.9      11 0.00024   14.9   1.2   17    6-22    114-130 (181)
110 KOG0978|consensus               55.7     3.5 7.6E-05   20.0  -0.1   17    7-23    679-695 (698)
111 KOG2593|consensus               55.3     8.4 0.00018   17.7   0.9   19    4-22    126-144 (436)
112 PF02176 zf-TRAF:  TRAF-type zi  55.3     8.5 0.00018   11.8   1.8   32    6-37      9-41  (60)
113 PF08792 A2L_zn_ribbon:  A2L zi  52.8     8.2 0.00018   10.9   0.6   10    7-16     22-31  (33)
114 COG3677 Transposase and inacti  52.4     8.5 0.00018   14.5   0.6   15    5-19     52-66  (129)
115 COG5152 Uncharacterized conser  51.4       9  0.0002   15.9   0.7   16    4-19    194-209 (259)
116 COG1996 RPC10 DNA-directed RNA  51.2     7.8 0.00017   12.2   0.4   12    5-16      5-16  (49)
117 TIGR00244 transcriptional regu  50.5     7.8 0.00017   15.1   0.4   14    7-20     29-42  (147)
118 KOG2636|consensus               49.9      23  0.0005   16.7   1.7   23    4-26    399-422 (497)
119 KOG0562|consensus               49.8      20 0.00043   14.5   1.8   25    5-29    152-176 (184)
120 PF05191 ADK_lid:  Adenylate ki  49.8     9.8 0.00021   11.0   0.9   10    8-17     23-32  (36)
121 KOG0782|consensus               49.4       3 6.5E-05   20.0  -0.8   14    7-20    254-267 (1004)
122 PRK12387 formate hydrogenlyase  49.2      11 0.00024   14.8   0.8   16    6-21    114-129 (180)
123 TIGR02098 MJ0042_CXXC MJ0042 f  49.1     9.6 0.00021   10.6   0.8   14    7-20      3-16  (38)
124 COG1997 RPL43A Ribosomal prote  48.7      11 0.00024   13.5   0.7   11    7-17     54-64  (89)
125 COG1327 Predicted transcriptio  48.6     8.6 0.00019   15.1   0.4   13    8-20     30-42  (156)
126 KOG4727|consensus               48.5      16 0.00034   14.8   1.1   21    6-26     75-95  (193)
127 smart00132 LIM Zinc-binding do  47.2     8.7 0.00019   10.2   0.3    9    7-15     28-36  (39)
128 PF13717 zinc_ribbon_4:  zinc-r  47.0      11 0.00024   10.7   1.0   10    7-16     26-35  (36)
129 COG5112 UFD2 U1-like Zn-finger  47.0      11 0.00023   14.0   0.5   22    6-27     55-76  (126)
130 PF03811 Zn_Tnp_IS1:  InsA N-te  47.0     2.1 4.5E-05   12.4  -1.0   28    7-38      6-33  (36)
131 PF06170 DUF983:  Protein of un  46.4      11 0.00023   13.2   0.5   12    8-19     10-21  (86)
132 PF10083 DUF2321:  Uncharacteri  45.1      12 0.00025   14.9   0.5   18    4-21     66-83  (158)
133 PF09965 DUF2199:  Uncharacteri  45.1      11 0.00023   14.7   0.4   13    7-19      1-13  (148)
134 PF14447 Prok-RING_4:  Prokaryo  44.9      11 0.00025   12.2   0.4   13    5-17     38-50  (55)
135 TIGR03829 YokU_near_AblA uncha  44.1      18  0.0004   12.9   0.9   16    7-22     36-51  (89)
136 COG3091 SprT Zn-dependent meta  44.1      14 0.00029   14.7   0.6   27    6-37    117-143 (156)
137 PF13240 zinc_ribbon_2:  zinc-r  44.1     8.6 0.00019    9.8   0.1    6    9-14     16-21  (23)
138 PF10367 Vps39_2:  Vacuolar sor  44.1      14  0.0003   12.8   0.6   12    8-19     80-91  (109)
139 COG4306 Uncharacterized protei  44.0      15 0.00033   14.1   0.7   16    4-19     66-81  (160)
140 COG4888 Uncharacterized Zn rib  43.8      16 0.00034   13.5   0.7    9    6-14     22-30  (104)
141 KOG3362|consensus               43.8       7 0.00015   15.3  -0.1   20    6-25    129-148 (156)
142 PF03604 DNA_RNApol_7kD:  DNA d  43.7      13 0.00028   10.5   0.6   10    7-16      1-10  (32)
143 smart00531 TFIIE Transcription  43.6      23 0.00051   13.5   1.2   16    5-20     98-113 (147)
144 COG1631 RPL42A Ribosomal prote  43.0      12 0.00026   13.5   0.4   11    7-17     69-79  (94)
145 PF14690 zf-ISL3:  zinc-finger   42.7      14 0.00031   10.7   0.5    9    6-14      2-10  (47)
146 KOG3183|consensus               42.5      12 0.00025   16.0   0.4   14    6-19     23-36  (250)
147 COG1594 RPB9 DNA-directed RNA   42.5      14 0.00031   13.6   0.6   10    7-16    101-110 (113)
148 PLN03238 probable histone acet  42.3      35 0.00075   15.1   2.3   24    5-28     47-70  (290)
149 PF03107 C1_2:  C1 domain;  Int  42.2      12 0.00026   10.0   0.3    7    8-14      2-8   (30)
150 TIGR01206 lysW lysine biosynth  41.8      13 0.00028   11.9   0.4   11    7-17      3-13  (54)
151 COG3357 Predicted transcriptio  41.7      13 0.00028   13.4   0.4   14    5-18     57-70  (97)
152 PF06353 DUF1062:  Protein of u  41.3      15 0.00033   14.2   0.6   10    7-16     14-23  (142)
153 PLN00104 MYST -like histone ac  40.7      36 0.00078   16.1   1.7   23    5-27    197-219 (450)
154 TIGR02300 FYDLN_acid conserved  40.6      22 0.00047   13.7   0.9   16    4-19     24-39  (129)
155 PF13824 zf-Mss51:  Zinc-finger  40.5      18 0.00039   11.7   0.6   14    4-17     12-25  (55)
156 PF15269 zf-C2H2_7:  Zinc-finge  40.1      18 0.00039   11.2   1.2   21    7-27     21-41  (54)
157 PF07295 DUF1451:  Protein of u  38.9      14 0.00031   14.3   0.4   11    6-16    112-122 (146)
158 COG4338 Uncharacterized protei  38.5      11 0.00024   11.9   0.1   13    8-20     14-26  (54)
159 PF09855 DUF2082:  Nucleic-acid  38.5      15 0.00032   12.2   0.3    7    8-14      2-8   (64)
160 PF14787 zf-CCHC_5:  GAG-polypr  37.5      18 0.00039   10.7   0.4   13    8-20      4-16  (36)
161 PF01780 Ribosomal_L37ae:  Ribo  37.4      21 0.00047   12.8   0.7    8    7-14     36-43  (90)
162 PF10276 zf-CHCC:  Zinc-finger   37.1      19 0.00042   10.7   0.7   11    6-16     29-39  (40)
163 PF09943 DUF2175:  Uncharacteri  37.0      17 0.00038   13.3   0.4    9    7-15      3-11  (101)
164 PRK03824 hypA hydrogenase nick  36.6      22 0.00047   13.5   0.7   14    6-19     70-83  (135)
165 PF14354 Lar_restr_allev:  Rest  36.4      22 0.00047   11.1   0.6    6    8-13      5-10  (61)
166 KOG4124|consensus               36.3       5 0.00011   18.0  -1.0   20    4-23    396-415 (442)
167 KOG0402|consensus               36.3      11 0.00023   13.4  -0.1    8    7-14     37-44  (92)
168 PF01363 FYVE:  FYVE zinc finge  36.3      22 0.00047   11.4   0.6   12    6-17     25-36  (69)
169 smart00661 RPOL9 RNA polymeras  35.8      21 0.00045   10.6   0.8   14    6-19     20-33  (52)
170 KOG1842|consensus               35.7      28 0.00061   16.5   1.0   25    6-30     15-39  (505)
171 PF13696 zf-CCHC_2:  Zinc knuck  35.6      19 0.00041   10.3   0.4    9    6-14      8-16  (32)
172 COG1885 Uncharacterized protei  35.5      19 0.00042   13.3   0.5   10    7-16     50-59  (115)
173 COG4530 Uncharacterized protei  35.1      26 0.00056   13.2   0.7   14    3-16     23-36  (129)
174 PF08209 Sgf11:  Sgf11 (transcr  34.7      20 0.00044   10.2   0.6   20    6-26      4-23  (33)
175 TIGR03830 CxxCG_CxxCG_HTH puta  34.5      32 0.00068   12.4   1.8   17    7-23     32-48  (127)
176 PF01194 RNA_pol_N:  RNA polyme  34.4      19 0.00042   11.9   0.4   15    5-19      3-17  (60)
177 PF08271 TF_Zn_Ribbon:  TFIIB z  34.4      21 0.00046   10.4   0.5    7    8-14      2-8   (43)
178 PF12907 zf-met2:  Zinc-binding  34.3      17 0.00036   10.9   0.2   21    7-27      2-25  (40)
179 PF00412 LIM:  LIM domain;  Int  34.3      23 0.00049   10.6   0.7   12    7-18     27-38  (58)
180 PTZ00064 histone acetyltransfe  34.3      63  0.0014   15.8   2.0   24    5-28    279-302 (552)
181 PRK11823 DNA repair protein Ra  34.1      29 0.00063   16.0   0.9   12    6-17      7-18  (446)
182 KOG4173|consensus               34.0      18  0.0004   15.2   0.3   19    8-26    108-126 (253)
183 PF13408 Zn_ribbon_recom:  Reco  34.0      19 0.00041   10.9   0.3   12    7-18      6-17  (58)
184 COG1656 Uncharacterized conser  33.9      41  0.0009   13.6   1.5   16    7-22    131-146 (165)
185 PHA02998 RNA polymerase subuni  33.9      32  0.0007   14.2   1.0   13    7-19    172-184 (195)
186 PRK04016 DNA-directed RNA poly  33.6      26 0.00056   11.7   0.6   14    5-18      3-16  (62)
187 PF13821 DUF4187:  Domain of un  33.5      23  0.0005   11.3   0.5   19    7-25     28-46  (55)
188 PF00935 Ribosomal_L44:  Riboso  33.2      24 0.00053   12.2   0.5   10    7-16     54-63  (77)
189 PF07503 zf-HYPF:  HypF finger;  32.6      23 0.00049   10.2   0.6   11    7-17     22-32  (35)
190 PF02998 Lentiviral_Tat:  Lenti  32.4      28  0.0006   12.3   0.6   11    5-15     73-83  (86)
191 KOG3214|consensus               32.3      16 0.00034   13.5   0.0   13    7-19     48-60  (109)
192 COG5188 PRP9 Splicing factor 3  32.3      21 0.00046   16.3   0.4   21    7-27    239-259 (470)
193 COG4847 Uncharacterized protei  32.0      23 0.00051   12.9   0.4   11    5-15      5-15  (103)
194 PRK01343 zinc-binding protein;  31.8      25 0.00055   11.5   0.5   12    6-17      9-20  (57)
195 PF14803 Nudix_N_2:  Nudix N-te  31.7      22 0.00047   10.2   0.3    8    9-16      3-10  (34)
196 PF03286 Pox_Ag35:  Pox virus A  31.5      46 0.00099   13.9   1.2   21   11-31      9-29  (200)
197 PF06689 zf-C4_ClpX:  ClpX C4-t  31.2      24 0.00051   10.4   0.4    9    8-16      3-11  (41)
198 PF15499 Peptidase_C98:  Ubiqui  30.8      15 0.00033   15.9  -0.1   12    5-16    133-144 (275)
199 PF09889 DUF2116:  Uncharacteri  30.8      32 0.00069   11.3   0.8    9    8-16      5-13  (59)
200 PRK11032 hypothetical protein;  30.5      23  0.0005   14.1   0.3    8    7-14    125-132 (160)
201 PF03194 LUC7:  LUC7 N_terminus  30.4      28  0.0006   14.8   0.6   10    7-16    191-200 (254)
202 PF04438 zf-HIT:  HIT zinc fing  29.8      24 0.00053    9.7   0.6   12    6-17     13-24  (30)
203 PF05290 Baculo_IE-1:  Baculovi  29.5      32  0.0007   13.4   0.6   15    5-19     79-93  (140)
204 PF01844 HNH:  HNH endonuclease  29.4      24 0.00053   10.0   0.3    7   10-16      2-8   (47)
205 PF05741 zf-nanos:  Nanos RNA b  29.3      25 0.00055   11.4   0.3    9    6-14     33-41  (55)
206 PF03691 UPF0167:  Uncharacteri  28.8      33 0.00071   13.9   0.6   11    6-16    160-170 (176)
207 PLN03239 histone acetyltransfe  28.7      58  0.0013   14.9   1.3   23    5-27    105-127 (351)
208 PF14311 DUF4379:  Domain of un  28.7      32 0.00069   10.6   1.0   13    7-19     29-41  (55)
209 PF01155 HypA:  Hydrogenase exp  28.7      31 0.00068   12.6   0.6   12    7-18     71-82  (113)
210 PF04810 zf-Sec23_Sec24:  Sec23  28.4      29 0.00063   10.1   0.8   10    5-14     23-32  (40)
211 PF07649 C1_3:  C1-like domain;  28.4      25 0.00054    9.3   0.5   10    5-14     14-23  (30)
212 KOG3014|consensus               28.4      65  0.0014   14.1   1.6   24    7-30     38-63  (257)
213 COG4640 Predicted membrane pro  28.4      68  0.0015   15.2   1.5   19    5-23     14-32  (465)
214 TIGR00416 sms DNA repair prote  28.2      42  0.0009   15.6   0.9   11    6-16      7-17  (454)
215 COG5151 SSL1 RNA polymerase II  28.0      68  0.0015   14.6   1.5   24    6-29    388-411 (421)
216 KOG3352|consensus               27.8      31 0.00066   13.7   0.5   13    5-17    132-144 (153)
217 cd07153 Fur_like Ferric uptake  27.6      35 0.00075   12.1   0.6   12    7-18     74-85  (116)
218 PF04988 AKAP95:  A-kinase anch  27.6      49  0.0011   13.4   1.0   20    7-26      1-20  (165)
219 COG4855 Uncharacterized protei  27.5      33 0.00073   11.7   0.5   11    8-18     25-35  (76)
220 PF14446 Prok-RING_1:  Prokaryo  27.4      26 0.00056   11.3   0.2   11    7-17      6-16  (54)
221 TIGR00280 L37a ribosomal prote  27.2      38 0.00082   12.2   0.6   10    7-16     54-63  (91)
222 PF14445 Prok-RING_2:  Prokaryo  27.1      15 0.00032   11.8  -0.3   11    7-17      8-18  (57)
223 TIGR00320 dfx_rbo desulfoferro  27.1      39 0.00084   12.8   0.7   11    6-16      7-17  (125)
224 PF12230 PRP21_like_P:  Pre-mRN  26.6      22 0.00047   14.6   0.0   26    7-33    169-194 (229)
225 PF03884 DUF329:  Domain of unk  26.6      35 0.00077   11.1   0.5   12    7-18      3-14  (57)
226 TIGR02986 restrict_Alw26I type  25.9      19 0.00042   16.6  -0.2    9    9-17     85-93  (424)
227 cd00065 FYVE FYVE domain; Zinc  25.9      36 0.00078   10.3   0.6   12    6-17     18-29  (57)
228 PF14255 Cys_rich_CPXG:  Cystei  25.7      34 0.00073   10.9   0.4    8    9-16      3-10  (52)
229 PF10955 DUF2757:  Protein of u  25.6      41 0.00088   11.7   0.6   11    6-16      4-14  (76)
230 PF01475 FUR:  Ferric uptake re  25.6      38 0.00083   12.2   0.6   13    7-19     81-93  (120)
231 PRK09678 DNA-binding transcrip  25.5      44 0.00095   11.4   0.6   16    6-21     27-44  (72)
232 PTZ00255 60S ribosomal protein  24.8      45 0.00098   12.0   0.6   11    6-16     54-64  (90)
233 PF08394 Arc_trans_TRASH:  Arch  24.7      37  0.0008   10.0   0.5    6    9-14      1-6   (37)
234 PF13453 zf-TFIIB:  Transcripti  24.5      36 0.00077    9.8   1.3   17    7-23     20-36  (41)
235 PF11931 DUF3449:  Domain of un  24.5      25 0.00054   14.5   0.0   21    5-25    100-121 (196)
236 PF12523 DUF3725:  Protein of u  24.5      49  0.0011   11.3   0.7   12    4-15     57-68  (74)
237 PF10588 NADH-G_4Fe-4S_3:  NADH  24.3      37 0.00081   10.0   0.4    9    6-14     13-21  (41)
238 COG4830 RPS26B Ribosomal prote  24.3      56  0.0012   12.1   0.8   12    6-17     20-31  (108)
239 KOG1280|consensus               24.2      93   0.002   14.5   1.9   25    6-30     79-103 (381)
240 KOG0227|consensus               24.1      49  0.0011   13.9   0.7   21    6-26     53-73  (222)
241 smart00064 FYVE Protein presen  24.0      44 0.00095   10.6   0.6   12    6-17     26-37  (68)
242 PHA00689 hypothetical protein   24.0      43 0.00094   10.6   0.6   13    5-17     16-28  (62)
243 PF02891 zf-MIZ:  MIZ/SP-RING z  24.0      33 0.00072   10.5   0.2    7    7-13     42-48  (50)
244 PF08274 PhnA_Zn_Ribbon:  PhnA   24.0      35 0.00076    9.5   0.5    8    7-14     20-27  (30)
245 KOG4118|consensus               23.9      50  0.0011   11.2   1.1   21    7-27     39-59  (74)
246 PF05180 zf-DNL:  DNL zinc fing  23.6      46 0.00099   11.2   0.5    9    7-15      5-13  (66)
247 PF10609 ParA:  ParA/MinD ATPas  23.6      43 0.00092   11.7   0.5   10    6-15     65-74  (81)
248 PRK03976 rpl37ae 50S ribosomal  23.5      49  0.0011   11.9   0.6   10    7-16     55-64  (90)
249 PF06524 NOA36:  NOA36 protein;  23.5      13 0.00027   16.2  -0.9   24    5-28    208-231 (314)
250 PLN00032 DNA-directed RNA poly  23.3      49  0.0011   11.4   0.6   15    5-19      3-17  (71)
251 KOG3456|consensus               23.0      38 0.00083   12.7   0.3   13    6-18    104-116 (120)
252 PF00130 C1_1:  Phorbol esters/  22.7      42 0.00091   10.0   0.9   12    5-16     10-21  (53)
253 COG4068 Uncharacterized protei  22.6      42  0.0009   11.1   0.4   10    8-17     10-19  (64)
254 PF11672 DUF3268:  Protein of u  22.5      46   0.001   12.2   0.5    9    6-14      2-10  (102)
255 cd02336 ZZ_RSC8 Zinc finger, Z  22.5      41  0.0009   10.2   0.3    7    8-14      2-8   (45)
256 PRK12860 transcriptional activ  22.4      80  0.0017   13.1   1.3   10    8-17    136-145 (189)
257 TIGR03826 YvyF flagellar opero  22.1      31 0.00068   13.3   0.1   11    8-18      5-15  (137)
258 PF10058 DUF2296:  Predicted in  21.9      50  0.0011   10.5   0.6    8    6-13     44-51  (54)
259 PF04032 Rpr2:  RNAse P Rpr2/Rp  21.9      50  0.0011   11.0   0.5    7    7-13     78-84  (85)
260 PRK00564 hypA hydrogenase nick  21.8      48   0.001   12.3   0.5   12    7-18     72-83  (117)
261 PF03966 Trm112p:  Trm112p-like  21.8      52  0.0011   10.7   0.7   12    6-17     53-64  (68)
262 PF09665 RE_Alw26IDE:  Type II   21.8      43 0.00093   16.1   0.4    8    9-16     85-92  (511)
263 PRK12380 hydrogenase nickel in  21.7      54  0.0012   12.1   0.6   12    7-18     71-82  (113)
264 PTZ00157 60S ribosomal protein  21.2      52  0.0011   11.7   0.5   10    7-16     70-79  (84)
265 COG3024 Uncharacterized protei  21.2      50  0.0011   11.2   0.4   11    7-17      8-18  (65)
266 KOG1813|consensus               21.1      50  0.0011   14.8   0.5   14    5-18    240-253 (313)
267 TIGR02159 PA_CoA_Oxy4 phenylac  21.0      23  0.0005   13.7  -0.4   10    7-16    131-140 (146)
268 PRK05767 rpl44e 50S ribosomal   21.0      49  0.0011   12.0   0.4   10    7-16     68-77  (92)
269 PF02591 DUF164:  Putative zinc  21.0      50  0.0011   10.2   1.1    9    6-14     46-54  (56)
270 COG1571 Predicted DNA-binding   20.8      75  0.0016   15.0   1.0   15    4-18    365-379 (421)
271 COG1644 RPB10 DNA-directed RNA  20.8      56  0.0012   11.0   0.5   15    5-19      3-17  (63)
272 PF04570 DUF581:  Protein of un  20.8      26 0.00057   11.4  -0.2   10    8-17     18-27  (58)
273 TIGR00340 zpr1_rel ZPR1-relate  20.7      61  0.0013   13.0   0.7   10    6-15     28-37  (163)
274 PF05864 Chordopox_RPO7:  Chord  20.7      53  0.0012   10.8   0.5   14    6-19      4-17  (63)
275 PF01396 zf-C4_Topoisom:  Topoi  20.7      33 0.00072    9.9   0.0    8    8-15      3-10  (39)
276 KOG3497|consensus               20.4      60  0.0013   10.9   0.7   15    5-19      3-17  (69)
277 PRK12722 transcriptional activ  20.4      91   0.002   12.9   1.3    8    9-16    137-144 (187)
278 PF05766 NinG:  Bacteriophage L  20.3      36 0.00078   14.0   0.1   15    5-19      5-19  (189)
279 COG4332 Uncharacterized protei  20.1      62  0.0014   13.5   0.7   10    7-16     50-59  (203)
280 TIGR01384 TFS_arch transcripti  20.0      61  0.0013   11.4   0.6    9    7-15     91-99  (104)

No 1  
>KOG2462|consensus
Probab=99.70  E-value=1.8e-17  Score=63.68  Aligned_cols=38  Identities=21%  Similarity=0.517  Sum_probs=35.7

Q ss_pred             CCCCcceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           1 MDPTYLYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         1 h~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      |+||+||.|..|+++|..+++|+.|+++|.+.|+|+|.
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~  247 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCP  247 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCc
Confidence            78999999999999999999999999999999999985


No 2  
>KOG3623|consensus
Probab=99.56  E-value=1.2e-15  Score=64.69  Aligned_cols=38  Identities=34%  Similarity=0.709  Sum_probs=36.6

Q ss_pred             CCCCcceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           1 MDPTYLYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         1 h~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      |+|++||.|..|.++|.++-.|..|.|.|.|||||.|.
T Consensus       917 HsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCd  954 (1007)
T KOG3623|consen  917 HSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCD  954 (1007)
T ss_pred             hcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhh
Confidence            78999999999999999999999999999999999984


No 3  
>KOG2462|consensus
Probab=99.49  E-value=1.1e-14  Score=56.24  Aligned_cols=34  Identities=41%  Similarity=0.737  Sum_probs=32.1

Q ss_pred             cceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      -++.|..|++.|....-|+.|+|+|+|||||.|.
T Consensus       186 l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~  219 (279)
T KOG2462|consen  186 LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCP  219 (279)
T ss_pred             CCcccccccccccchHHhhcccccccCCCCccCC
Confidence            4789999999999999999999999999999996


No 4  
>PHA00616 hypothetical protein
Probab=99.41  E-value=9.2e-14  Score=41.69  Aligned_cols=33  Identities=15%  Similarity=0.328  Sum_probs=30.9

Q ss_pred             ceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      ||.|..|++.|.+.+.+..|++.+++++++.|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            688999999999999999999999999998775


No 5  
>KOG3623|consensus
Probab=99.32  E-value=5e-13  Score=57.16  Aligned_cols=35  Identities=37%  Similarity=0.794  Sum_probs=32.8

Q ss_pred             CcceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           4 TYLYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      -+.|.|.+|+++|..+-.|..|.|+|.|||||.|+
T Consensus       279 lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCp  313 (1007)
T KOG3623|consen  279 LRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECP  313 (1007)
T ss_pred             hccccccccchhhhhHHHHHhhheeecCCCCcCCc
Confidence            35689999999999999999999999999999996


No 6  
>PHA02768 hypothetical protein; Provisional
Probab=99.17  E-value=3.3e-11  Score=37.65  Aligned_cols=30  Identities=23%  Similarity=0.449  Sum_probs=25.8

Q ss_pred             ceeccccccccccchhHHHHhHHhcCCCCccC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHTGEKPFVC   37 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c   37 (39)
                      .|.|..|++.|.....|..|++.|+  ++++|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc   34 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKL   34 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccC
Confidence            4789999999999999999999999  34444


No 7  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.95  E-value=1.1e-09  Score=29.72  Aligned_cols=19  Identities=58%  Similarity=1.375  Sum_probs=16.6

Q ss_pred             hHHHHhHHhcCCCCccCCC
Q psy4412          21 HMRDHIRRHTGEKPFVCPF   39 (39)
Q Consensus        21 ~~~~~~~~~~~~~~~~c~~   39 (39)
                      +|..|++.|++++||.|++
T Consensus         1 ~l~~H~~~H~~~k~~~C~~   19 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPY   19 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCC
Confidence            4788999999999999974


No 8  
>KOG1074|consensus
Probab=98.90  E-value=5.5e-10  Score=48.73  Aligned_cols=33  Identities=15%  Similarity=0.383  Sum_probs=27.4

Q ss_pred             CCCCcceeccccccccccchhHHHHhHHhcCCC
Q psy4412           1 MDPTYLYACLWCDYHTLNSGHMRDHIRRHTGEK   33 (39)
Q Consensus         1 h~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~   33 (39)
                      |+|++||.|..|+++|..+.+|+.|+.+|...-
T Consensus       628 HtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p  660 (958)
T KOG1074|consen  628 HTGERPFKCKICGRAFTTKGNLKAHMSVHKAKP  660 (958)
T ss_pred             ccCcCccccccccchhccccchhhcccccccCc
Confidence            678889999999999988888888888776553


No 9  
>KOG3576|consensus
Probab=98.89  E-value=2.2e-10  Score=43.68  Aligned_cols=33  Identities=27%  Similarity=0.646  Sum_probs=23.7

Q ss_pred             ceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      -+-|..|+++|...-+|..|.++|+|.+||+|.
T Consensus       145 r~lct~cgkgfndtfdlkrh~rthtgvrpykc~  177 (267)
T KOG3576|consen  145 RHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCS  177 (267)
T ss_pred             HHHHhhccCcccchhhhhhhhccccCccccchh
Confidence            355667777777777777777777777777774


No 10 
>KOG1074|consensus
Probab=98.87  E-value=8.3e-10  Score=48.22  Aligned_cols=33  Identities=33%  Similarity=0.715  Sum_probs=28.9

Q ss_pred             eeccccccccccchhHHHHhHHhcCCCCccCCC
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRHTGEKPFVCPF   39 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~~   39 (39)
                      .+|..|.+.|...+.|..|.|.|+||+||+|.+
T Consensus       354 hkCr~CakvfgS~SaLqiHlRSHTGERPfqCnv  386 (958)
T KOG1074|consen  354 HKCRFCAKVFGSDSALQIHLRSHTGERPFQCNV  386 (958)
T ss_pred             chhhhhHhhcCchhhhhhhhhccCCCCCeeecc
Confidence            578899999999999999999999999999864


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.84  E-value=1.1e-09  Score=29.77  Aligned_cols=17  Identities=18%  Similarity=0.360  Sum_probs=15.4

Q ss_pred             CCCCcceeccccccccc
Q psy4412           1 MDPTYLYACLWCDYHTL   17 (39)
Q Consensus         1 h~~~~~~~c~~c~~~~~   17 (39)
                      |++++||.|..|++.|.
T Consensus         9 H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    9 HTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HSSSSSEEESSSSEEES
T ss_pred             cCCCCCCCCCCCcCeeC
Confidence            67999999999999885


No 12 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.76  E-value=1.3e-08  Score=26.65  Aligned_cols=23  Identities=30%  Similarity=0.746  Sum_probs=20.6

Q ss_pred             eeccccccccccchhHHHHhHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57999999999999999998764


No 13 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.70  E-value=1.4e-08  Score=27.50  Aligned_cols=25  Identities=24%  Similarity=0.446  Sum_probs=22.5

Q ss_pred             ceeccccccccccchhHHHHhHHhc
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      |+.|..|++.|.....+..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5889999999999999999988764


No 14 
>PHA00733 hypothetical protein
Probab=98.58  E-value=1.1e-07  Score=34.13  Aligned_cols=34  Identities=32%  Similarity=0.557  Sum_probs=27.6

Q ss_pred             CCcceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           3 PTYLYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         3 ~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      +.+||.|..|++.|.....+..|++.+  +.++.|.
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            467899999999999999999998865  3456664


No 15 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.44  E-value=3.9e-07  Score=23.59  Aligned_cols=23  Identities=26%  Similarity=0.673  Sum_probs=18.7

Q ss_pred             eeccccccccccchhHHHHhHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      |.|..|+..|.....+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            57999999999999999998765


No 16 
>KOG3576|consensus
Probab=98.40  E-value=1.3e-07  Score=36.43  Aligned_cols=30  Identities=13%  Similarity=0.343  Sum_probs=26.1

Q ss_pred             CCCCcceeccccccccccchhHHHHhHHhc
Q psy4412           1 MDPTYLYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         1 h~~~~~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      |+|.+||.|..|+++|.++-.|..|.+...
T Consensus       168 htgvrpykc~~c~kaftqrcsleshl~kvh  197 (267)
T KOG3576|consen  168 HTGVRPYKCSLCEKAFTQRCSLESHLKKVH  197 (267)
T ss_pred             ccCccccchhhhhHHHHhhccHHHHHHHHc
Confidence            679999999999999999999988876443


No 17 
>smart00355 ZnF_C2H2 zinc finger.
Probab=98.29  E-value=1.2e-06  Score=22.91  Aligned_cols=24  Identities=25%  Similarity=0.549  Sum_probs=20.6

Q ss_pred             eeccccccccccchhHHHHhHHhc
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            468999999999999999988654


No 18 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.25  E-value=4e-06  Score=26.06  Aligned_cols=32  Identities=22%  Similarity=0.323  Sum_probs=23.0

Q ss_pred             CCcceeccccccccccchhHHHHhHHhcCCCC
Q psy4412           3 PTYLYACLWCDYHTLNSGHMRDHIRRHTGEKP   34 (39)
Q Consensus         3 ~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~   34 (39)
                      .+.|-.|..|+..+.+..+|..|+....+.||
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45678999999999999999999988887775


No 19 
>KOG3608|consensus
Probab=98.06  E-value=4.2e-06  Score=34.67  Aligned_cols=37  Identities=16%  Similarity=0.474  Sum_probs=24.7

Q ss_pred             CCCCcceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           1 MDPTYLYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         1 h~~~~~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      |+..+|+.|+.|...+...++|..|...|+ +..|.|.
T Consensus       287 Hs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~  323 (467)
T KOG3608|consen  287 HSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCE  323 (467)
T ss_pred             hccCCCccccchhhhhccHHHHHHHHHhcc-ccceecC
Confidence            345677777777777777777777776665 4445553


No 20 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=98.05  E-value=4.9e-06  Score=21.93  Aligned_cols=23  Identities=22%  Similarity=0.570  Sum_probs=20.0

Q ss_pred             eeccccccccccchhHHHHhHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      |.|..|...|.....+..|.+.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999998654


No 21 
>PHA00732 hypothetical protein
Probab=98.05  E-value=6.2e-06  Score=27.62  Aligned_cols=26  Identities=31%  Similarity=0.681  Sum_probs=21.8

Q ss_pred             ceeccccccccccchhHHHHhHH-hcC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRR-HTG   31 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~-~~~   31 (39)
                      ||.|..|++.|.....+..|++. |.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC
Confidence            57899999999999999999874 543


No 22 
>PRK04860 hypothetical protein; Provisional
Probab=97.82  E-value=4.2e-05  Score=28.63  Aligned_cols=29  Identities=31%  Similarity=0.599  Sum_probs=24.7

Q ss_pred             ceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      +|.|. |+.   ....+..|.+++.++++|.|.
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~  147 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCR  147 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECC
Confidence            68897 876   566789999999999999985


No 23 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.52  E-value=0.00014  Score=18.91  Aligned_cols=22  Identities=36%  Similarity=0.982  Sum_probs=15.8

Q ss_pred             eeccccccccccchhHHHHhHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      |.|..|..... ...+..|++.+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            57889987776 77888888765


No 24 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.35  E-value=3.9e-05  Score=20.67  Aligned_cols=22  Identities=18%  Similarity=0.523  Sum_probs=18.2

Q ss_pred             eeccccccccccchhHHHHhHH
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      |.|..|++.|.....+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5799999999999888877653


No 25 
>KOG3608|consensus
Probab=97.34  E-value=0.00032  Score=29.53  Aligned_cols=33  Identities=39%  Similarity=0.885  Sum_probs=25.7

Q ss_pred             ceeccccccccccchhHHHHhH-HhcCCCCccCC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR-RHTGEKPFVCP   38 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~-~~~~~~~~~c~   38 (39)
                      .|.|..|.-+....++|..|++ -|...+||+|.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd  296 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCD  296 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCcccc
Confidence            4678888888888888888887 45567899885


No 26 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.28  E-value=0.00037  Score=30.66  Aligned_cols=31  Identities=16%  Similarity=0.309  Sum_probs=14.1

Q ss_pred             ceeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      ++.|. |+..+ ....+..|...+...+++.|.
T Consensus       478 pv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~  508 (567)
T PLN03086        478 PLQCP-CGVVL-EKEQMVQHQASTCPLRLITCR  508 (567)
T ss_pred             CccCC-CCCCc-chhHHHhhhhccCCCCceeCC
Confidence            33444 44322 334444555555555555553


No 27 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=97.14  E-value=0.00056  Score=19.17  Aligned_cols=22  Identities=14%  Similarity=0.409  Sum_probs=18.2

Q ss_pred             ceeccccccccccchhHHHHhH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      ++.|..|...|.....+..|..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5789999999998887777764


No 28 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.02  E-value=0.0018  Score=20.15  Aligned_cols=33  Identities=27%  Similarity=0.735  Sum_probs=21.8

Q ss_pred             ceeccccccccccchhHHHHhHH-hcCC-CCccCCC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRR-HTGE-KPFVCPF   39 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~-~~~~-~~~~c~~   39 (39)
                      .|.|+.|++ ......|..|... |..+ +.+.|++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPi   36 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPI   36 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCC
Confidence            477888998 5556778888654 3332 4567753


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.85  E-value=0.0018  Score=21.84  Aligned_cols=24  Identities=17%  Similarity=0.588  Sum_probs=20.7

Q ss_pred             ceeccccccccccchhHHHHhHHh
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      .+.|..|+..|.....+..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            478999999999999999999865


No 30 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.75  E-value=0.0003  Score=29.24  Aligned_cols=24  Identities=25%  Similarity=0.362  Sum_probs=20.5

Q ss_pred             CCcceeccccccccccchhHHHHh
Q psy4412           3 PTYLYACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         3 ~~~~~~c~~c~~~~~~~~~~~~~~   26 (39)
                      ..+||.|.+|++.+.....|..|.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCCceeccccchhhccCccceecc
Confidence            358999999999999988887764


No 31 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=96.46  E-value=0.0059  Score=27.26  Aligned_cols=36  Identities=22%  Similarity=0.387  Sum_probs=27.1

Q ss_pred             CCCcceecccccccccc----------chhHHHHhHHhcCCCCccCC
Q psy4412           2 DPTYLYACLWCDYHTLN----------SGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         2 ~~~~~~~c~~c~~~~~~----------~~~~~~~~~~~~~~~~~~c~   38 (39)
                      ..++++.|..|+..+..          ...+..|.... +.+++.|.
T Consensus       500 Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~  545 (567)
T PLN03086        500 CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCD  545 (567)
T ss_pred             CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEcc
Confidence            35788999999988742          24688887774 88888884


No 32 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.43  E-value=0.0042  Score=16.51  Aligned_cols=20  Identities=15%  Similarity=0.378  Sum_probs=14.5

Q ss_pred             eeccccccccccchhHHHHhH
Q psy4412           7 YACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      ..|..|+..|. ...+..|..
T Consensus         3 ~~C~~CgR~F~-~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKFN-PDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEEC-HHHHHHHHH
Confidence            46889999994 555777754


No 33 
>KOG3993|consensus
Probab=95.66  E-value=0.0067  Score=26.39  Aligned_cols=25  Identities=28%  Similarity=0.440  Sum_probs=22.3

Q ss_pred             ceeccccccccccchhHHHHhHHhc
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      -|.|.+|++.|.-..+|..|.|.|.
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccC
Confidence            5899999999999999999988774


No 34 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=95.26  E-value=0.0069  Score=23.99  Aligned_cols=28  Identities=18%  Similarity=0.273  Sum_probs=20.7

Q ss_pred             CcceeccccccccccchhHHHHhHHhcC
Q psy4412           4 TYLYACLWCDYHTLNSGHMRDHIRRHTG   31 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~~~~~~~~~~~   31 (39)
                      +..|.|..|++.|.-...+.+|+..-+.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            3458999999999999999999875543


No 35 
>KOG3993|consensus
Probab=95.03  E-value=0.014  Score=25.53  Aligned_cols=26  Identities=19%  Similarity=0.402  Sum_probs=22.3

Q ss_pred             cceeccccccccccchhHHHHhHHhc
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      .-|.|..|++.|.....|+.|+..|.
T Consensus       355 gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  355 GIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             ceeecHHhhhhhHHHHHHHHhHHhhh
Confidence            46899999999999999999976654


No 36 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.01  E-value=0.019  Score=18.39  Aligned_cols=25  Identities=12%  Similarity=0.208  Sum_probs=20.7

Q ss_pred             CCcceeccccccccccchhHHHHhH
Q psy4412           3 PTYLYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         3 ~~~~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      |+.-+.|..|+..|....+...|..
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhh
Confidence            6667899999999988888877754


No 37 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=94.04  E-value=0.091  Score=18.56  Aligned_cols=26  Identities=38%  Similarity=0.719  Sum_probs=21.1

Q ss_pred             ceec----cccccccccchhHHHHhHHhcC
Q psy4412           6 LYAC----LWCDYHTLNSGHMRDHIRRHTG   31 (39)
Q Consensus         6 ~~~c----~~c~~~~~~~~~~~~~~~~~~~   31 (39)
                      .|.|    ..|+........+..|.+...+
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3678    8899988999999999886643


No 38 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=93.57  E-value=0.076  Score=19.78  Aligned_cols=23  Identities=30%  Similarity=0.638  Sum_probs=14.4

Q ss_pred             eeccccccccccchhHHHHhHHhcCC
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRHTGE   32 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~~~~   32 (39)
                      ..|.+||+.|..   |..|.+.|.|-
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eEEccCCcccch---HHHHHHHccCC
Confidence            579999998866   57888888654


No 39 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=92.20  E-value=0.04  Score=15.23  Aligned_cols=19  Identities=16%  Similarity=0.494  Sum_probs=11.2

Q ss_pred             eeccccccccccchhHHHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~   26 (39)
                      +.|..|++.|. ......|.
T Consensus         1 ~sCiDC~~~F~-~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDFD-GDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEEE-GGGTTT--
T ss_pred             CeeecCCCCcC-cCCcCCCC
Confidence            46888999884 33344443


No 40 
>KOG2482|consensus
Probab=91.49  E-value=0.19  Score=21.80  Aligned_cols=23  Identities=22%  Similarity=0.748  Sum_probs=20.3

Q ss_pred             eeccccccccccchhHHHHhHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      +.|.-|.+.|..+..|..|++..
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhc
Confidence            57999999999999999998743


No 41 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.33  E-value=0.2  Score=14.05  Aligned_cols=9  Identities=44%  Similarity=1.173  Sum_probs=4.2

Q ss_pred             eeccccccc
Q psy4412           7 YACLWCDYH   15 (39)
Q Consensus         7 ~~c~~c~~~   15 (39)
                      |.|..|+..
T Consensus         2 ~~C~~CGy~   10 (33)
T cd00350           2 YVCPVCGYI   10 (33)
T ss_pred             EECCCCCCE
Confidence            345555543


No 42 
>KOG3408|consensus
Probab=90.32  E-value=0.26  Score=18.32  Aligned_cols=24  Identities=13%  Similarity=0.439  Sum_probs=20.0

Q ss_pred             cceeccccccccccchhHHHHhHH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      ..|-|..|.+-|.....+..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            357899999999999999888664


No 43 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.23  E-value=0.33  Score=18.87  Aligned_cols=10  Identities=30%  Similarity=1.055  Sum_probs=6.8

Q ss_pred             ceeccccccc
Q psy4412           6 LYACLWCDYH   15 (39)
Q Consensus         6 ~~~c~~c~~~   15 (39)
                      -|.|.+||..
T Consensus       134 ~~vC~vCGy~  143 (166)
T COG1592         134 VWVCPVCGYT  143 (166)
T ss_pred             EEEcCCCCCc
Confidence            3678888753


No 44 
>KOG4167|consensus
Probab=89.38  E-value=0.08  Score=24.96  Aligned_cols=25  Identities=16%  Similarity=0.445  Sum_probs=20.9

Q ss_pred             ceeccccccccccchhHHHHhHHhc
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      -|.|.+|++-|..-.++..|++.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3789999999988888888888775


No 45 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.37  E-value=0.2  Score=20.92  Aligned_cols=32  Identities=38%  Similarity=0.773  Sum_probs=16.5

Q ss_pred             eeccccccccccchhHHHHhH--HhcCC--CCccCC
Q psy4412           7 YACLWCDYHTLNSGHMRDHIR--RHTGE--KPFVCP   38 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~--~~~~~--~~~~c~   38 (39)
                      +.|..|...+.....+..|.+  .|.++  +++.|.
T Consensus       290 ~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p  325 (467)
T COG5048         290 IKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCP  325 (467)
T ss_pred             CCCccccCCccccccccccccccccccccCCceeee
Confidence            344455555555555555555  45555  555443


No 46 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.33  E-value=0.29  Score=14.00  Aligned_cols=15  Identities=20%  Similarity=0.151  Sum_probs=10.7

Q ss_pred             ceeccccccccccch
Q psy4412           6 LYACLWCDYHTLNSG   20 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~   20 (39)
                      .|.|..|+..|....
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            378999998775443


No 47 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.22  E-value=0.36  Score=14.30  Aligned_cols=16  Identities=19%  Similarity=0.171  Sum_probs=11.3

Q ss_pred             ceeccccccccccchh
Q psy4412           6 LYACLWCDYHTLNSGH   21 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~   21 (39)
                      .|.|..|+..|.....
T Consensus         5 ey~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQS   20 (42)
T ss_pred             EEEeCCCCCEEEEEEE
Confidence            3789999987765443


No 48 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=85.34  E-value=0.48  Score=12.72  Aligned_cols=10  Identities=30%  Similarity=0.697  Sum_probs=6.8

Q ss_pred             eccccccccc
Q psy4412           8 ACLWCDYHTL   17 (39)
Q Consensus         8 ~c~~c~~~~~   17 (39)
                      .|..||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5777877664


No 49 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=84.67  E-value=0.56  Score=14.26  Aligned_cols=15  Identities=20%  Similarity=0.239  Sum_probs=10.4

Q ss_pred             ceeccccccccccch
Q psy4412           6 LYACLWCDYHTLNSG   20 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~   20 (39)
                      -|.|..|+..|....
T Consensus         5 ey~C~~Cg~~fe~~~   19 (52)
T TIGR02605         5 EYRCTACGHRFEVLQ   19 (52)
T ss_pred             EEEeCCCCCEeEEEE
Confidence            367888888775543


No 50 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=84.54  E-value=0.83  Score=17.40  Aligned_cols=24  Identities=25%  Similarity=0.425  Sum_probs=17.6

Q ss_pred             eccccccccccchhHHHHhHHhcCCCC
Q psy4412           8 ACLWCDYHTLNSGHMRDHIRRHTGEKP   34 (39)
Q Consensus         8 ~c~~c~~~~~~~~~~~~~~~~~~~~~~   34 (39)
                      .|.++|+.|.   +|..|..+|.+..|
T Consensus        78 icLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEeccCcchH---HHHHHHhcccCCCH
Confidence            5888888775   48888888776543


No 51 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=84.07  E-value=0.5  Score=14.00  Aligned_cols=15  Identities=13%  Similarity=0.306  Sum_probs=9.1

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      .|+.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478899999888643


No 52 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=83.64  E-value=0.76  Score=13.47  Aligned_cols=14  Identities=14%  Similarity=0.335  Sum_probs=10.9

Q ss_pred             ceeccccccccccc
Q psy4412           6 LYACLWCDYHTLNS   19 (39)
Q Consensus         6 ~~~c~~c~~~~~~~   19 (39)
                      |+.|..|+..|...
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899998887643


No 53 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=82.93  E-value=1.2  Score=13.58  Aligned_cols=21  Identities=29%  Similarity=0.673  Sum_probs=14.8

Q ss_pred             eeccccccccccc-----hhHHHHhH
Q psy4412           7 YACLWCDYHTLNS-----GHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~-----~~~~~~~~   27 (39)
                      -.|..|++.+...     +.|..|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4688898877554     46777776


No 54 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=82.74  E-value=0.96  Score=16.12  Aligned_cols=13  Identities=15%  Similarity=0.026  Sum_probs=10.6

Q ss_pred             cceeccccccccc
Q psy4412           5 YLYACLWCDYHTL   17 (39)
Q Consensus         5 ~~~~c~~c~~~~~   17 (39)
                      .+..|..|+.-|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            5789999998775


No 55 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=81.72  E-value=1.1  Score=17.68  Aligned_cols=15  Identities=13%  Similarity=0.135  Sum_probs=11.6

Q ss_pred             Ccceecccccccccc
Q psy4412           4 TYLYACLWCDYHTLN   18 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~   18 (39)
                      .+|..|.+|+.-|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            468899999987753


No 56 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=81.58  E-value=0.72  Score=17.38  Aligned_cols=15  Identities=13%  Similarity=0.175  Sum_probs=10.3

Q ss_pred             ceeccccccccccch
Q psy4412           6 LYACLWCDYHTLNSG   20 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~   20 (39)
                      |+.|..|++.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            456788888776544


No 57 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=81.00  E-value=0.99  Score=11.99  Aligned_cols=9  Identities=22%  Similarity=0.940  Sum_probs=6.3

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      .|.|..|++
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            577887763


No 58 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=80.81  E-value=1  Score=18.10  Aligned_cols=19  Identities=11%  Similarity=0.067  Sum_probs=14.0

Q ss_pred             CcceeccccccccccchhH
Q psy4412           4 TYLYACLWCDYHTLNSGHM   22 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~~   22 (39)
                      ++...|+.|++.|....-.
T Consensus         3 ~k~~~CPvC~~~F~~~~vr   21 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVR   21 (214)
T ss_pred             CCceECCCCCCeeeeeEEE
Confidence            3567899999988766433


No 59 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=79.14  E-value=1.3  Score=13.87  Aligned_cols=17  Identities=12%  Similarity=0.192  Sum_probs=12.1

Q ss_pred             Ccceeccccccccccch
Q psy4412           4 TYLYACLWCDYHTLNSG   20 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~   20 (39)
                      .+.+.|..|+..|.-..
T Consensus         2 Dk~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTA   18 (49)
T ss_pred             CeeEEcccCCCeEEEeh
Confidence            35678999998775544


No 60 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=77.62  E-value=1.3  Score=12.78  Aligned_cols=12  Identities=25%  Similarity=0.451  Sum_probs=5.7

Q ss_pred             eccccccccccc
Q psy4412           8 ACLWCDYHTLNS   19 (39)
Q Consensus         8 ~c~~c~~~~~~~   19 (39)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            688888877543


No 61 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=77.45  E-value=1.3  Score=12.98  Aligned_cols=11  Identities=27%  Similarity=0.767  Sum_probs=6.0

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      -|.|..|++..
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            47899998754


No 62 
>PHA00626 hypothetical protein
Probab=76.40  E-value=2.2  Score=13.86  Aligned_cols=14  Identities=29%  Similarity=0.601  Sum_probs=11.0

Q ss_pred             cceecccccccccc
Q psy4412           5 YLYACLWCDYHTLN   18 (39)
Q Consensus         5 ~~~~c~~c~~~~~~   18 (39)
                      ..|.|..|+..|..
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            46899999987754


No 63 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=75.96  E-value=2.4  Score=13.50  Aligned_cols=16  Identities=6%  Similarity=-0.132  Sum_probs=8.7

Q ss_pred             cceeccccccccccch
Q psy4412           5 YLYACLWCDYHTLNSG   20 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~   20 (39)
                      .|+....|+..|....
T Consensus        23 ~PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   23 DPVKSKKCGHTFEKEA   38 (57)
T ss_dssp             SEEEESSS--EEEHHH
T ss_pred             CCcCcCCCCCeecHHH
Confidence            4666677777775443


No 64 
>KOG2071|consensus
Probab=75.81  E-value=3.2  Score=19.59  Aligned_cols=26  Identities=19%  Similarity=0.267  Sum_probs=19.9

Q ss_pred             cceeccccccccccchhHHHHhHHhc
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      .|-.|..||..|........++..|.
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhhhhh
Confidence            45679999999988887777666553


No 65 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=75.75  E-value=1.9  Score=12.22  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=8.2

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .|.|..|+..+.
T Consensus         2 ~~~C~~CG~i~~   13 (34)
T cd00729           2 VWVCPVCGYIHE   13 (34)
T ss_pred             eEECCCCCCEeE
Confidence            367888887543


No 66 
>KOG2893|consensus
Probab=74.91  E-value=0.42  Score=19.86  Aligned_cols=17  Identities=12%  Similarity=0.481  Sum_probs=7.2

Q ss_pred             eeccccccccccchhHH
Q psy4412           7 YACLWCDYHTLNSGHMR   23 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~   23 (39)
                      |.|..|.+-+..-..|.
T Consensus        35 fkchichkkl~sgpgls   51 (341)
T KOG2893|consen   35 FKCHICHKKLFSGPGLS   51 (341)
T ss_pred             ceeeeehhhhccCCCce
Confidence            44444444443333333


No 67 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=74.05  E-value=1.5  Score=13.58  Aligned_cols=12  Identities=17%  Similarity=0.376  Sum_probs=6.0

Q ss_pred             eccccccccccc
Q psy4412           8 ACLWCDYHTLNS   19 (39)
Q Consensus         8 ~c~~c~~~~~~~   19 (39)
                      .|++|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999887543


No 68 
>KOG0717|consensus
Probab=73.45  E-value=3.5  Score=19.08  Aligned_cols=21  Identities=14%  Similarity=0.447  Sum_probs=17.3

Q ss_pred             eeccccccccccchhHHHHhH
Q psy4412           7 YACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      +-|..|.++|.....+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            569999999998888877754


No 69 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=73.17  E-value=2.2  Score=11.32  Aligned_cols=18  Identities=17%  Similarity=0.407  Sum_probs=10.8

Q ss_pred             eccccccccccchhHHHHh
Q psy4412           8 ACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         8 ~c~~c~~~~~~~~~~~~~~   26 (39)
                      .|..|.+.+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            577888776 334444543


No 70 
>PTZ00448 hypothetical protein; Provisional
Probab=72.50  E-value=3.9  Score=18.26  Aligned_cols=23  Identities=17%  Similarity=0.576  Sum_probs=17.0

Q ss_pred             ceeccccccccccchhHHHHhHH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      .+.|..|.-.|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            46799999888766666666553


No 71 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=72.44  E-value=2.8  Score=12.20  Aligned_cols=22  Identities=18%  Similarity=0.424  Sum_probs=12.3

Q ss_pred             cceeccccccccccc----hhHHHHh
Q psy4412           5 YLYACLWCDYHTLNS----GHMRDHI   26 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~----~~~~~~~   26 (39)
                      .-..|..|++.+...    +.|..|+
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            345789999877553    4566666


No 72 
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.46  E-value=1.6  Score=15.05  Aligned_cols=12  Identities=25%  Similarity=0.451  Sum_probs=9.0

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .|.|..|+..|-
T Consensus        12 ~Y~c~~cg~~~d   23 (82)
T COG2331          12 SYECTECGNRFD   23 (82)
T ss_pred             EEeecccchHHH
Confidence            478999987653


No 73 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=70.73  E-value=3.2  Score=12.27  Aligned_cols=24  Identities=17%  Similarity=0.231  Sum_probs=15.3

Q ss_pred             eecccccccccc--chhHHHHhHHhc
Q psy4412           7 YACLWCDYHTLN--SGHMRDHIRRHT   30 (39)
Q Consensus         7 ~~c~~c~~~~~~--~~~~~~~~~~~~   30 (39)
                      -.|..|+-.+..  ..+...|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            478899876643  345566666553


No 74 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=70.03  E-value=2.3  Score=12.94  Aligned_cols=14  Identities=14%  Similarity=0.162  Sum_probs=10.2

Q ss_pred             eccccccccccchh
Q psy4412           8 ACLWCDYHTLNSGH   21 (39)
Q Consensus         8 ~c~~c~~~~~~~~~   21 (39)
                      .|..|+..|.-...
T Consensus        10 ~C~~C~rpf~WRKK   23 (42)
T PF10013_consen   10 ICPVCGRPFTWRKK   23 (42)
T ss_pred             cCcccCCcchHHHH
Confidence            58899988865443


No 75 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=69.57  E-value=2.4  Score=15.48  Aligned_cols=14  Identities=14%  Similarity=0.173  Sum_probs=10.2

Q ss_pred             ceeccccccccccc
Q psy4412           6 LYACLWCDYHTLNS   19 (39)
Q Consensus         6 ~~~c~~c~~~~~~~   19 (39)
                      |..|..|+..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            56788888877663


No 76 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=69.32  E-value=2.6  Score=13.57  Aligned_cols=13  Identities=23%  Similarity=0.480  Sum_probs=8.9

Q ss_pred             ceecccccccccc
Q psy4412           6 LYACLWCDYHTLN   18 (39)
Q Consensus         6 ~~~c~~c~~~~~~   18 (39)
                      .+.|..|+..|--
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            4678888876643


No 77 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=69.23  E-value=5.9  Score=14.69  Aligned_cols=24  Identities=21%  Similarity=0.243  Sum_probs=15.2

Q ss_pred             ceeccccccccccchhHHHHhHHh
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      .|.|..|.+.|...-++-.|...|
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhcc
Confidence            366777777777666666555444


No 78 
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=68.47  E-value=3.1  Score=15.86  Aligned_cols=14  Identities=14%  Similarity=-0.026  Sum_probs=10.8

Q ss_pred             cceecccccccccc
Q psy4412           5 YLYACLWCDYHTLN   18 (39)
Q Consensus         5 ~~~~c~~c~~~~~~   18 (39)
                      ++..|..|+..|.-
T Consensus       111 ~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  111 KPQRCPECGQVFKL  124 (136)
T ss_dssp             SEEEETTTEEEEEE
T ss_pred             CccCCCCCCeEEEE
Confidence            57889999987753


No 79 
>PLN02748 tRNA dimethylallyltransferase
Probab=68.33  E-value=5.5  Score=18.33  Aligned_cols=24  Identities=17%  Similarity=0.237  Sum_probs=17.3

Q ss_pred             Ccceecccccc-ccccchhHHHHhH
Q psy4412           4 TYLYACLWCDY-HTLNSGHMRDHIR   27 (39)
Q Consensus         4 ~~~~~c~~c~~-~~~~~~~~~~~~~   27 (39)
                      ++.|.|..|+. .+.....+..|..
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhc
Confidence            35678999997 6776666666654


No 80 
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=67.48  E-value=3.7  Score=17.20  Aligned_cols=15  Identities=33%  Similarity=0.620  Sum_probs=11.3

Q ss_pred             Ccceecccccccccc
Q psy4412           4 TYLYACLWCDYHTLN   18 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~   18 (39)
                      .++..|..|+.-|.-
T Consensus       179 GkpqRCpECGqVFKL  193 (268)
T PTZ00043        179 GFLYRCGECDQIFML  193 (268)
T ss_pred             CCCccCCCCCcEEEE
Confidence            457889999987754


No 81 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=67.25  E-value=0.7  Score=14.55  Aligned_cols=23  Identities=22%  Similarity=0.226  Sum_probs=11.0

Q ss_pred             cceeccccccccccchhHHHHhH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      ..|.|..|.+.|...-++-.|..
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~   42 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHET   42 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTT
T ss_pred             CeEECCCCCCccccCcChhhhcc
Confidence            35888888888876555444433


No 82 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=66.94  E-value=4.1  Score=14.86  Aligned_cols=17  Identities=12%  Similarity=0.083  Sum_probs=12.1

Q ss_pred             CCcceeccccccccccc
Q psy4412           3 PTYLYACLWCDYHTLNS   19 (39)
Q Consensus         3 ~~~~~~c~~c~~~~~~~   19 (39)
                      ++.|-.|..|+..|...
T Consensus        23 nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   23 NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCCCccCCCCCCccCcc
Confidence            34577788888877655


No 83 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=66.04  E-value=5  Score=15.88  Aligned_cols=15  Identities=13%  Similarity=0.341  Sum_probs=9.1

Q ss_pred             ceeccccccccccch
Q psy4412           6 LYACLWCDYHTLNSG   20 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~   20 (39)
                      -|.|..|+..|....
T Consensus       117 ~Y~Cp~C~~rytf~e  131 (178)
T PRK06266        117 FFFCPNCHIRFTFDE  131 (178)
T ss_pred             EEECCCCCcEEeHHH
Confidence            366777776665444


No 84 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=65.96  E-value=4  Score=12.60  Aligned_cols=11  Identities=36%  Similarity=0.779  Sum_probs=7.3

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      |.|..|+..+-
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            56777876553


No 85 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=64.56  E-value=3.6  Score=11.97  Aligned_cols=10  Identities=30%  Similarity=0.694  Sum_probs=5.9

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|++.+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5666666543


No 86 
>KOG2186|consensus
Probab=64.43  E-value=3.5  Score=17.52  Aligned_cols=21  Identities=14%  Similarity=0.463  Sum_probs=14.1

Q ss_pred             ceeccccccccccchhHHHHhH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      -|.|..|++.|.. .+...|..
T Consensus        29 ~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen   29 YFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             eeEEeeccccccc-chhhhhhh
Confidence            3678888888876 44555543


No 87 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=63.24  E-value=9.1  Score=14.83  Aligned_cols=17  Identities=12%  Similarity=0.086  Sum_probs=10.6

Q ss_pred             ceeccccccccccchhH
Q psy4412           6 LYACLWCDYHTLNSGHM   22 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~   22 (39)
                      -|.|..|+..|.....+
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            46777777666554444


No 88 
>PF14353 CpXC:  CpXC protein
Probab=63.07  E-value=4.7  Score=14.74  Aligned_cols=15  Identities=13%  Similarity=0.186  Sum_probs=10.3

Q ss_pred             ceeccccccccccch
Q psy4412           6 LYACLWCDYHTLNSG   20 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~   20 (39)
                      .+.|..|+..+....
T Consensus        38 ~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEY   52 (128)
T ss_pred             EEECCCCCCceecCC
Confidence            468999998665443


No 89 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=63.04  E-value=4.4  Score=12.94  Aligned_cols=16  Identities=31%  Similarity=0.708  Sum_probs=11.0

Q ss_pred             Ccceeccccccccccc
Q psy4412           4 TYLYACLWCDYHTLNS   19 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~   19 (39)
                      ...+.|..|+..+...
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            4578899998877554


No 90 
>KOG2785|consensus
Probab=62.76  E-value=8.8  Score=17.39  Aligned_cols=24  Identities=25%  Similarity=0.587  Sum_probs=18.5

Q ss_pred             ceeccccc---cccccchhHHHHhHHh
Q psy4412           6 LYACLWCD---YHTLNSGHMRDHIRRH   29 (39)
Q Consensus         6 ~~~c~~c~---~~~~~~~~~~~~~~~~   29 (39)
                      .+.|..|.   ..|.....++.|+...
T Consensus       217 ~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  217 GFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CceEEEeccccCcccccHHHHHHHhhc
Confidence            35677777   8888889999998643


No 91 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=62.27  E-value=5.2  Score=13.19  Aligned_cols=9  Identities=33%  Similarity=0.770  Sum_probs=5.8

Q ss_pred             cceeccccc
Q psy4412           5 YLYACLWCD   13 (39)
Q Consensus         5 ~~~~c~~c~   13 (39)
                      .+|.|..|+
T Consensus        49 ~~Y~Cp~CG   57 (61)
T COG2888          49 NPYRCPKCG   57 (61)
T ss_pred             CceECCCcC
Confidence            357777765


No 92 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=61.91  E-value=3.7  Score=12.82  Aligned_cols=11  Identities=36%  Similarity=0.806  Sum_probs=7.5

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      |.|..|+..+-
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56778876654


No 93 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=61.77  E-value=5.5  Score=12.05  Aligned_cols=12  Identities=25%  Similarity=0.415  Sum_probs=8.1

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      |.|..|+..+..
T Consensus         3 Y~C~~Cg~~~~~   14 (44)
T smart00659        3 YICGECGRENEI   14 (44)
T ss_pred             EECCCCCCEeec
Confidence            677888775543


No 94 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=61.74  E-value=4.1  Score=15.82  Aligned_cols=15  Identities=20%  Similarity=0.255  Sum_probs=11.5

Q ss_pred             ceeccccccccccch
Q psy4412           6 LYACLWCDYHTLNSG   20 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~   20 (39)
                      -+.|..|+..|....
T Consensus        28 ~~~c~~c~~~f~~~e   42 (154)
T PRK00464         28 RRECLACGKRFTTFE   42 (154)
T ss_pred             eeeccccCCcceEeE
Confidence            378999999887654


No 95 
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=61.55  E-value=5  Score=11.12  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=8.1

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      -|.|..|+...
T Consensus         7 ~ykC~~Cgniv   17 (34)
T TIGR00319         7 VYKCEVCGNIV   17 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47888888755


No 96 
>KOG1994|consensus
Probab=61.52  E-value=7.2  Score=16.45  Aligned_cols=22  Identities=18%  Similarity=0.576  Sum_probs=17.9

Q ss_pred             ceeccccccccccchhHHHHhH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      -|-|..|+--|.....|..|..
T Consensus       239 h~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  239 HYYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             ceEEEEeccccCCHHHHHHhCC
Confidence            4679999999998888887743


No 97 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=61.51  E-value=4.5  Score=11.62  Aligned_cols=11  Identities=27%  Similarity=0.546  Sum_probs=7.0

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      +.|..|+..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            35777776553


No 98 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=61.06  E-value=8.8  Score=14.55  Aligned_cols=15  Identities=20%  Similarity=0.470  Sum_probs=10.5

Q ss_pred             eeccccccccccchh
Q psy4412           7 YACLWCDYHTLNSGH   21 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~   21 (39)
                      +.|..|++.|..-+.
T Consensus       125 ~~C~~C~kiyW~GsH  139 (147)
T PF01927_consen  125 WRCPGCGKIYWEGSH  139 (147)
T ss_pred             EECCCCCCEeccccc
Confidence            578888887765443


No 99 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=60.53  E-value=10  Score=17.65  Aligned_cols=22  Identities=14%  Similarity=0.421  Sum_probs=18.7

Q ss_pred             ceeccccccccccchhHHHHhH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      =+.|..|.+.|.....+..|+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHH
Confidence            3579999999999999998876


No 100
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=60.45  E-value=5.9  Score=11.79  Aligned_cols=12  Identities=25%  Similarity=0.576  Sum_probs=7.6

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .|.|..|+..+.
T Consensus         3 ~y~C~~CG~~~~   14 (46)
T PRK00398          3 EYKCARCGREVE   14 (46)
T ss_pred             EEECCCCCCEEE
Confidence            466777776553


No 101
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=60.01  E-value=5.4  Score=11.06  Aligned_cols=11  Identities=27%  Similarity=0.730  Sum_probs=7.7

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      -|.|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            36788887655


No 102
>KOG1146|consensus
Probab=59.49  E-value=12  Score=20.04  Aligned_cols=25  Identities=28%  Similarity=0.652  Sum_probs=21.0

Q ss_pred             CcceeccccccccccchhHHHHhHH
Q psy4412           4 TYLYACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      .++|.|..|..++.....+..|+..
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            4678999999999988888888764


No 103
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.34  E-value=1  Score=18.73  Aligned_cols=27  Identities=19%  Similarity=0.229  Sum_probs=18.1

Q ss_pred             cceeccccccccccchhHHHHhHHhcC
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRRHTG   31 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~~~~   31 (39)
                      +...|++|+-.|.....+....|+.++
T Consensus        18 k~ieCPvC~tkFkkeev~tgsiRiiag   44 (267)
T COG1655          18 KTIECPVCNTKFKKEEVKTGSIRIIAG   44 (267)
T ss_pred             ceeccCcccchhhhhheeccceeEecc
Confidence            457899999888776655554454444


No 104
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=59.26  E-value=6  Score=11.32  Aligned_cols=11  Identities=18%  Similarity=0.217  Sum_probs=7.4

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      ...|..|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            45677777665


No 105
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=57.66  E-value=7  Score=12.82  Aligned_cols=9  Identities=33%  Similarity=0.815  Sum_probs=5.8

Q ss_pred             cceeccccc
Q psy4412           5 YLYACLWCD   13 (39)
Q Consensus         5 ~~~~c~~c~   13 (39)
                      .+|.|..|+
T Consensus        47 ~~Y~CP~CG   55 (59)
T PRK14890         47 NPYTCPKCG   55 (59)
T ss_pred             CceECCCCC
Confidence            356777665


No 106
>PF14369 zf-RING_3:  zinc-finger
Probab=56.90  E-value=5.6  Score=11.36  Aligned_cols=10  Identities=30%  Similarity=0.537  Sum_probs=6.9

Q ss_pred             eccccccccc
Q psy4412           8 ACLWCDYHTL   17 (39)
Q Consensus         8 ~c~~c~~~~~   17 (39)
                      .|..|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4777877764


No 107
>KOG2857|consensus
Probab=56.86  E-value=6.9  Score=15.25  Aligned_cols=22  Identities=18%  Similarity=0.267  Sum_probs=17.3

Q ss_pred             ceeccccccccccchhHHHHhH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      .|.|..|.-.+....-++.|.-
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            5888888888888877777754


No 108
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=56.45  E-value=7.3  Score=11.41  Aligned_cols=10  Identities=30%  Similarity=0.704  Sum_probs=6.0

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5666676543


No 109
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=55.91  E-value=11  Score=14.92  Aligned_cols=17  Identities=18%  Similarity=0.333  Sum_probs=12.6

Q ss_pred             ceeccccccccccchhH
Q psy4412           6 LYACLWCDYHTLNSGHM   22 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~   22 (39)
                      ...|..|++.|.....+
T Consensus       114 ~~~C~~Cg~~f~~~k~i  130 (181)
T PRK08222        114 LQRCSRCERPFAPQKTV  130 (181)
T ss_pred             cCcCcccCCccCcHhHH
Confidence            56799999999755443


No 110
>KOG0978|consensus
Probab=55.67  E-value=3.5  Score=19.96  Aligned_cols=17  Identities=18%  Similarity=0.192  Sum_probs=11.5

Q ss_pred             eeccccccccccchhHH
Q psy4412           7 YACLWCDYHTLNSGHMR   23 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~   23 (39)
                      -.|+.|+.+|.....+.
T Consensus       679 RKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVHR  695 (698)
T ss_pred             CCCCCCCCCCCcccccc
Confidence            36888888887655433


No 111
>KOG2593|consensus
Probab=55.29  E-value=8.4  Score=17.74  Aligned_cols=19  Identities=16%  Similarity=0.258  Sum_probs=13.7

Q ss_pred             CcceeccccccccccchhH
Q psy4412           4 TYLYACLWCDYHTLNSGHM   22 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~~   22 (39)
                      ...|.|..|.+.|.....+
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~  144 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEAL  144 (436)
T ss_pred             cccccCCccccchhhhHHH
Confidence            4568899999888765543


No 112
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=55.25  E-value=8.5  Score=11.83  Aligned_cols=32  Identities=19%  Similarity=0.485  Sum_probs=14.5

Q ss_pred             ceeccc-cccccccchhHHHHhHHhcCCCCccC
Q psy4412           6 LYACLW-CDYHTLNSGHMRDHIRRHTGEKPFVC   37 (39)
Q Consensus         6 ~~~c~~-c~~~~~~~~~~~~~~~~~~~~~~~~c   37 (39)
                      +..|.. |......+..+..|....-..++..|
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C   41 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRPVPC   41 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCcEEC
Confidence            445665 33333345567777764444444444


No 113
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=52.84  E-value=8.2  Score=10.92  Aligned_cols=10  Identities=20%  Similarity=0.753  Sum_probs=6.0

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      +.|..|+..+
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            3566676654


No 114
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=52.43  E-value=8.5  Score=14.48  Aligned_cols=15  Identities=20%  Similarity=0.301  Sum_probs=11.1

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      .-|.|..|++.|...
T Consensus        52 qRyrC~~C~~tf~~~   66 (129)
T COG3677          52 QRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccCCcCcceeee
Confidence            357899999887554


No 115
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=51.42  E-value=9  Score=15.87  Aligned_cols=16  Identities=13%  Similarity=0.277  Sum_probs=11.2

Q ss_pred             Ccceeccccccccccc
Q psy4412           4 TYLYACLWCDYHTLNS   19 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~   19 (39)
                      ..||.|..|-+.|...
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            4688888887766543


No 116
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=51.22  E-value=7.8  Score=12.21  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=9.2

Q ss_pred             cceecccccccc
Q psy4412           5 YLYACLWCDYHT   16 (39)
Q Consensus         5 ~~~~c~~c~~~~   16 (39)
                      ..|.|..|+..+
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            357888888876


No 117
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=50.53  E-value=7.8  Score=15.11  Aligned_cols=14  Identities=21%  Similarity=0.302  Sum_probs=10.3

Q ss_pred             eeccccccccccch
Q psy4412           7 YACLWCDYHTLNSG   20 (39)
Q Consensus         7 ~~c~~c~~~~~~~~   20 (39)
                      -.|..|++.|....
T Consensus        29 ReC~~C~~RFTTyE   42 (147)
T TIGR00244        29 RECLECHERFTTFE   42 (147)
T ss_pred             ccCCccCCccceee
Confidence            36888998887654


No 118
>KOG2636|consensus
Probab=49.92  E-value=23  Score=16.72  Aligned_cols=23  Identities=22%  Similarity=0.444  Sum_probs=15.8

Q ss_pred             Ccceeccccc-cccccchhHHHHh
Q psy4412           4 TYLYACLWCD-YHTLNSGHMRDHI   26 (39)
Q Consensus         4 ~~~~~c~~c~-~~~~~~~~~~~~~   26 (39)
                      .+.|.|..|+ ..+.-+..+..|.
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHh
Confidence            3468999999 5666666666663


No 119
>KOG0562|consensus
Probab=49.78  E-value=20  Score=14.52  Aligned_cols=25  Identities=16%  Similarity=0.345  Sum_probs=17.7

Q ss_pred             cceeccccccccccchhHHHHhHHh
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      .+..|-.|.......+.+..|.+.+
T Consensus       152 ~dLrC~~Cq~~~~~~~kLK~Hl~~~  176 (184)
T KOG0562|consen  152 EDLRCWRCQTFGPHFPKLKAHLREE  176 (184)
T ss_pred             cceeehhhhhcccccHHHHHHHHHH
Confidence            4567888886556667788887654


No 120
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=49.75  E-value=9.8  Score=10.96  Aligned_cols=10  Identities=20%  Similarity=0.418  Sum_probs=5.0

Q ss_pred             eccccccccc
Q psy4412           8 ACLWCDYHTL   17 (39)
Q Consensus         8 ~c~~c~~~~~   17 (39)
                      .|+.|+..+.
T Consensus        23 ~Cd~cg~~L~   32 (36)
T PF05191_consen   23 VCDNCGGELV   32 (36)
T ss_dssp             BCTTTTEBEB
T ss_pred             ccCCCCCeeE
Confidence            4555555443


No 121
>KOG0782|consensus
Probab=49.36  E-value=3  Score=19.97  Aligned_cols=14  Identities=14%  Similarity=0.014  Sum_probs=10.0

Q ss_pred             eeccccccccccch
Q psy4412           7 YACLWCDYHTLNSG   20 (39)
Q Consensus         7 ~~c~~c~~~~~~~~   20 (39)
                      ..|..|+++|.++-
T Consensus       254 GkC~~CgKgFQQKf  267 (1004)
T KOG0782|consen  254 GKCNTCGKGFQQKF  267 (1004)
T ss_pred             cccchhhhhhhhhe
Confidence            46888888877654


No 122
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=49.19  E-value=11  Score=14.76  Aligned_cols=16  Identities=19%  Similarity=0.262  Sum_probs=12.1

Q ss_pred             ceeccccccccccchh
Q psy4412           6 LYACLWCDYHTLNSGH   21 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~   21 (39)
                      +..|..|++.|.....
T Consensus       114 ~~~C~~CG~~f~~~~~  129 (180)
T PRK12387        114 LCNCRVCGRPFAVQKE  129 (180)
T ss_pred             cccchhhCCccccHHH
Confidence            5689999998875543


No 123
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=49.05  E-value=9.6  Score=10.65  Aligned_cols=14  Identities=14%  Similarity=0.171  Sum_probs=9.2

Q ss_pred             eeccccccccccch
Q psy4412           7 YACLWCDYHTLNSG   20 (39)
Q Consensus         7 ~~c~~c~~~~~~~~   20 (39)
                      ..|..|+..|....
T Consensus         3 ~~CP~C~~~~~v~~   16 (38)
T TIGR02098         3 IQCPNCKTSFRVVD   16 (38)
T ss_pred             EECCCCCCEEEeCH
Confidence            46778887765544


No 124
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=48.72  E-value=11  Score=13.46  Aligned_cols=11  Identities=18%  Similarity=0.489  Sum_probs=7.8

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      +.|..|+..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            67888887664


No 125
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=48.55  E-value=8.6  Score=15.15  Aligned_cols=13  Identities=23%  Similarity=0.363  Sum_probs=9.7

Q ss_pred             eccccccccccch
Q psy4412           8 ACLWCDYHTLNSG   20 (39)
Q Consensus         8 ~c~~c~~~~~~~~   20 (39)
                      .|..|+..|....
T Consensus        30 eC~~C~~RFTTfE   42 (156)
T COG1327          30 ECLECGERFTTFE   42 (156)
T ss_pred             cccccccccchhh
Confidence            6888888886654


No 126
>KOG4727|consensus
Probab=48.53  E-value=16  Score=14.84  Aligned_cols=21  Identities=38%  Similarity=0.523  Sum_probs=16.2

Q ss_pred             ceeccccccccccchhHHHHh
Q psy4412           6 LYACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~   26 (39)
                      .|-|.+|.-.+...-.+..|+
T Consensus        75 GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             ceeeeecceeehhhHHHHHHh
Confidence            478999998887777777664


No 127
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=47.22  E-value=8.7  Score=10.22  Aligned_cols=9  Identities=22%  Similarity=0.704  Sum_probs=4.6

Q ss_pred             eeccccccc
Q psy4412           7 YACLWCDYH   15 (39)
Q Consensus         7 ~~c~~c~~~   15 (39)
                      +.|..|+..
T Consensus        28 f~C~~C~~~   36 (39)
T smart00132       28 FKCSKCGKP   36 (39)
T ss_pred             CCCcccCCc
Confidence            445555544


No 128
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=47.02  E-value=11  Score=10.75  Aligned_cols=10  Identities=20%  Similarity=0.315  Sum_probs=6.0

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      ..|..|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            4666666544


No 129
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=46.97  E-value=11  Score=14.01  Aligned_cols=22  Identities=14%  Similarity=0.320  Sum_probs=16.8

Q ss_pred             ceeccccccccccchhHHHHhH
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      .+-|.+|.+-|.....|..|.+
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            3568889988888877777755


No 130
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=46.96  E-value=2.1  Score=12.42  Aligned_cols=28  Identities=14%  Similarity=0.482  Sum_probs=15.4

Q ss_pred             eeccccccccccchhHHHHhHHhcCCCCccCC
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRHTGEKPFVCP   38 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c~   38 (39)
                      ..|..|...-    .+..|.....|...|.|.
T Consensus         6 v~CP~C~s~~----~v~k~G~~~~G~qryrC~   33 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGKSPSGHQRYRCK   33 (36)
T ss_pred             eeCCCCCCCC----cceeCCCCCCCCEeEecC
Confidence            4566665422    144555566666677664


No 131
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=46.42  E-value=11  Score=13.24  Aligned_cols=12  Identities=17%  Similarity=0.504  Sum_probs=8.4

Q ss_pred             eccccccccccc
Q psy4412           8 ACLWCDYHTLNS   19 (39)
Q Consensus         8 ~c~~c~~~~~~~   19 (39)
                      .|..|+..+...
T Consensus        10 ~C~~CG~d~~~~   21 (86)
T PF06170_consen   10 RCPHCGLDYSHA   21 (86)
T ss_pred             cccccCCccccC
Confidence            688888766543


No 132
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=45.11  E-value=12  Score=14.86  Aligned_cols=18  Identities=11%  Similarity=-0.001  Sum_probs=12.9

Q ss_pred             Ccceeccccccccccchh
Q psy4412           4 TYLYACLWCDYHTLNSGH   21 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~   21 (39)
                      ..|.-|..||+.|..-..
T Consensus        66 ~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCChhHHhCCCCCchHHH
Confidence            356778999998865543


No 133
>PF09965 DUF2199:  Uncharacterized protein conserved in bacteria (DUF2199);  InterPro: IPR018697 This domain has no known function.
Probab=45.08  E-value=11  Score=14.69  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=7.6

Q ss_pred             eeccccccccccc
Q psy4412           7 YACLWCDYHTLNS   19 (39)
Q Consensus         7 ~~c~~c~~~~~~~   19 (39)
                      |.|..|+..+...
T Consensus         1 y~C~~Cg~~h~~~   13 (148)
T PF09965_consen    1 YTCSCCGEEHEGL   13 (148)
T ss_pred             CCCCcCCccCCCC
Confidence            4577777655443


No 134
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=44.88  E-value=11  Score=12.18  Aligned_cols=13  Identities=15%  Similarity=0.353  Sum_probs=7.9

Q ss_pred             cceeccccccccc
Q psy4412           5 YLYACLWCDYHTL   17 (39)
Q Consensus         5 ~~~~c~~c~~~~~   17 (39)
                      +-..|..|+..|.
T Consensus        38 rYngCPfC~~~~~   50 (55)
T PF14447_consen   38 RYNGCPFCGTPFE   50 (55)
T ss_pred             hccCCCCCCCccc
Confidence            3346777776654


No 135
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=44.13  E-value=18  Score=12.91  Aligned_cols=16  Identities=13%  Similarity=0.422  Sum_probs=11.2

Q ss_pred             eeccccccccccchhH
Q psy4412           7 YACLWCDYHTLNSGHM   22 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~   22 (39)
                      ..|..||..+......
T Consensus        36 ~~C~~CGe~y~~dev~   51 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTV   51 (89)
T ss_pred             ccccCCCcEeecHHHH
Confidence            4688899887665543


No 136
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=44.13  E-value=14  Score=14.66  Aligned_cols=27  Identities=37%  Similarity=0.805  Sum_probs=13.6

Q ss_pred             ceeccccccccccchhHHHHhHHhcCCCCccC
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHTGEKPFVC   37 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~c   37 (39)
                      +|.|. |+..+..   .+.|-.+-.|+ .|.|
T Consensus       117 ~Y~C~-C~q~~l~---~RRhn~~~~g~-~YrC  143 (156)
T COG3091         117 PYRCQ-CQQHYLR---IRRHNTVRRGE-VYRC  143 (156)
T ss_pred             eEEee-cCCccch---hhhcccccccc-eEEe
Confidence            57777 7765433   23333344444 5555


No 137
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=44.12  E-value=8.6  Score=9.82  Aligned_cols=6  Identities=33%  Similarity=0.850  Sum_probs=3.1

Q ss_pred             cccccc
Q psy4412           9 CLWCDY   14 (39)
Q Consensus         9 c~~c~~   14 (39)
                      |..|+.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555553


No 138
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=44.06  E-value=14  Score=12.75  Aligned_cols=12  Identities=33%  Similarity=0.421  Sum_probs=8.9

Q ss_pred             eccccccccccc
Q psy4412           8 ACLWCDYHTLNS   19 (39)
Q Consensus         8 ~c~~c~~~~~~~   19 (39)
                      .|..|++.+...
T Consensus        80 ~C~vC~k~l~~~   91 (109)
T PF10367_consen   80 KCSVCGKPLGNS   91 (109)
T ss_pred             CccCcCCcCCCc
Confidence            588899877653


No 139
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.95  E-value=15  Score=14.08  Aligned_cols=16  Identities=13%  Similarity=0.002  Sum_probs=11.3

Q ss_pred             Ccceeccccccccccc
Q psy4412           4 TYLYACLWCDYHTLNS   19 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~   19 (39)
                      +.|.-|..|++.|...
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            4466788898887644


No 140
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=43.77  E-value=16  Score=13.47  Aligned_cols=9  Identities=22%  Similarity=0.792  Sum_probs=6.0

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      .|.|..|+.
T Consensus        22 ~FtCp~Cgh   30 (104)
T COG4888          22 TFTCPRCGH   30 (104)
T ss_pred             eEecCccCC
Confidence            467777765


No 141
>KOG3362|consensus
Probab=43.76  E-value=7  Score=15.27  Aligned_cols=20  Identities=20%  Similarity=0.542  Sum_probs=10.7

Q ss_pred             ceeccccccccccchhHHHH
Q psy4412           6 LYACLWCDYHTLNSGHMRDH   25 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~   25 (39)
                      +|.|.-||..+....-+..|
T Consensus       129 ~ysC~~CG~kyCsv~C~~~H  148 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTH  148 (156)
T ss_pred             hhHHHhcCCceeechhhhhc
Confidence            35555566655555544444


No 142
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=43.70  E-value=13  Score=10.49  Aligned_cols=10  Identities=30%  Similarity=0.654  Sum_probs=5.1

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|+..+
T Consensus         1 Y~C~~Cg~~~   10 (32)
T PF03604_consen    1 YICGECGAEV   10 (32)
T ss_dssp             EBESSSSSSE
T ss_pred             CCCCcCCCee
Confidence            3455665543


No 143
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=43.57  E-value=23  Score=13.50  Aligned_cols=16  Identities=19%  Similarity=0.266  Sum_probs=11.6

Q ss_pred             cceeccccccccccch
Q psy4412           5 YLYACLWCDYHTLNSG   20 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~   20 (39)
                      .-|.|+.|+..|....
T Consensus        98 ~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       98 AYYKCPNCQSKYTFLE  113 (147)
T ss_pred             cEEECcCCCCEeeHHH
Confidence            3578999998777543


No 144
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=42.98  E-value=12  Score=13.48  Aligned_cols=11  Identities=18%  Similarity=0.368  Sum_probs=8.3

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      +.|..|+++-.
T Consensus        69 ~~Ct~Cgkah~   79 (94)
T COG1631          69 LRCTECGKAHQ   79 (94)
T ss_pred             EEehhhccccc
Confidence            68999987644


No 145
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=42.71  E-value=14  Score=10.74  Aligned_cols=9  Identities=22%  Similarity=0.449  Sum_probs=5.6

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      |..|..|+.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            456777774


No 146
>KOG3183|consensus
Probab=42.53  E-value=12  Score=15.96  Aligned_cols=14  Identities=14%  Similarity=0.126  Sum_probs=10.3

Q ss_pred             ceeccccccccccc
Q psy4412           6 LYACLWCDYHTLNS   19 (39)
Q Consensus         6 ~~~c~~c~~~~~~~   19 (39)
                      |+.|+.|...|...
T Consensus        23 Pf~Cd~C~~~FC~e   36 (250)
T KOG3183|consen   23 PFKCDGCSGIFCLE   36 (250)
T ss_pred             ceeeCCccchhhhc
Confidence            78888888777543


No 147
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=42.49  E-value=14  Score=13.57  Aligned_cols=10  Identities=40%  Similarity=1.082  Sum_probs=6.4

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|+..+
T Consensus       101 y~C~~Cg~~w  110 (113)
T COG1594         101 YKCTRCGYRW  110 (113)
T ss_pred             EEecccCCEe
Confidence            5677776654


No 148
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=42.26  E-value=35  Score=15.10  Aligned_cols=24  Identities=21%  Similarity=0.458  Sum_probs=20.0

Q ss_pred             cceeccccccccccchhHHHHhHH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      ..|.|..|-+-|.....+..|...
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHHh
Confidence            458899999999999999988763


No 149
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=42.15  E-value=12  Score=10.05  Aligned_cols=7  Identities=29%  Similarity=0.510  Sum_probs=3.2

Q ss_pred             ecccccc
Q psy4412           8 ACLWCDY   14 (39)
Q Consensus         8 ~c~~c~~   14 (39)
                      .|..|++
T Consensus         2 ~C~~C~~    8 (30)
T PF03107_consen    2 WCDVCRR    8 (30)
T ss_pred             CCCCCCC
Confidence            3444543


No 150
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=41.78  E-value=13  Score=11.89  Aligned_cols=11  Identities=18%  Similarity=0.471  Sum_probs=6.6

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      +.|..|+..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            45777776543


No 151
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=41.70  E-value=13  Score=13.43  Aligned_cols=14  Identities=14%  Similarity=0.332  Sum_probs=9.5

Q ss_pred             cceecccccccccc
Q psy4412           5 YLYACLWCDYHTLN   18 (39)
Q Consensus         5 ~~~~c~~c~~~~~~   18 (39)
                      +|-.|..||.-|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            35578888876654


No 152
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=41.32  E-value=15  Score=14.19  Aligned_cols=10  Identities=50%  Similarity=1.086  Sum_probs=7.6

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|+.+.
T Consensus        14 YrC~~C~~Tw   23 (142)
T PF06353_consen   14 YRCEKCDYTW   23 (142)
T ss_pred             EEcccCcCcc
Confidence            7888888654


No 153
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=40.65  E-value=36  Score=16.05  Aligned_cols=23  Identities=22%  Similarity=0.556  Sum_probs=19.8

Q ss_pred             cceeccccccccccchhHHHHhH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      ..|.|..|-+-|.....+..|+.
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHHh
Confidence            46889999999999999999875


No 154
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=40.61  E-value=22  Score=13.68  Aligned_cols=16  Identities=0%  Similarity=-0.238  Sum_probs=9.5

Q ss_pred             Ccceeccccccccccc
Q psy4412           4 TYLYACLWCDYHTLNS   19 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~   19 (39)
                      +.|-.|..|+..+...
T Consensus        24 k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        24 RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCCccCCCcCCccCcc
Confidence            4466677777665443


No 155
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=40.51  E-value=18  Score=11.72  Aligned_cols=14  Identities=21%  Similarity=0.361  Sum_probs=9.7

Q ss_pred             Ccceeccccccccc
Q psy4412           4 TYLYACLWCDYHTL   17 (39)
Q Consensus         4 ~~~~~c~~c~~~~~   17 (39)
                      ...|.|..||-..-
T Consensus        12 ~v~~~Cp~cGipth   25 (55)
T PF13824_consen   12 HVNFECPDCGIPTH   25 (55)
T ss_pred             ccCCcCCCCCCcCc
Confidence            45688998886543


No 156
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=40.15  E-value=18  Score=11.23  Aligned_cols=21  Identities=24%  Similarity=0.804  Sum_probs=11.3

Q ss_pred             eeccccccccccchhHHHHhH
Q psy4412           7 YACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      |.|-+|.-.-...+.+-.|+.
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            456666544444455555554


No 157
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=38.90  E-value=14  Score=14.29  Aligned_cols=11  Identities=18%  Similarity=0.416  Sum_probs=7.1

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      .+.|..|+...
T Consensus       112 ~l~C~~Cg~~~  122 (146)
T PF07295_consen  112 TLVCENCGHEV  122 (146)
T ss_pred             eEecccCCCEE
Confidence            46777777533


No 158
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.52  E-value=11  Score=11.88  Aligned_cols=13  Identities=15%  Similarity=0.158  Sum_probs=9.3

Q ss_pred             eccccccccccch
Q psy4412           8 ACLWCDYHTLNSG   20 (39)
Q Consensus         8 ~c~~c~~~~~~~~   20 (39)
                      .|..|...|....
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            5888888876543


No 159
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=38.51  E-value=15  Score=12.21  Aligned_cols=7  Identities=29%  Similarity=0.738  Sum_probs=3.7

Q ss_pred             ecccccc
Q psy4412           8 ACLWCDY   14 (39)
Q Consensus         8 ~c~~c~~   14 (39)
                      .|+.|+.
T Consensus         2 ~C~KCg~    8 (64)
T PF09855_consen    2 KCPKCGN    8 (64)
T ss_pred             CCCCCCC
Confidence            4555554


No 160
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=37.53  E-value=18  Score=10.67  Aligned_cols=13  Identities=15%  Similarity=0.215  Sum_probs=7.0

Q ss_pred             eccccccccccch
Q psy4412           8 ACLWCDYHTLNSG   20 (39)
Q Consensus         8 ~c~~c~~~~~~~~   20 (39)
                      .|..|++.+-..+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            4777877765443


No 161
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=37.36  E-value=21  Score=12.79  Aligned_cols=8  Identities=38%  Similarity=1.277  Sum_probs=4.1

Q ss_pred             eecccccc
Q psy4412           7 YACLWCDY   14 (39)
Q Consensus         7 ~~c~~c~~   14 (39)
                      |.|..|++
T Consensus        36 y~Cp~Cgk   43 (90)
T PF01780_consen   36 YTCPFCGK   43 (90)
T ss_dssp             BEESSSSS
T ss_pred             CcCCCCCC
Confidence            45555554


No 162
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=37.06  E-value=19  Score=10.73  Aligned_cols=11  Identities=18%  Similarity=0.558  Sum_probs=7.1

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      +..|..|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45677777654


No 163
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=36.95  E-value=17  Score=13.31  Aligned_cols=9  Identities=22%  Similarity=0.807  Sum_probs=6.1

Q ss_pred             eeccccccc
Q psy4412           7 YACLWCDYH   15 (39)
Q Consensus         7 ~~c~~c~~~   15 (39)
                      +.|..|++.
T Consensus         3 WkC~iCg~~   11 (101)
T PF09943_consen    3 WKCYICGKP   11 (101)
T ss_pred             eEEEecCCe
Confidence            567777763


No 164
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.57  E-value=22  Score=13.50  Aligned_cols=14  Identities=14%  Similarity=0.221  Sum_probs=10.2

Q ss_pred             ceeccccccccccc
Q psy4412           6 LYACLWCDYHTLNS   19 (39)
Q Consensus         6 ~~~c~~c~~~~~~~   19 (39)
                      .+.|..|+..|...
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            36899999776543


No 165
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=36.42  E-value=22  Score=11.08  Aligned_cols=6  Identities=33%  Similarity=1.370  Sum_probs=2.8

Q ss_pred             eccccc
Q psy4412           8 ACLWCD   13 (39)
Q Consensus         8 ~c~~c~   13 (39)
                      .|..||
T Consensus         5 PCPFCG   10 (61)
T PF14354_consen    5 PCPFCG   10 (61)
T ss_pred             CCCCCC
Confidence            345554


No 166
>KOG4124|consensus
Probab=36.32  E-value=5  Score=18.01  Aligned_cols=20  Identities=20%  Similarity=0.370  Sum_probs=14.4

Q ss_pred             CcceeccccccccccchhHH
Q psy4412           4 TYLYACLWCDYHTLNSGHMR   23 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~~~~~~   23 (39)
                      .+++.|..|.+.+.....|.
T Consensus       396 nk~~r~~i~~~~~k~~~~l~  415 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLK  415 (442)
T ss_pred             cCcccChhhhhhhccCCCCC
Confidence            57889999988776655443


No 167
>KOG0402|consensus
Probab=36.30  E-value=11  Score=13.39  Aligned_cols=8  Identities=38%  Similarity=1.286  Sum_probs=5.5

Q ss_pred             eecccccc
Q psy4412           7 YACLWCDY   14 (39)
Q Consensus         7 ~~c~~c~~   14 (39)
                      |.|..|++
T Consensus        37 y~CsfCGK   44 (92)
T KOG0402|consen   37 YTCSFCGK   44 (92)
T ss_pred             hhhhhcch
Confidence            56777775


No 168
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=36.26  E-value=22  Score=11.36  Aligned_cols=12  Identities=17%  Similarity=0.191  Sum_probs=4.9

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .+.|..||..+.
T Consensus        25 rhhCr~CG~~vC   36 (69)
T PF01363_consen   25 RHHCRNCGRVVC   36 (69)
T ss_dssp             EEE-TTT--EEE
T ss_pred             eEccCCCCCEEC
Confidence            355666666553


No 169
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=35.82  E-value=21  Score=10.63  Aligned_cols=14  Identities=21%  Similarity=0.563  Sum_probs=9.4

Q ss_pred             ceeccccccccccc
Q psy4412           6 LYACLWCDYHTLNS   19 (39)
Q Consensus         6 ~~~c~~c~~~~~~~   19 (39)
                      -+.|..|+..+...
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            46788888765443


No 170
>KOG1842|consensus
Probab=35.72  E-value=28  Score=16.47  Aligned_cols=25  Identities=20%  Similarity=0.360  Sum_probs=20.3

Q ss_pred             ceeccccccccccchhHHHHhHHhc
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      .+.|+.|..-|.....|..|.-..+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhc
Confidence            5789999999999888888875433


No 171
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=35.58  E-value=19  Score=10.27  Aligned_cols=9  Identities=33%  Similarity=0.792  Sum_probs=6.1

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      .|.|..|+.
T Consensus         8 ~Y~C~~C~~   16 (32)
T PF13696_consen    8 GYVCHRCGQ   16 (32)
T ss_pred             CCEeecCCC
Confidence            367777764


No 172
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=35.52  E-value=19  Score=13.34  Aligned_cols=10  Identities=20%  Similarity=0.351  Sum_probs=6.8

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      ..|+.|+..|
T Consensus        50 t~CP~Cg~~~   59 (115)
T COG1885          50 TSCPKCGEPF   59 (115)
T ss_pred             ccCCCCCCcc
Confidence            4688888654


No 173
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.06  E-value=26  Score=13.19  Aligned_cols=14  Identities=0%  Similarity=-0.223  Sum_probs=10.4

Q ss_pred             CCcceecccccccc
Q psy4412           3 PTYLYACLWCDYHT   16 (39)
Q Consensus         3 ~~~~~~c~~c~~~~   16 (39)
                      +..|..|..|+++|
T Consensus        23 NrdPiVsPytG~s~   36 (129)
T COG4530          23 NRDPIVSPYTGKSY   36 (129)
T ss_pred             CCCccccCcccccc
Confidence            34577788888887


No 174
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=34.74  E-value=20  Score=10.22  Aligned_cols=20  Identities=20%  Similarity=0.368  Sum_probs=11.0

Q ss_pred             ceeccccccccccchhHHHHh
Q psy4412           6 LYACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~   26 (39)
                      .+.|..|+....... +..|.
T Consensus         4 ~~~C~nC~R~v~a~R-fA~HL   23 (33)
T PF08209_consen    4 YVECPNCGRPVAASR-FAPHL   23 (33)
T ss_dssp             EEE-TTTSSEEEGGG-HHHHH
T ss_pred             eEECCCCcCCcchhh-hHHHH
Confidence            467888987654432 44443


No 175
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=34.46  E-value=32  Score=12.38  Aligned_cols=17  Identities=18%  Similarity=0.452  Sum_probs=11.3

Q ss_pred             eeccccccccccchhHH
Q psy4412           7 YACLWCDYHTLNSGHMR   23 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~   23 (39)
                      +.|..|+..+.......
T Consensus        32 ~~C~~CGe~~~~~e~~~   48 (127)
T TIGR03830        32 WYCPACGEELLDPEESK   48 (127)
T ss_pred             eECCCCCCEEEcHHHHH
Confidence            56888888776655433


No 176
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=34.44  E-value=19  Score=11.86  Aligned_cols=15  Identities=20%  Similarity=0.262  Sum_probs=9.2

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      .|..|-.||+...+.
T Consensus         3 iPVRCFTCGkvi~~~   17 (60)
T PF01194_consen    3 IPVRCFTCGKVIGNK   17 (60)
T ss_dssp             -SSS-STTTSBTCGH
T ss_pred             CceecCCCCCChhHh
Confidence            366788888866544


No 177
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=34.36  E-value=21  Score=10.39  Aligned_cols=7  Identities=29%  Similarity=0.710  Sum_probs=3.2

Q ss_pred             ecccccc
Q psy4412           8 ACLWCDY   14 (39)
Q Consensus         8 ~c~~c~~   14 (39)
                      .|..|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            3445544


No 178
>PF12907 zf-met2:  Zinc-binding
Probab=34.34  E-value=17  Score=10.91  Aligned_cols=21  Identities=14%  Similarity=0.501  Sum_probs=12.3

Q ss_pred             eeccccccccccc---hhHHHHhH
Q psy4412           7 YACLWCDYHTLNS---GHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~---~~~~~~~~   27 (39)
                      +.|..|...|...   ..|..|-.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHH
Confidence            3577777666443   44666654


No 179
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=34.31  E-value=23  Score=10.64  Aligned_cols=12  Identities=17%  Similarity=0.471  Sum_probs=7.3

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      +.|..|+..+..
T Consensus        27 f~C~~C~~~l~~   38 (58)
T PF00412_consen   27 FKCSKCGKPLND   38 (58)
T ss_dssp             SBETTTTCBTTT
T ss_pred             cccCCCCCccCC
Confidence            567777765543


No 180
>PTZ00064 histone acetyltransferase; Provisional
Probab=34.29  E-value=63  Score=15.79  Aligned_cols=24  Identities=21%  Similarity=0.311  Sum_probs=19.9

Q ss_pred             cceeccccccccccchhHHHHhHH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      ..|.|..|-+-|.....+..|+..
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHHhc
Confidence            458899999988888889988663


No 181
>PRK11823 DNA repair protein RadA; Provisional
Probab=34.08  E-value=29  Score=15.99  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=8.2

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .|.|..|+....
T Consensus         7 ~y~C~~Cg~~~~   18 (446)
T PRK11823          7 AYVCQECGAESP   18 (446)
T ss_pred             eEECCcCCCCCc
Confidence            478888886543


No 182
>KOG4173|consensus
Probab=34.04  E-value=18  Score=15.18  Aligned_cols=19  Identities=21%  Similarity=0.506  Sum_probs=14.2

Q ss_pred             eccccccccccchhHHHHh
Q psy4412           8 ACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         8 ~c~~c~~~~~~~~~~~~~~   26 (39)
                      .|..|.+.|....-|..|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             hhHHHHHhCCchhhhhHHH
Confidence            6888888887776666664


No 183
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=33.99  E-value=19  Score=10.86  Aligned_cols=12  Identities=17%  Similarity=0.401  Sum_probs=7.9

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      ..|..|+..+..
T Consensus         6 l~C~~CG~~m~~   17 (58)
T PF13408_consen    6 LRCGHCGSKMTR   17 (58)
T ss_pred             EEcccCCcEeEE
Confidence            357778876654


No 184
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.94  E-value=41  Score=13.58  Aligned_cols=16  Identities=25%  Similarity=0.505  Sum_probs=11.1

Q ss_pred             eeccccccccccchhH
Q psy4412           7 YACLWCDYHTLNSGHM   22 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~   22 (39)
                      +.|..|++.|-.-+.+
T Consensus       131 ~~C~~CgkiYW~GsHw  146 (165)
T COG1656         131 YRCPKCGKIYWKGSHW  146 (165)
T ss_pred             eECCCCcccccCchHH
Confidence            5689999877655443


No 185
>PHA02998 RNA polymerase subunit; Provisional
Probab=33.89  E-value=32  Score=14.15  Aligned_cols=13  Identities=31%  Similarity=0.396  Sum_probs=9.2

Q ss_pred             eeccccccccccc
Q psy4412           7 YACLWCDYHTLNS   19 (39)
Q Consensus         7 ~~c~~c~~~~~~~   19 (39)
                      |.|..|++.+...
T Consensus       172 YkC~~CG~~wkpp  184 (195)
T PHA02998        172 HACRDCKKHFKPP  184 (195)
T ss_pred             EEcCCCCCccCCc
Confidence            6788888776543


No 186
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=33.64  E-value=26  Score=11.68  Aligned_cols=14  Identities=14%  Similarity=0.285  Sum_probs=10.2

Q ss_pred             cceecccccccccc
Q psy4412           5 YLYACLWCDYHTLN   18 (39)
Q Consensus         5 ~~~~c~~c~~~~~~   18 (39)
                      .|..|-.||+....
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            36778889886654


No 187
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=33.51  E-value=23  Score=11.29  Aligned_cols=19  Identities=16%  Similarity=0.608  Sum_probs=12.6

Q ss_pred             eeccccccccccchhHHHH
Q psy4412           7 YACLWCDYHTLNSGHMRDH   25 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~   25 (39)
                      +-|..|+-.+.....|..+
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             ceeeeeCCccCCHHHHHhC
Confidence            3477888777776666543


No 188
>PF00935 Ribosomal_L44:  Ribosomal protein L44;  InterPro: IPR000552 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of mammalian [], Trypanosoma brucei, Caenorhabditis elegans and fungal L44, and Haloarcula marismortui LA [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZS_r 1S1I_Z 3O5H_f 3O58_f 3IZR_r 1M1K_4 3CCQ_3 3CCL_3 3CME_3 1K73_4 ....
Probab=33.21  E-value=24  Score=12.24  Aligned_cols=10  Identities=20%  Similarity=0.478  Sum_probs=6.7

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      +.|..|+...
T Consensus        54 l~C~~C~~~~   63 (77)
T PF00935_consen   54 LECTECGKAH   63 (77)
T ss_dssp             EEETTTS-EE
T ss_pred             EEeCCCCccc
Confidence            6788888654


No 189
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=32.65  E-value=23  Score=10.19  Aligned_cols=11  Identities=18%  Similarity=0.368  Sum_probs=5.4

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      -.|..||..+.
T Consensus        22 isC~~CGPr~~   32 (35)
T PF07503_consen   22 ISCTNCGPRYS   32 (35)
T ss_dssp             --BTTCC-SCC
T ss_pred             ccCCCCCCCEE
Confidence            35777876553


No 190
>PF02998 Lentiviral_Tat:  Lentiviral Tat protein;  InterPro: IPR004247 This family contains retroviral transactivating (Tat) proteins, from a variety of lentiviruses. The Tat protein may have a role in trans-activation of the viral long terminal repeat [].; GO: 0045893 positive regulation of transcription, DNA-dependent
Probab=32.38  E-value=28  Score=12.26  Aligned_cols=11  Identities=18%  Similarity=0.416  Sum_probs=7.4

Q ss_pred             cceeccccccc
Q psy4412           5 YLYACLWCDYH   15 (39)
Q Consensus         5 ~~~~c~~c~~~   15 (39)
                      ++..|..|..+
T Consensus        73 R~CGCRlCNPG   83 (86)
T PF02998_consen   73 RPCGCRLCNPG   83 (86)
T ss_pred             cCCCccccCCC
Confidence            46777777654


No 191
>KOG3214|consensus
Probab=32.34  E-value=16  Score=13.47  Aligned_cols=13  Identities=15%  Similarity=0.409  Sum_probs=9.4

Q ss_pred             eeccccccccccc
Q psy4412           7 YACLWCDYHTLNS   19 (39)
Q Consensus         7 ~~c~~c~~~~~~~   19 (39)
                      ..|..|+.+|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            4688888888654


No 192
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=32.30  E-value=21  Score=16.31  Aligned_cols=21  Identities=19%  Similarity=0.322  Sum_probs=16.6

Q ss_pred             eeccccccccccchhHHHHhH
Q psy4412           7 YACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      +-|..|++.|.....+..|..
T Consensus       239 ~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         239 VYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             eeeHhhhhHhhhhHHHHHHHh
Confidence            569999999988877777754


No 193
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=32.02  E-value=23  Score=12.91  Aligned_cols=11  Identities=18%  Similarity=0.455  Sum_probs=7.5

Q ss_pred             cceeccccccc
Q psy4412           5 YLYACLWCDYH   15 (39)
Q Consensus         5 ~~~~c~~c~~~   15 (39)
                      +.|.|..|+..
T Consensus         5 kewkC~VCg~~   15 (103)
T COG4847           5 KEWKCYVCGGT   15 (103)
T ss_pred             ceeeEeeeCCE
Confidence            45778888763


No 194
>PRK01343 zinc-binding protein; Provisional
Probab=31.81  E-value=25  Score=11.48  Aligned_cols=12  Identities=17%  Similarity=0.299  Sum_probs=8.6

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      ...|..|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            356899998654


No 195
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=31.68  E-value=22  Score=10.17  Aligned_cols=8  Identities=25%  Similarity=0.488  Sum_probs=2.6

Q ss_pred             cccccccc
Q psy4412           9 CLWCDYHT   16 (39)
Q Consensus         9 c~~c~~~~   16 (39)
                      |..|+...
T Consensus         3 C~~CG~~l   10 (34)
T PF14803_consen    3 CPQCGGPL   10 (34)
T ss_dssp             -TTT--B-
T ss_pred             cccccChh
Confidence            66676654


No 196
>PF03286 Pox_Ag35:  Pox virus Ag35 surface protein;  InterPro: IPR004966 The Pox virus Ag35 surface protein is an evelope protein known as protein H5.; GO: 0019031 viral envelope
Probab=31.54  E-value=46  Score=13.88  Aligned_cols=21  Identities=14%  Similarity=0.117  Sum_probs=16.7

Q ss_pred             ccccccccchhHHHHhHHhcC
Q psy4412          11 WCDYHTLNSGHMRDHIRRHTG   31 (39)
Q Consensus        11 ~c~~~~~~~~~~~~~~~~~~~   31 (39)
                      -++-.|.....++.|.+.-+.
T Consensus         9 ~~~~~f~tl~eiR~hlrs~ae   29 (200)
T PF03286_consen    9 NGGSNFKTLEEIRAHLRSTAE   29 (200)
T ss_pred             CCCccceeHHHHHHHHhhhcc
Confidence            367789999999999886654


No 197
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=31.21  E-value=24  Score=10.39  Aligned_cols=9  Identities=22%  Similarity=0.778  Sum_probs=3.4

Q ss_pred             ecccccccc
Q psy4412           8 ACLWCDYHT   16 (39)
Q Consensus         8 ~c~~c~~~~   16 (39)
                      .|..|++.-
T Consensus         3 ~CSFCgr~~   11 (41)
T PF06689_consen    3 RCSFCGRPE   11 (41)
T ss_dssp             B-TTT--BT
T ss_pred             CccCCCCCH
Confidence            466676644


No 198
>PF15499 Peptidase_C98:  Ubiquitin-specific peptidase-like, SUMO isopeptidase
Probab=30.84  E-value=15  Score=15.88  Aligned_cols=12  Identities=17%  Similarity=0.589  Sum_probs=7.6

Q ss_pred             cceecccccccc
Q psy4412           5 YLYACLWCDYHT   16 (39)
Q Consensus         5 ~~~~c~~c~~~~   16 (39)
                      ..|.|..|+..+
T Consensus       133 WeFeC~~Cg~~~  144 (275)
T PF15499_consen  133 WEFECSQCGHKY  144 (275)
T ss_pred             EEEEccccCChh
Confidence            346777777544


No 199
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=30.82  E-value=32  Score=11.28  Aligned_cols=9  Identities=22%  Similarity=0.505  Sum_probs=5.5

Q ss_pred             ecccccccc
Q psy4412           8 ACLWCDYHT   16 (39)
Q Consensus         8 ~c~~c~~~~   16 (39)
                      .|..||++.
T Consensus         5 HC~~CG~~I   13 (59)
T PF09889_consen    5 HCPVCGKPI   13 (59)
T ss_pred             cCCcCCCcC
Confidence            467777544


No 200
>PRK11032 hypothetical protein; Provisional
Probab=30.54  E-value=23  Score=14.08  Aligned_cols=8  Identities=25%  Similarity=0.625  Sum_probs=4.4

Q ss_pred             eecccccc
Q psy4412           7 YACLWCDY   14 (39)
Q Consensus         7 ~~c~~c~~   14 (39)
                      ..|..|+.
T Consensus       125 LvC~~Cg~  132 (160)
T PRK11032        125 LVCEKCHH  132 (160)
T ss_pred             EEecCCCC
Confidence            45666654


No 201
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=30.38  E-value=28  Score=14.83  Aligned_cols=10  Identities=20%  Similarity=0.385  Sum_probs=6.8

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      -.|.+||...
T Consensus       191 ~VCeVCGA~L  200 (254)
T PF03194_consen  191 EVCEVCGAFL  200 (254)
T ss_pred             cchhhhhhHH
Confidence            4688888533


No 202
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.78  E-value=24  Score=9.66  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=4.9

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .|.|..|+..+-
T Consensus        13 kY~Cp~C~~~~C   24 (30)
T PF04438_consen   13 KYRCPRCGARYC   24 (30)
T ss_dssp             SEE-TTT--EES
T ss_pred             EEECCCcCCcee
Confidence            456666665443


No 203
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=29.47  E-value=32  Score=13.43  Aligned_cols=15  Identities=27%  Similarity=0.596  Sum_probs=10.1

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      +.|+|+.|..++...
T Consensus        79 ~lYeCnIC~etS~ee   93 (140)
T PF05290_consen   79 KLYECNICKETSAEE   93 (140)
T ss_pred             CceeccCcccccchh
Confidence            568888887655433


No 204
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=29.39  E-value=24  Score=10.03  Aligned_cols=7  Identities=14%  Similarity=0.468  Sum_probs=1.8

Q ss_pred             ccccccc
Q psy4412          10 LWCDYHT   16 (39)
Q Consensus        10 ~~c~~~~   16 (39)
                      ..|+..+
T Consensus         2 ~~C~~~~    8 (47)
T PF01844_consen    2 QYCGKPG    8 (47)
T ss_dssp             TTT--B-
T ss_pred             CCCCCcC
Confidence            3454443


No 205
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=29.33  E-value=25  Score=11.36  Aligned_cols=9  Identities=33%  Similarity=0.837  Sum_probs=2.7

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      .|.|..|+.
T Consensus        33 ~y~Cp~CgA   41 (55)
T PF05741_consen   33 KYVCPICGA   41 (55)
T ss_dssp             G---TTT--
T ss_pred             cCcCCCCcC
Confidence            367777764


No 206
>PF03691 UPF0167:  Uncharacterised protein family (UPF0167);  InterPro: IPR005363 The proteins in this family are about 200 amino acids long and each contain 3 CXXC motifs.
Probab=28.77  E-value=33  Score=13.91  Aligned_cols=11  Identities=45%  Similarity=1.165  Sum_probs=8.3

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      .|.|..|++-.
T Consensus       160 lFrClhCgk~~  170 (176)
T PF03691_consen  160 LFRCLHCGKHR  170 (176)
T ss_pred             EEEcCcCCcEE
Confidence            47899998743


No 207
>PLN03239 histone acetyltransferase; Provisional
Probab=28.75  E-value=58  Score=14.94  Aligned_cols=23  Identities=13%  Similarity=0.148  Sum_probs=18.3

Q ss_pred             cceeccccccccccchhHHHHhH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      ..|.|..|-+-|.....+..|+.
T Consensus       105 ~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        105 VLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             eEEEeccchhhhcCHHHHHHHHH
Confidence            46889999988888888887764


No 208
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=28.74  E-value=32  Score=10.61  Aligned_cols=13  Identities=23%  Similarity=0.399  Sum_probs=8.9

Q ss_pred             eeccccccccccc
Q psy4412           7 YACLWCDYHTLNS   19 (39)
Q Consensus         7 ~~c~~c~~~~~~~   19 (39)
                      +.|..|+..+...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            5788887766543


No 209
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=28.70  E-value=31  Score=12.58  Aligned_cols=12  Identities=17%  Similarity=0.146  Sum_probs=7.7

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            568888877653


No 210
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=28.43  E-value=29  Score=10.06  Aligned_cols=10  Identities=20%  Similarity=0.723  Sum_probs=5.6

Q ss_pred             cceecccccc
Q psy4412           5 YLYACLWCDY   14 (39)
Q Consensus         5 ~~~~c~~c~~   14 (39)
                      +.+.|..|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            4567887765


No 211
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=28.38  E-value=25  Score=9.30  Aligned_cols=10  Identities=40%  Similarity=1.321  Sum_probs=4.7

Q ss_pred             cceecccccc
Q psy4412           5 YLYACLWCDY   14 (39)
Q Consensus         5 ~~~~c~~c~~   14 (39)
                      ..|.|..|.-
T Consensus        14 ~~Y~C~~Cdf   23 (30)
T PF07649_consen   14 WFYRCSECDF   23 (30)
T ss_dssp             -EEE-TTT--
T ss_pred             ceEECccCCC
Confidence            4678888864


No 212
>KOG3014|consensus
Probab=28.35  E-value=65  Score=14.09  Aligned_cols=24  Identities=17%  Similarity=0.224  Sum_probs=16.0

Q ss_pred             eeccccccccc--cchhHHHHhHHhc
Q psy4412           7 YACLWCDYHTL--NSGHMRDHIRRHT   30 (39)
Q Consensus         7 ~~c~~c~~~~~--~~~~~~~~~~~~~   30 (39)
                      ..|..|+-.+.  ...+...|...|.
T Consensus        38 ~~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   38 VKCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             eehhhcCceecCCCHHHHHHHHHHHH
Confidence            47888986554  3455667777775


No 213
>COG4640 Predicted membrane protein [Function unknown]
Probab=28.35  E-value=68  Score=15.19  Aligned_cols=19  Identities=11%  Similarity=0.069  Sum_probs=13.0

Q ss_pred             cceeccccccccccchhHH
Q psy4412           5 YLYACLWCDYHTLNSGHMR   23 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~   23 (39)
                      -...|.+||..+.......
T Consensus        14 d~~qC~qCG~~~t~~~sqa   32 (465)
T COG4640          14 DDVQCTQCGHKFTSRQSQA   32 (465)
T ss_pred             ccccccccCCcCCchhhhh
Confidence            3456999998887665443


No 214
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=28.20  E-value=42  Score=15.63  Aligned_cols=11  Identities=18%  Similarity=0.712  Sum_probs=6.7

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      .|.|..|+...
T Consensus         7 ~y~C~~Cg~~~   17 (454)
T TIGR00416         7 KFVCQHCGADS   17 (454)
T ss_pred             eEECCcCCCCC
Confidence            36777777533


No 215
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=27.98  E-value=68  Score=14.64  Aligned_cols=24  Identities=21%  Similarity=0.290  Sum_probs=16.2

Q ss_pred             ceeccccccccccchhHHHHhHHh
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRH   29 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~   29 (39)
                      .|.|..|...|..--+.-.|...|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            477888877777766666665444


No 216
>KOG3352|consensus
Probab=27.79  E-value=31  Score=13.73  Aligned_cols=13  Identities=15%  Similarity=0.041  Sum_probs=8.7

Q ss_pred             cceeccccccccc
Q psy4412           5 YLYACLWCDYHTL   17 (39)
Q Consensus         5 ~~~~c~~c~~~~~   17 (39)
                      +...|.+|+.-|.
T Consensus       132 e~~rc~eCG~~fk  144 (153)
T KOG3352|consen  132 ETQRCPECGHYFK  144 (153)
T ss_pred             CcccCCcccceEE
Confidence            3456888887664


No 217
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=27.65  E-value=35  Score=12.06  Aligned_cols=12  Identities=17%  Similarity=0.160  Sum_probs=8.9

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      +.|..|++.+-.
T Consensus        74 ~~C~~Cg~i~~~   85 (116)
T cd07153          74 LICTKCGKVIDF   85 (116)
T ss_pred             eEeCCCCCEEEe
Confidence            678889986643


No 218
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=27.61  E-value=49  Score=13.39  Aligned_cols=20  Identities=20%  Similarity=0.891  Sum_probs=10.4

Q ss_pred             eeccccccccccchhHHHHh
Q psy4412           7 YACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~   26 (39)
                      |.|..|.........+..|.
T Consensus         1 F~Cs~CKfrtf~~~ei~~Hl   20 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHL   20 (165)
T ss_pred             CccceeeeecccHHHHHHHH
Confidence            35666665444444455543


No 219
>COG4855 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.46  E-value=33  Score=11.68  Aligned_cols=11  Identities=18%  Similarity=0.483  Sum_probs=7.0

Q ss_pred             ecccccccccc
Q psy4412           8 ACLWCDYHTLN   18 (39)
Q Consensus         8 ~c~~c~~~~~~   18 (39)
                      .|..|+.+...
T Consensus        25 iCIVCG~GlC~   35 (76)
T COG4855          25 ICIVCGMGLCM   35 (76)
T ss_pred             EEEEeCchHHH
Confidence            57777766543


No 220
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=27.38  E-value=26  Score=11.32  Aligned_cols=11  Identities=18%  Similarity=0.350  Sum_probs=7.3

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      ..|..|+..|.
T Consensus         6 ~~C~~Cg~~~~   16 (54)
T PF14446_consen    6 CKCPVCGKKFK   16 (54)
T ss_pred             ccChhhCCccc
Confidence            35777777664


No 221
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=27.23  E-value=38  Score=12.24  Aligned_cols=10  Identities=20%  Similarity=0.611  Sum_probs=6.4

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      +.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (91)
T TIGR00280        54 WTCRKCGAKF   63 (91)
T ss_pred             EEcCCCCCEE
Confidence            5677777654


No 222
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=27.14  E-value=15  Score=11.75  Aligned_cols=11  Identities=27%  Similarity=0.748  Sum_probs=7.3

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      |.|+.|..++.
T Consensus         8 y~CDLCn~~~p   18 (57)
T PF14445_consen    8 YSCDLCNSSHP   18 (57)
T ss_pred             HhHHhhcccCc
Confidence            56777776554


No 223
>TIGR00320 dfx_rbo desulfoferrodoxin. This protein is described in some articles as rubredoxin oxidoreductase (rbo), and its gene shares an operon with the rubredoxin gene in Desulfovibrio vulgaris Hildenborough.
Probab=27.13  E-value=39  Score=12.78  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=8.2

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      -|.|..|+...
T Consensus         7 fYkC~~CGniv   17 (125)
T TIGR00320         7 VYKCEVCGNIV   17 (125)
T ss_pred             EEECCCCCcEE
Confidence            47888888765


No 224
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=26.63  E-value=22  Score=14.61  Aligned_cols=26  Identities=15%  Similarity=0.188  Sum_probs=0.0

Q ss_pred             eeccccccccccchhHHHHhHHhcCCC
Q psy4412           7 YACLWCDYHTLNSGHMRDHIRRHTGEK   33 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~~~~~~~   33 (39)
                      ..|..||.... ...+..|+++.....
T Consensus       169 ~~cPitGe~IP-~~e~~eHmRi~LlDP  194 (229)
T PF12230_consen  169 IICPITGEMIP-ADEMDEHMRIELLDP  194 (229)
T ss_dssp             ---------------------------
T ss_pred             ccccccccccc-ccccccccccccccc
Confidence            46888887443 455788888766543


No 225
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=26.62  E-value=35  Score=11.10  Aligned_cols=12  Identities=17%  Similarity=0.221  Sum_probs=4.7

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      ..|..|++....
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            357777765443


No 226
>TIGR02986 restrict_Alw26I type II restriction endonuclease, Alw26I/Eco31I/Esp3I family. Members of this family are type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family. Characterized specificities of three members are GGTCTC, CGTCTC, and the shared subsequence GTCTC.
Probab=25.95  E-value=19  Score=16.60  Aligned_cols=9  Identities=22%  Similarity=0.479  Sum_probs=5.9

Q ss_pred             ccccccccc
Q psy4412           9 CLWCDYHTL   17 (39)
Q Consensus         9 c~~c~~~~~   17 (39)
                      |..||+.+.
T Consensus        85 C~~CG~~m~   93 (424)
T TIGR02986        85 CQTCGKTMS   93 (424)
T ss_pred             hHhcCCeee
Confidence            677777553


No 227
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=25.86  E-value=36  Score=10.28  Aligned_cols=12  Identities=17%  Similarity=0.124  Sum_probs=7.2

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      .+.|..|+..+.
T Consensus        18 k~~Cr~Cg~~~C   29 (57)
T cd00065          18 RHHCRNCGRIFC   29 (57)
T ss_pred             ccccCcCcCCcC
Confidence            345666776654


No 228
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=25.70  E-value=34  Score=10.86  Aligned_cols=8  Identities=25%  Similarity=0.854  Sum_probs=4.1

Q ss_pred             cccccccc
Q psy4412           9 CLWCDYHT   16 (39)
Q Consensus         9 c~~c~~~~   16 (39)
                      |..|+..+
T Consensus         3 CPyCge~~   10 (52)
T PF14255_consen    3 CPYCGEPI   10 (52)
T ss_pred             CCCCCCee
Confidence            55555543


No 229
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=25.62  E-value=41  Score=11.72  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=7.1

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      -|.|..|+...
T Consensus         4 ~Y~CRHCg~~I   14 (76)
T PF10955_consen    4 HYYCRHCGTKI   14 (76)
T ss_pred             EEEecCCCCEE
Confidence            36788887533


No 230
>PF01475 FUR:  Ferric uptake regulator family;  InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins. These are responsible for controlling the intracellular concentration of iron in many bacteria. Although iron is essential for most organisms, high concentrations can be toxic because of the formation of hydroxyl radicals []. FURs can also control zinc homeostasis [] and is the subject of research on the pathogenesis of mycobacteria.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1MZB_A 2RGV_B 2FE3_B 3F8N_B 3EYY_B 2W57_A 2FU4_A 2O03_A 3MWM_B 2XIG_B ....
Probab=25.59  E-value=38  Score=12.15  Aligned_cols=13  Identities=15%  Similarity=0.314  Sum_probs=8.0

Q ss_pred             eeccccccccccc
Q psy4412           7 YACLWCDYHTLNS   19 (39)
Q Consensus         7 ~~c~~c~~~~~~~   19 (39)
                      +.|..|++...-.
T Consensus        81 ~iC~~Cg~v~~~~   93 (120)
T PF01475_consen   81 FICTQCGKVIDLD   93 (120)
T ss_dssp             EEETTTS-EEEE-
T ss_pred             EEECCCCCEEEec
Confidence            5788999866443


No 231
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=25.46  E-value=44  Score=11.43  Aligned_cols=16  Identities=13%  Similarity=0.243  Sum_probs=10.5

Q ss_pred             ceecc--ccccccccchh
Q psy4412           6 LYACL--WCDYHTLNSGH   21 (39)
Q Consensus         6 ~~~c~--~c~~~~~~~~~   21 (39)
                      -+.|.  .|+..|.....
T Consensus        27 Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678         27 YHQCQNVNCSATFITYES   44 (72)
T ss_pred             eeecCCCCCCCEEEEEEE
Confidence            35676  78888765543


No 232
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=24.79  E-value=45  Score=12.02  Aligned_cols=11  Identities=18%  Similarity=0.646  Sum_probs=6.8

Q ss_pred             ceecccccccc
Q psy4412           6 LYACLWCDYHT   16 (39)
Q Consensus         6 ~~~c~~c~~~~   16 (39)
                      .+.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            35677777654


No 233
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=24.75  E-value=37  Score=10.02  Aligned_cols=6  Identities=33%  Similarity=1.065  Sum_probs=2.6

Q ss_pred             cccccc
Q psy4412           9 CLWCDY   14 (39)
Q Consensus         9 c~~c~~   14 (39)
                      |+.|++
T Consensus         1 Cd~CG~    6 (37)
T PF08394_consen    1 CDYCGG    6 (37)
T ss_pred             CCccCC
Confidence            344444


No 234
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=24.52  E-value=36  Score=9.80  Aligned_cols=17  Identities=18%  Similarity=0.405  Sum_probs=10.8

Q ss_pred             eeccccccccccchhHH
Q psy4412           7 YACLWCDYHTLNSGHMR   23 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~   23 (39)
                      ..|..|+..+.....+.
T Consensus        20 d~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EECCCCCeEEccHHHHH
Confidence            45777777766555544


No 235
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=24.51  E-value=25  Score=14.51  Aligned_cols=21  Identities=19%  Similarity=0.445  Sum_probs=0.0

Q ss_pred             cceecccccccc-ccchhHHHH
Q psy4412           5 YLYACLWCDYHT-LNSGHMRDH   25 (39)
Q Consensus         5 ~~~~c~~c~~~~-~~~~~~~~~   25 (39)
                      +.|.|..||... .-+..+..|
T Consensus       100 ~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen  100 VEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ----------------------
T ss_pred             CeeeeEeCCCcceecHHHHHHh
Confidence            358899999633 233444444


No 236
>PF12523 DUF3725:  Protein of unknown function (DUF3725);  InterPro: IPR022199  This domain family is found in viruses, and is approximately 70 amino acids in length. The family is found in association with PF01577 from PFAM. There is a conserved FLE sequence motif. 
Probab=24.49  E-value=49  Score=11.33  Aligned_cols=12  Identities=33%  Similarity=0.769  Sum_probs=7.7

Q ss_pred             Ccceeccccccc
Q psy4412           4 TYLYACLWCDYH   15 (39)
Q Consensus         4 ~~~~~c~~c~~~   15 (39)
                      ...+.|..|+++
T Consensus        57 ~Elw~Ch~C~~t   68 (74)
T PF12523_consen   57 SELWECHSCDNT   68 (74)
T ss_pred             cceEEeecCCCc
Confidence            345677777764


No 237
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=24.35  E-value=37  Score=9.96  Aligned_cols=9  Identities=33%  Similarity=0.637  Sum_probs=3.4

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      |..|..|.+
T Consensus        13 ~~dC~~C~~   21 (41)
T PF10588_consen   13 PLDCPTCDK   21 (41)
T ss_dssp             ---TTT-TT
T ss_pred             CCcCcCCCC
Confidence            556777764


No 238
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=24.32  E-value=56  Score=12.09  Aligned_cols=12  Identities=17%  Similarity=0.241  Sum_probs=8.3

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      ...|+.|++...
T Consensus        20 ~v~CdnCg~~vP   31 (108)
T COG4830          20 YVRCDNCGKAVP   31 (108)
T ss_pred             ceeeccccccCC
Confidence            457888887543


No 239
>KOG1280|consensus
Probab=24.16  E-value=93  Score=14.47  Aligned_cols=25  Identities=12%  Similarity=0.487  Sum_probs=17.9

Q ss_pred             ceeccccccccccchhHHHHhHHhc
Q psy4412           6 LYACLWCDYHTLNSGHMRDHIRRHT   30 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~~~~~   30 (39)
                      .|.|..|+..-.....+..|.....
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~H  103 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQH  103 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcC
Confidence            5788888877677777777765433


No 240
>KOG0227|consensus
Probab=24.07  E-value=49  Score=13.87  Aligned_cols=21  Identities=29%  Similarity=0.444  Sum_probs=13.9

Q ss_pred             ceeccccccccccchhHHHHh
Q psy4412           6 LYACLWCDYHTLNSGHMRDHI   26 (39)
Q Consensus         6 ~~~c~~c~~~~~~~~~~~~~~   26 (39)
                      .|.|..|.-...+..+...|.
T Consensus        53 ~yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   53 KYECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             ceeehhhhhhhcchhhhhhhh
Confidence            478888876666666665553


No 241
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PHA00689 hypothetical protein
Probab=23.99  E-value=43  Score=10.57  Aligned_cols=13  Identities=23%  Similarity=0.422  Sum_probs=8.0

Q ss_pred             cceeccccccccc
Q psy4412           5 YLYACLWCDYHTL   17 (39)
Q Consensus         5 ~~~~c~~c~~~~~   17 (39)
                      +...|..|++.-.
T Consensus        16 ravtckrcgktgl   28 (62)
T PHA00689         16 RAVTCKRCGKTGL   28 (62)
T ss_pred             ceeehhhccccCc
Confidence            3456777876543


No 243
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=23.96  E-value=33  Score=10.54  Aligned_cols=7  Identities=29%  Similarity=1.179  Sum_probs=2.3

Q ss_pred             eeccccc
Q psy4412           7 YACLWCD   13 (39)
Q Consensus         7 ~~c~~c~   13 (39)
                      +.|..|+
T Consensus        42 W~CPiC~   48 (50)
T PF02891_consen   42 WKCPICN   48 (50)
T ss_dssp             -B-TTT-
T ss_pred             eECcCCc
Confidence            4565554


No 244
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=23.95  E-value=35  Score=9.48  Aligned_cols=8  Identities=25%  Similarity=0.601  Sum_probs=4.8

Q ss_pred             eecccccc
Q psy4412           7 YACLWCDY   14 (39)
Q Consensus         7 ~~c~~c~~   14 (39)
                      +.|..|+.
T Consensus        20 ~vCp~C~~   27 (30)
T PF08274_consen   20 LVCPECGH   27 (30)
T ss_dssp             EEETTTTE
T ss_pred             EeCCcccc
Confidence            56666653


No 245
>KOG4118|consensus
Probab=23.88  E-value=50  Score=11.23  Aligned_cols=21  Identities=14%  Similarity=0.390  Sum_probs=11.5

Q ss_pred             eeccccccccccchhHHHHhH
Q psy4412           7 YACLWCDYHTLNSGHMRDHIR   27 (39)
Q Consensus         7 ~~c~~c~~~~~~~~~~~~~~~   27 (39)
                      +.|.+|.-.......+..|.-
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe   59 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFE   59 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHh
Confidence            456666655554455555543


No 246
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=23.60  E-value=46  Score=11.23  Aligned_cols=9  Identities=22%  Similarity=0.778  Sum_probs=5.6

Q ss_pred             eeccccccc
Q psy4412           7 YACLWCDYH   15 (39)
Q Consensus         7 ~~c~~c~~~   15 (39)
                      |.|..|+..
T Consensus         5 FTC~~C~~R   13 (66)
T PF05180_consen    5 FTCNKCGTR   13 (66)
T ss_dssp             EEETTTTEE
T ss_pred             EEcCCCCCc
Confidence            567777643


No 247
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=23.58  E-value=43  Score=11.73  Aligned_cols=10  Identities=20%  Similarity=0.770  Sum_probs=4.6

Q ss_pred             ceeccccccc
Q psy4412           6 LYACLWCDYH   15 (39)
Q Consensus         6 ~~~c~~c~~~   15 (39)
                      .|.|..|++.
T Consensus        65 ~~~Cp~Cg~~   74 (81)
T PF10609_consen   65 YFVCPHCGER   74 (81)
T ss_dssp             EEE-TTT--E
T ss_pred             ccCCCCCCCe
Confidence            3678887754


No 248
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=23.55  E-value=49  Score=11.93  Aligned_cols=10  Identities=20%  Similarity=0.591  Sum_probs=6.2

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      +.|..|++.|
T Consensus        55 W~C~~C~~~~   64 (90)
T PRK03976         55 WECRKCGAKF   64 (90)
T ss_pred             EEcCCCCCEE
Confidence            5666676644


No 249
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=23.52  E-value=13  Score=16.19  Aligned_cols=24  Identities=21%  Similarity=0.371  Sum_probs=13.9

Q ss_pred             cceeccccccccccchhHHHHhHH
Q psy4412           5 YLYACLWCDYHTLNSGHMRDHIRR   28 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~~~~~~~~~~   28 (39)
                      +++.|+.|+........|....+.
T Consensus       208 k~~PCPKCg~et~eTkdLSmStR~  231 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSMSTRS  231 (314)
T ss_pred             CCCCCCCCCCcccccccceeeeec
Confidence            466788887655555555443333


No 250
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=23.30  E-value=49  Score=11.40  Aligned_cols=15  Identities=20%  Similarity=0.262  Sum_probs=10.3

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      .|..|-.||+.....
T Consensus         3 iPVRCFTCGkvig~~   17 (71)
T PLN00032          3 IPVRCFTCGKVIGNK   17 (71)
T ss_pred             CceeecCCCCCcHHH
Confidence            467788888866444


No 251
>KOG3456|consensus
Probab=22.97  E-value=38  Score=12.69  Aligned_cols=13  Identities=15%  Similarity=0.472  Sum_probs=8.6

Q ss_pred             ceecccccccccc
Q psy4412           6 LYACLWCDYHTLN   18 (39)
Q Consensus         6 ~~~c~~c~~~~~~   18 (39)
                      +..|..|+..|.+
T Consensus       104 ~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  104 PHICGYCGLRFVQ  116 (120)
T ss_pred             Ccccccchhhhhh
Confidence            4567778776643


No 252
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=22.73  E-value=42  Score=9.98  Aligned_cols=12  Identities=17%  Similarity=0.146  Sum_probs=6.8

Q ss_pred             cceecccccccc
Q psy4412           5 YLYACLWCDYHT   16 (39)
Q Consensus         5 ~~~~c~~c~~~~   16 (39)
                      .|..|..|++..
T Consensus        10 ~~~~C~~C~~~i   21 (53)
T PF00130_consen   10 KPTYCDVCGKFI   21 (53)
T ss_dssp             STEB-TTSSSBE
T ss_pred             CCCCCcccCccc
Confidence            455677777654


No 253
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=22.58  E-value=42  Score=11.15  Aligned_cols=10  Identities=20%  Similarity=0.524  Sum_probs=6.9

Q ss_pred             eccccccccc
Q psy4412           8 ACLWCDYHTL   17 (39)
Q Consensus         8 ~c~~c~~~~~   17 (39)
                      .|..|+++..
T Consensus        10 HC~VCg~aIp   19 (64)
T COG4068          10 HCVVCGKAIP   19 (64)
T ss_pred             cccccCCcCC
Confidence            5888887543


No 254
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=22.55  E-value=46  Score=12.24  Aligned_cols=9  Identities=22%  Similarity=0.633  Sum_probs=5.1

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      |-.|..|+.
T Consensus         2 p~~CpYCg~   10 (102)
T PF11672_consen    2 PIICPYCGG   10 (102)
T ss_pred             CcccCCCCC
Confidence            445666664


No 255
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=22.53  E-value=41  Score=10.25  Aligned_cols=7  Identities=29%  Similarity=0.923  Sum_probs=3.5

Q ss_pred             ecccccc
Q psy4412           8 ACLWCDY   14 (39)
Q Consensus         8 ~c~~c~~   14 (39)
                      .|..|+.
T Consensus         2 ~C~~Cg~    8 (45)
T cd02336           2 HCFTCGN    8 (45)
T ss_pred             cccCCCC
Confidence            3555554


No 256
>PRK12860 transcriptional activator FlhC; Provisional
Probab=22.45  E-value=80  Score=13.12  Aligned_cols=10  Identities=20%  Similarity=0.521  Sum_probs=4.7

Q ss_pred             eccccccccc
Q psy4412           8 ACLWCDYHTL   17 (39)
Q Consensus         8 ~c~~c~~~~~   17 (39)
                      .|..|+..|.
T Consensus       136 ~C~~Cgg~fv  145 (189)
T PRK12860        136 RCCRCGGKFV  145 (189)
T ss_pred             cCCCCCCCee
Confidence            3455554443


No 257
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=22.13  E-value=31  Score=13.33  Aligned_cols=11  Identities=18%  Similarity=0.416  Sum_probs=7.0

Q ss_pred             ecccccccccc
Q psy4412           8 ACLWCDYHTLN   18 (39)
Q Consensus         8 ~c~~c~~~~~~   18 (39)
                      .|..|++.|..
T Consensus         5 nC~~CgklF~~   15 (137)
T TIGR03826         5 NCPKCGRLFVK   15 (137)
T ss_pred             cccccchhhhh
Confidence            46777776654


No 258
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=21.91  E-value=50  Score=10.51  Aligned_cols=8  Identities=38%  Similarity=1.269  Sum_probs=4.9

Q ss_pred             ceeccccc
Q psy4412           6 LYACLWCD   13 (39)
Q Consensus         6 ~~~c~~c~   13 (39)
                      .|.|..|+
T Consensus        44 ~y~C~~Cg   51 (54)
T PF10058_consen   44 QYRCPYCG   51 (54)
T ss_pred             EEEcCCCC
Confidence            36666665


No 259
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=21.91  E-value=50  Score=10.99  Aligned_cols=7  Identities=57%  Similarity=1.516  Sum_probs=3.1

Q ss_pred             eeccccc
Q psy4412           7 YACLWCD   13 (39)
Q Consensus         7 ~~c~~c~   13 (39)
                      +.|..|+
T Consensus        78 ~~C~~C~   84 (85)
T PF04032_consen   78 YTCLNCG   84 (85)
T ss_dssp             EEETTTT
T ss_pred             EEccccC
Confidence            3444443


No 260
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.85  E-value=48  Score=12.28  Aligned_cols=12  Identities=17%  Similarity=0.191  Sum_probs=8.3

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      ..|..|+..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            578888866544


No 261
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=21.77  E-value=52  Score=10.70  Aligned_cols=12  Identities=17%  Similarity=0.205  Sum_probs=8.2

Q ss_pred             ceeccccccccc
Q psy4412           6 LYACLWCDYHTL   17 (39)
Q Consensus         6 ~~~c~~c~~~~~   17 (39)
                      -..|..|+..|.
T Consensus        53 ~L~Cp~c~r~YP   64 (68)
T PF03966_consen   53 ELICPECGREYP   64 (68)
T ss_dssp             EEEETTTTEEEE
T ss_pred             EEEcCCCCCEEe
Confidence            356788877664


No 262
>PF09665 RE_Alw26IDE:  Type II restriction endonuclease (RE_Alw26IDE);  InterPro: IPR014328 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family [], whose recognition sequences are 5'-GTCTC-3' (Alw26I), 5'-GGTCTC-3' (Eco31I) and 5'-CGTCTC-3' (Esp3I).
Probab=21.76  E-value=43  Score=16.06  Aligned_cols=8  Identities=25%  Similarity=0.526  Sum_probs=5.4

Q ss_pred             cccccccc
Q psy4412           9 CLWCDYHT   16 (39)
Q Consensus         9 c~~c~~~~   16 (39)
                      |..||+.+
T Consensus        85 Ck~CG~~m   92 (511)
T PF09665_consen   85 CKTCGKIM   92 (511)
T ss_pred             hHhcCCee
Confidence            67777654


No 263
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=21.73  E-value=54  Score=12.06  Aligned_cols=12  Identities=17%  Similarity=0.072  Sum_probs=8.2

Q ss_pred             eecccccccccc
Q psy4412           7 YACLWCDYHTLN   18 (39)
Q Consensus         7 ~~c~~c~~~~~~   18 (39)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PRK12380         71 AWCWDCSQVVEI   82 (113)
T ss_pred             EEcccCCCEEec
Confidence            568888866543


No 264
>PTZ00157 60S ribosomal protein L36a; Provisional
Probab=21.19  E-value=52  Score=11.73  Aligned_cols=10  Identities=20%  Similarity=0.574  Sum_probs=6.9

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      +.|..|++..
T Consensus        70 l~C~~C~~~~   79 (84)
T PTZ00157         70 LECTKCKSKR   79 (84)
T ss_pred             EEecccCcee
Confidence            6788887643


No 265
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.18  E-value=50  Score=11.16  Aligned_cols=11  Identities=18%  Similarity=0.459  Sum_probs=7.5

Q ss_pred             eeccccccccc
Q psy4412           7 YACLWCDYHTL   17 (39)
Q Consensus         7 ~~c~~c~~~~~   17 (39)
                      ..|..|++...
T Consensus         8 v~CP~Cgkpv~   18 (65)
T COG3024           8 VPCPTCGKPVV   18 (65)
T ss_pred             ccCCCCCCccc
Confidence            46888887543


No 266
>KOG1813|consensus
Probab=21.06  E-value=50  Score=14.80  Aligned_cols=14  Identities=14%  Similarity=0.455  Sum_probs=9.7

Q ss_pred             cceecccccccccc
Q psy4412           5 YLYACLWCDYHTLN   18 (39)
Q Consensus         5 ~~~~c~~c~~~~~~   18 (39)
                      .|+.|..|.+.|..
T Consensus       240 ~Pf~c~icr~~f~~  253 (313)
T KOG1813|consen  240 LPFKCFICRKYFYR  253 (313)
T ss_pred             CCcccccccccccc
Confidence            47778888776644


No 267
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=20.98  E-value=23  Score=13.71  Aligned_cols=10  Identities=30%  Similarity=0.630  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|...|
T Consensus       131 ~~c~~c~epf  140 (146)
T TIGR02159       131 YRCRACKEPF  140 (146)
T ss_pred             hhhhhhCCcH
Confidence            4455554444


No 268
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=20.97  E-value=49  Score=12.01  Aligned_cols=10  Identities=30%  Similarity=0.717  Sum_probs=7.3

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      +.|..|++..
T Consensus        68 ~~C~~C~~~~   77 (92)
T PRK05767         68 YRCTECGKAH   77 (92)
T ss_pred             EEecccChhh
Confidence            6788888654


No 269
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.97  E-value=50  Score=10.23  Aligned_cols=9  Identities=22%  Similarity=0.549  Sum_probs=4.9

Q ss_pred             ceecccccc
Q psy4412           6 LYACLWCDY   14 (39)
Q Consensus         6 ~~~c~~c~~   14 (39)
                      ...|+.|+.
T Consensus        46 i~~Cp~CgR   54 (56)
T PF02591_consen   46 IVFCPNCGR   54 (56)
T ss_pred             eEECcCCCc
Confidence            345666654


No 270
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=20.83  E-value=75  Score=15.04  Aligned_cols=15  Identities=13%  Similarity=0.313  Sum_probs=9.5

Q ss_pred             Ccceecccccccccc
Q psy4412           4 TYLYACLWCDYHTLN   18 (39)
Q Consensus         4 ~~~~~c~~c~~~~~~   18 (39)
                      ..-|.|..|+..+..
T Consensus       365 ~~g~rC~kCg~~~~~  379 (421)
T COG1571         365 RNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCcccccccccCCc
Confidence            336778888765543


No 271
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=20.80  E-value=56  Score=10.98  Aligned_cols=15  Identities=13%  Similarity=0.208  Sum_probs=9.7

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      .|..|-.||+.....
T Consensus         3 iPiRCFsCGkvi~~~   17 (63)
T COG1644           3 IPVRCFSCGKVIGHK   17 (63)
T ss_pred             CceEeecCCCCHHHH
Confidence            366788888765443


No 272
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=20.78  E-value=26  Score=11.43  Aligned_cols=10  Identities=20%  Similarity=0.458  Sum_probs=4.8

Q ss_pred             eccccccccc
Q psy4412           8 ACLWCDYHTL   17 (39)
Q Consensus         8 ~c~~c~~~~~   17 (39)
                      .|..|.+.+.
T Consensus        18 ~C~~C~k~L~   27 (58)
T PF04570_consen   18 FCYLCKKKLD   27 (58)
T ss_pred             HHHccCCCCC
Confidence            3555555443


No 273
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=20.72  E-value=61  Score=12.96  Aligned_cols=10  Identities=40%  Similarity=1.029  Sum_probs=6.8

Q ss_pred             ceeccccccc
Q psy4412           6 LYACLWCDYH   15 (39)
Q Consensus         6 ~~~c~~c~~~   15 (39)
                      .+.|..|+..
T Consensus        28 sf~C~~CGyr   37 (163)
T TIGR00340        28 TYICEKCGYR   37 (163)
T ss_pred             EEECCCCCCc
Confidence            3678888754


No 274
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=20.66  E-value=53  Score=10.85  Aligned_cols=14  Identities=14%  Similarity=0.294  Sum_probs=8.6

Q ss_pred             ceeccccccccccc
Q psy4412           6 LYACLWCDYHTLNS   19 (39)
Q Consensus         6 ~~~c~~c~~~~~~~   19 (39)
                      +..|..||......
T Consensus         4 ~lvCSTCGrDlSee   17 (63)
T PF05864_consen    4 QLVCSTCGRDLSEE   17 (63)
T ss_pred             eeeecccCCcchHH
Confidence            34677888765443


No 275
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=20.66  E-value=33  Score=9.93  Aligned_cols=8  Identities=25%  Similarity=0.493  Sum_probs=4.4

Q ss_pred             eccccccc
Q psy4412           8 ACLWCDYH   15 (39)
Q Consensus         8 ~c~~c~~~   15 (39)
                      .|..|+..
T Consensus         3 ~CP~Cg~~   10 (39)
T PF01396_consen    3 KCPKCGGP   10 (39)
T ss_pred             CCCCCCce
Confidence            36666643


No 276
>KOG3497|consensus
Probab=20.39  E-value=60  Score=10.85  Aligned_cols=15  Identities=13%  Similarity=0.235  Sum_probs=10.0

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      .|..|-.|++....+
T Consensus         3 iPiRCFtCGKvig~K   17 (69)
T KOG3497|consen    3 IPIRCFTCGKVIGDK   17 (69)
T ss_pred             eeeEeeecccccccc
Confidence            466788888765544


No 277
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.36  E-value=91  Score=12.94  Aligned_cols=8  Identities=38%  Similarity=0.787  Sum_probs=3.8

Q ss_pred             cccccccc
Q psy4412           9 CLWCDYHT   16 (39)
Q Consensus         9 c~~c~~~~   16 (39)
                      |..|+..|
T Consensus       137 C~~Cgg~f  144 (187)
T PRK12722        137 CNCCGGHF  144 (187)
T ss_pred             CCCCCCCe
Confidence            44455444


No 278
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=20.30  E-value=36  Score=14.00  Aligned_cols=15  Identities=13%  Similarity=0.184  Sum_probs=9.6

Q ss_pred             cceeccccccccccc
Q psy4412           5 YLYACLWCDYHTLNS   19 (39)
Q Consensus         5 ~~~~c~~c~~~~~~~   19 (39)
                      ++-.|..|+..|...
T Consensus         5 k~rKCKvCg~~F~P~   19 (189)
T PF05766_consen    5 KRRKCKVCGEWFVPA   19 (189)
T ss_pred             CCCcCcccCCccccC
Confidence            345677888777543


No 279
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.13  E-value=62  Score=13.46  Aligned_cols=10  Identities=50%  Similarity=1.232  Sum_probs=7.2

Q ss_pred             eecccccccc
Q psy4412           7 YACLWCDYHT   16 (39)
Q Consensus         7 ~~c~~c~~~~   16 (39)
                      |.|..|.++.
T Consensus        50 YkC~~Cd~tW   59 (203)
T COG4332          50 YKCTHCDYTW   59 (203)
T ss_pred             EEeeccCCcc
Confidence            7788887654


No 280
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=20.00  E-value=61  Score=11.43  Aligned_cols=9  Identities=44%  Similarity=1.165  Sum_probs=4.5

Q ss_pred             eeccccccc
Q psy4412           7 YACLWCDYH   15 (39)
Q Consensus         7 ~~c~~c~~~   15 (39)
                      |.|..|+..
T Consensus        91 y~C~~C~~~   99 (104)
T TIGR01384        91 YKCTKCGYV   99 (104)
T ss_pred             EEeCCCCCe
Confidence            455555543


Done!