Query         psy4421
Match_columns 167
No_of_seqs    123 out of 1105
Neff          10.5
Searched_HMMs 46136
Date          Fri Aug 16 16:41:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4421.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4421hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 6.1E-31 1.3E-35  181.9   5.7  134    6-165   129-265 (279)
  2 KOG2462|consensus               99.9 7.5E-24 1.6E-28  146.9   5.0  109   41-167   128-239 (279)
  3 KOG1074|consensus               99.8   6E-20 1.3E-24  143.3   1.7   56    7-70    353-408 (958)
  4 KOG1074|consensus               99.7 4.9E-19 1.1E-23  138.2   3.3   52  116-167   880-931 (958)
  5 KOG3608|consensus               99.7 8.3E-18 1.8E-22  120.5   4.9  134    7-167   237-376 (467)
  6 KOG3608|consensus               99.7   1E-17 2.3E-22  120.0   4.1  106   43-166   237-344 (467)
  7 KOG3576|consensus               99.7 1.2E-17 2.6E-22  111.3   2.9  110   42-167   116-236 (267)
  8 KOG3576|consensus               99.6 9.2E-17   2E-21  107.1   1.8  122    4-142   114-239 (267)
  9 KOG3623|consensus               99.6 1.5E-16 3.2E-21  123.2   3.1  113   44-165   211-331 (1007)
 10 KOG3623|consensus               99.4 2.9E-14 6.3E-19  110.7   1.2   84    2-102   889-972 (1007)
 11 PLN03086 PRLI-interacting fact  99.3 1.4E-11   3E-16   95.5   7.6  104   41-167   451-564 (567)
 12 PHA00733 hypothetical protein   99.2 9.9E-12 2.1E-16   79.5   3.6   98   57-167    26-123 (128)
 13 PHA02768 hypothetical protein;  99.1 3.1E-11 6.8E-16   64.5   1.9   44  115-160     5-48  (55)
 14 PF13465 zf-H2C2_2:  Zinc-finge  99.0   5E-10 1.1E-14   51.4   2.6   26  130-155     1-26  (26)
 15 PLN03086 PRLI-interacting fact  99.0 1.8E-09 3.9E-14   83.9   6.7  102    4-136   450-561 (567)
 16 PHA00733 hypothetical protein   98.9 2.1E-09 4.6E-14   68.8   5.3   87    2-102    35-121 (128)
 17 KOG3993|consensus               98.9   5E-10 1.1E-14   82.7   1.5  157    2-167   262-482 (500)
 18 PHA02768 hypothetical protein;  98.7 3.1E-09 6.8E-14   56.8   0.4   42   44-96      6-47  (55)
 19 PHA00732 hypothetical protein   98.5 9.5E-08 2.1E-12   55.8   2.9   45  115-165     1-46  (79)
 20 PHA00616 hypothetical protein   98.5 5.4E-08 1.2E-12   49.6   1.1   34  115-148     1-34  (44)
 21 PF05605 zf-Di19:  Drought indu  98.4 5.8E-07 1.3E-11   48.8   3.6   50  115-167     2-53  (54)
 22 PHA00616 hypothetical protein   98.3   4E-07 8.7E-12   46.4   1.7   31   43-73      1-31  (44)
 23 KOG3993|consensus               98.3   2E-07 4.3E-12   69.3   0.3   78   82-167   270-380 (500)
 24 PF00096 zf-C2H2:  Zinc finger,  98.2 6.2E-07 1.4E-11   39.7   1.5   22  144-165     1-22  (23)
 25 PF13465 zf-H2C2_2:  Zinc-finge  98.2 8.8E-07 1.9E-11   40.5   1.6   15   59-73      2-16  (26)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.2E-06 2.5E-11   39.1   1.8   24  144-167     1-24  (24)
 27 PHA00732 hypothetical protein   98.1 1.7E-06 3.6E-11   50.6   2.1   47    7-67      1-48  (79)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.1 2.8E-06 6.1E-11   39.1   2.0   25  143-167     1-25  (27)
 29 PF00096 zf-C2H2:  Zinc finger,  98.0 5.6E-06 1.2E-10   36.6   2.4   23   44-66      1-23  (23)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.5E-05 3.2E-10   48.7   2.5   72   82-166     2-73  (100)
 31 PF05605 zf-Di19:  Drought indu  97.7 3.8E-05 8.3E-10   41.6   2.6   47    8-65      3-51  (54)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.6 8.2E-05 1.8E-09   32.8   2.6   23   44-66      1-23  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.5 4.9E-05 1.1E-09   34.9   1.1   25  115-139     1-25  (27)
 34 COG5189 SFP1 Putative transcri  97.5 5.6E-05 1.2E-09   54.7   1.7   52  113-164   347-419 (423)
 35 smart00355 ZnF_C2H2 zinc finge  97.4 8.4E-05 1.8E-09   33.3   1.4   23  144-166     1-23  (26)
 36 PRK04860 hypothetical protein;  97.4 0.00013 2.7E-09   48.6   2.4   40  114-157   118-157 (160)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00018 3.9E-09   43.8   2.0   72   45-138     1-73  (100)
 38 PF09237 GAGA:  GAGA factor;  I  97.2 0.00041   9E-09   36.3   2.8   34  110-143    19-52  (54)
 39 PF12874 zf-met:  Zinc-finger o  97.1 0.00028 6.1E-09   31.6   1.5   22  144-165     1-22  (25)
 40 PF09237 GAGA:  GAGA factor;  I  97.1 0.00095 2.1E-08   35.0   3.1   33   39-71     20-52  (54)
 41 COG5189 SFP1 Putative transcri  97.1 0.00036 7.8E-09   50.6   2.0   70   41-136   347-419 (423)
 42 smart00355 ZnF_C2H2 zinc finge  97.0 0.00084 1.8E-08   29.9   2.4   24   44-67      1-24  (26)
 43 PF13909 zf-H2C2_5:  C2H2-type   96.9  0.0013 2.7E-08   29.1   2.7   23   44-67      1-23  (24)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00045 9.7E-09   30.6   1.0   23  144-167     1-23  (24)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00089 1.9E-08   30.6   0.9   22  144-165     2-23  (27)
 46 PF12874 zf-met:  Zinc-finger o  96.5  0.0021 4.5E-08   28.6   1.6   22   44-65      1-22  (25)
 47 PF13913 zf-C2HC_2:  zinc-finge  95.6  0.0096 2.1E-07   26.6   1.6   21  144-165     3-23  (25)
 48 COG5048 FOG: Zn-finger [Genera  95.5  0.0031 6.7E-08   48.2  -0.3   60    6-73    288-353 (467)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5   0.016 3.4E-07   26.3   2.2   17    8-24      2-18  (27)
 50 smart00451 ZnF_U1 U1-like zinc  95.1    0.02 4.3E-07   27.6   1.9   23  143-165     3-25  (35)
 51 PRK04860 hypothetical protein;  94.9   0.023 4.9E-07   37.9   2.4   35   42-88    118-152 (160)
 52 KOG2231|consensus               94.6    0.12 2.5E-06   42.1   5.9   48  116-167   183-236 (669)
 53 KOG2893|consensus               93.8   0.027 5.9E-07   39.6   0.9   32   46-89     13-44  (341)
 54 cd00350 rubredoxin_like Rubred  93.5   0.047   1E-06   26.1   1.3   24  116-151     2-25  (33)
 55 COG4049 Uncharacterized protei  92.9   0.045 9.8E-07   29.2   0.7   24  140-163    14-37  (65)
 56 smart00451 ZnF_U1 U1-like zinc  92.9    0.11 2.5E-06   24.8   2.2   23   43-65      3-25  (35)
 57 PHA00626 hypothetical protein   92.3   0.069 1.5E-06   28.6   0.9   13  142-154    22-34  (59)
 58 COG5048 FOG: Zn-finger [Genera  92.0   0.052 1.1E-06   41.5   0.4   53  114-166   288-346 (467)
 59 KOG2231|consensus               91.8    0.65 1.4E-05   37.9   6.2   93   52-164   158-260 (669)
 60 KOG2482|consensus               91.3    0.63 1.4E-05   34.7   5.2   55   82-136   147-216 (423)
 61 KOG1146|consensus               91.0    0.13 2.9E-06   44.5   1.8   55  111-165   461-540 (1406)
 62 COG2888 Predicted Zn-ribbon RN  91.0    0.24 5.3E-06   26.9   2.2   36  111-151    23-58  (61)
 63 PF02892 zf-BED:  BED zinc fing  90.9    0.25 5.4E-06   25.2   2.2   27  140-166    13-43  (45)
 64 PF12013 DUF3505:  Protein of u  90.2    0.71 1.5E-05   28.6   4.1   25  143-167    80-108 (109)
 65 PF09538 FYDLN_acid:  Protein o  90.2    0.22 4.7E-06   31.0   1.7   14  142-155    25-38  (108)
 66 COG1592 Rubrerythrin [Energy p  89.7    0.21 4.5E-06   33.5   1.5   23  115-150   134-156 (166)
 67 PF13719 zinc_ribbon_5:  zinc-r  89.7    0.33 7.3E-06   23.8   1.9   33  117-154     4-36  (37)
 68 cd00729 rubredoxin_SM Rubredox  89.2    0.25 5.5E-06   23.8   1.2   25  115-151     2-26  (34)
 69 PRK00464 nrdR transcriptional   89.0    0.13 2.7E-06   34.2   0.1   12  144-155    29-40  (154)
 70 TIGR02098 MJ0042_CXXC MJ0042 f  88.9     0.4 8.6E-06   23.5   1.9   35    7-54      2-36  (38)
 71 PF13717 zinc_ribbon_4:  zinc-r  88.3    0.49 1.1E-05   23.1   1.9   33  116-153     3-35  (36)
 72 KOG1146|consensus               87.9   0.088 1.9E-06   45.6  -1.4  111    9-141  1230-1354(1406)
 73 TIGR00622 ssl1 transcription f  86.7       2 4.2E-05   26.9   4.3   48  117-166    57-104 (112)
 74 PF09986 DUF2225:  Uncharacteri  86.7    0.21 4.5E-06   35.1   0.1   43  114-156     4-61  (214)
 75 PRK09678 DNA-binding transcrip  86.0    0.37   8E-06   27.6   0.8   40  116-157     2-43  (72)
 76 PRK00398 rpoP DNA-directed RNA  86.0    0.58 1.3E-05   24.1   1.5   30  115-154     3-32  (46)
 77 PRK00464 nrdR transcriptional   85.8    0.37   8E-06   32.0   0.9   43    8-59      1-44  (154)
 78 smart00531 TFIIE Transcription  85.3    0.87 1.9E-05   30.0   2.5   17   41-57     97-113 (147)
 79 COG5236 Uncharacterized conser  85.3    0.49 1.1E-05   35.3   1.4   48  117-165   222-273 (493)
 80 smart00659 RPOLCX RNA polymera  85.1    0.81 1.8E-05   23.4   1.8   28  115-153     2-29  (44)
 81 PF09986 DUF2225:  Uncharacteri  85.0    0.41   9E-06   33.6   0.9   44    5-56      3-61  (214)
 82 KOG2893|consensus               84.5    0.29 6.4E-06   34.5  -0.0   45   82-138    13-58  (341)
 83 PF09845 DUF2072:  Zn-ribbon co  84.1    0.68 1.5E-05   29.7   1.5   15    7-21      1-15  (131)
 84 PRK14890 putative Zn-ribbon RN  83.4     2.2 4.8E-05   23.3   3.1   34  113-151    23-56  (59)
 85 smart00614 ZnF_BED BED zinc fi  82.7       1 2.2E-05   23.6   1.6   22  143-164    18-44  (50)
 86 TIGR02300 FYDLN_acid conserved  82.5       1 2.2E-05   28.7   1.8   14  114-127    25-38  (129)
 87 COG1592 Rubrerythrin [Energy p  82.3    0.96 2.1E-05   30.4   1.7   21   82-123   137-157 (166)
 88 COG4049 Uncharacterized protei  82.0    0.43 9.3E-06   25.6  -0.0   20    5-24     15-34  (65)
 89 PF02176 zf-TRAF:  TRAF-type zi  81.7     1.3 2.9E-05   23.9   2.0   43  114-156     8-55  (60)
 90 PF08790 zf-LYAR:  LYAR-type C2  80.9    0.51 1.1E-05   21.6   0.0   18  144-162     1-18  (28)
 91 KOG2482|consensus               80.3     2.3 5.1E-05   31.9   3.2   49  116-164   280-355 (423)
 92 KOG2186|consensus               79.9    0.81 1.8E-05   32.7   0.8   46    8-64      4-49  (276)
 93 smart00531 TFIIE Transcription  79.7     5.1 0.00011   26.3   4.5   41  110-154    94-134 (147)
 94 COG3364 Zn-ribbon containing p  79.5     1.5 3.2E-05   26.8   1.6   19    6-24      1-19  (112)
 95 PF04959 ARS2:  Arsenite-resist  79.2     1.3 2.8E-05   31.1   1.6   29   39-67     73-101 (214)
 96 COG4888 Uncharacterized Zn rib  79.2    0.92   2E-05   27.5   0.8   42  110-155    17-58  (104)
 97 PF08274 PhnA_Zn_Ribbon:  PhnA   79.1    0.99 2.1E-05   21.1   0.7   24  117-151     4-27  (30)
 98 COG5236 Uncharacterized conser  78.9     2.3   5E-05   31.9   2.8  131    8-165   152-303 (493)
 99 TIGR02605 CxxC_CxxC_SSSS putat  78.2    0.57 1.2E-05   24.8  -0.3   13   44-56      6-18  (52)
100 KOG2785|consensus               77.7     2.7 5.9E-05   31.9   3.0   52  114-165   165-242 (390)
101 TIGR00373 conserved hypothetic  77.2     2.6 5.6E-05   28.2   2.5   36  110-154   104-139 (158)
102 smart00834 CxxC_CXXC_SSSS Puta  77.1    0.75 1.6E-05   22.8  -0.0   29  116-151     6-34  (41)
103 PF04959 ARS2:  Arsenite-resist  76.2     1.4 3.1E-05   30.9   1.1   23  143-165    77-99  (214)
104 PF09723 Zn-ribbon_8:  Zinc rib  75.9     0.6 1.3E-05   23.6  -0.6   12    8-19      6-17  (42)
105 smart00734 ZnF_Rad18 Rad18-lik  75.7     2.4 5.2E-05   18.9   1.4   18  145-163     3-20  (26)
106 PF03604 DNA_RNApol_7kD:  DNA d  74.5     2.3 5.1E-05   20.1   1.3    9  144-152    18-26  (32)
107 TIGR00244 transcriptional regu  74.2     0.9 1.9E-05   29.8  -0.2   12  144-155    29-40  (147)
108 COG1996 RPC10 DNA-directed RNA  74.2       2 4.4E-05   22.5   1.1   30  114-153     5-34  (49)
109 PF12013 DUF3505:  Protein of u  73.5     3.7   8E-05   25.4   2.4   25   44-68     81-109 (109)
110 PRK06266 transcription initiat  73.3     3.2   7E-05   28.3   2.2   35  112-155   114-148 (178)
111 PF10571 UPF0547:  Uncharacteri  71.7       2 4.4E-05   19.3   0.7    9  117-125    16-24  (26)
112 PF06524 NOA36:  NOA36 protein;  71.2     3.3 7.2E-05   29.9   2.0   15   41-55    140-154 (314)
113 COG1327 Predicted transcriptio  70.2     1.3 2.8E-05   29.1  -0.2   12  144-155    29-40  (156)
114 PF14353 CpXC:  CpXC protein     70.1     0.8 1.7E-05   29.3  -1.2   15   43-57     38-52  (128)
115 KOG3408|consensus               69.9       3 6.6E-05   26.3   1.4   26  140-165    54-79  (129)
116 TIGR00373 conserved hypothetic  69.8     3.1 6.7E-05   27.8   1.5   35   38-89    104-138 (158)
117 PF05443 ROS_MUCR:  ROS/MUCR tr  69.7     3.6 7.7E-05   26.6   1.7   22  143-167    72-93  (132)
118 smart00440 ZnF_C2C2 C2C2 Zinc   69.4     1.1 2.3E-05   22.4  -0.6   11  144-154    29-39  (40)
119 PRK00432 30S ribosomal protein  69.0     4.2 9.2E-05   21.4   1.6   12  142-153    36-47  (50)
120 PF15269 zf-C2H2_7:  Zinc-finge  68.1     6.1 0.00013   20.2   2.0   23   43-65     20-42  (54)
121 KOG2593|consensus               67.3     7.3 0.00016   30.2   3.2   40  111-153   124-163 (436)
122 KOG2593|consensus               67.2     4.2 9.2E-05   31.5   1.9   36    5-51    126-161 (436)
123 COG1997 RPL43A Ribosomal prote  66.3     5.2 0.00011   23.7   1.8   30  115-154    35-64  (89)
124 PF07754 DUF1610:  Domain of un  65.7     6.2 0.00013   17.3   1.6    9  114-122    15-23  (24)
125 COG4530 Uncharacterized protei  63.9     5.8 0.00013   24.6   1.7   12  114-125    25-36  (129)
126 PF12760 Zn_Tnp_IS1595:  Transp  63.4      11 0.00024   19.3   2.5   28  115-151    18-45  (46)
127 PF01096 TFIIS_C:  Transcriptio  62.3    0.38 8.3E-06   23.9  -3.0   10  144-153    29-38  (39)
128 COG3357 Predicted transcriptio  61.9     4.2 9.2E-05   24.3   0.9   14   42-55     57-70  (97)
129 KOG2186|consensus               61.3     5.7 0.00012   28.6   1.6   45   44-100     4-48  (276)
130 KOG2907|consensus               60.6     4.8  0.0001   25.1   1.0   39  115-156    74-115 (116)
131 PF13824 zf-Mss51:  Zinc-finger  60.4     9.1  0.0002   20.6   1.9   18  111-128    10-27  (55)
132 PF04606 Ogr_Delta:  Ogr/Delta-  59.9     2.9 6.3E-05   21.6  -0.0   37  118-156     2-40  (47)
133 PF13451 zf-trcl:  Probable zin  58.7     5.1 0.00011   21.1   0.7   16  141-156     2-17  (49)
134 COG1594 RPB9 DNA-directed RNA   58.3     3.9 8.4E-05   25.7   0.3   38  115-155    72-112 (113)
135 smart00661 RPOL9 RNA polymeras  58.1      11 0.00024   19.5   2.1   11  115-125    20-30  (52)
136 PF07975 C1_4:  TFIIH C1-like d  58.0     3.4 7.4E-05   21.9   0.0   16  115-130    21-36  (51)
137 PF08271 TF_Zn_Ribbon:  TFIIB z  57.4     6.1 0.00013   19.9   0.9   29  116-153     1-29  (43)
138 KOG4173|consensus               56.7     2.9 6.3E-05   29.0  -0.5   70   85-165    87-168 (253)
139 TIGR01206 lysW lysine biosynth  56.4     8.2 0.00018   20.7   1.3   30  116-153     3-32  (54)
140 PF01363 FYVE:  FYVE zinc finge  56.2     8.3 0.00018   21.5   1.5   27  116-154    10-36  (69)
141 smart00154 ZnF_AN1 AN1-like Zi  56.2     6.9 0.00015   19.4   1.0   12  143-154    12-23  (39)
142 COG1571 Predicted DNA-binding   55.7     8.5 0.00018   30.0   1.8   28  117-155   352-379 (421)
143 KOG2785|consensus               55.3      19  0.0004   27.6   3.5   55   82-137   169-242 (390)
144 PRK03824 hypA hydrogenase nick  55.0     4.7  0.0001   26.1   0.3   12   44-55     71-82  (135)
145 PRK04023 DNA polymerase II lar  54.9      16 0.00034   31.9   3.3    8  144-151   664-671 (1121)
146 PF14311 DUF4379:  Domain of un  54.2     8.3 0.00018   20.5   1.2   29  114-149    27-55  (55)
147 KOG2807|consensus               53.3      37  0.0008   25.6   4.6   13    9-21    246-258 (378)
148 PHA02998 RNA polymerase subuni  53.0     4.5 9.7E-05   27.4  -0.0   39  115-156   143-184 (195)
149 PF01428 zf-AN1:  AN1-like Zinc  52.8     6.2 0.00013   19.9   0.5   13  142-154    12-24  (43)
150 PRK14714 DNA polymerase II lar  51.2      20 0.00043   32.1   3.4   11  115-125   692-702 (1337)
151 PF13878 zf-C2H2_3:  zinc-finge  51.1      25 0.00055   17.5   2.6   23  116-138    14-38  (41)
152 PF10276 zf-CHCC:  Zinc-finger   49.8     8.7 0.00019   19.2   0.7   12  142-153    28-39  (40)
153 COG4957 Predicted transcriptio  49.2      11 0.00025   24.3   1.3   21  144-167    77-97  (148)
154 PF07282 OrfB_Zn_ribbon:  Putat  49.0      15 0.00033   20.4   1.8   13  141-153    44-56  (69)
155 KOG4167|consensus               49.0     3.7 8.1E-05   34.0  -1.0   24  143-166   792-815 (907)
156 KOG4167|consensus               48.1     2.8   6E-05   34.7  -1.8   26   42-67    791-816 (907)
157 PTZ00255 60S ribosomal protein  48.1      12 0.00025   22.5   1.2   30  115-154    36-65  (90)
158 PF13453 zf-TFIIB:  Transcripti  47.9      17 0.00037   18.0   1.7   17  144-160    20-36  (41)
159 COG5151 SSL1 RNA polymerase II  47.6      19 0.00042   26.8   2.5   26   42-67    387-412 (421)
160 PF01780 Ribosomal_L37ae:  Ribo  46.8       9 0.00019   23.0   0.6   30  115-154    35-64  (90)
161 COG1198 PriA Primosomal protei  46.2      13 0.00029   31.2   1.7   14  139-152   471-484 (730)
162 PF05290 Baculo_IE-1:  Baculovi  45.2      17 0.00036   23.5   1.7   17   41-57     78-94  (140)
163 TIGR00100 hypA hydrogenase nic  44.0      12 0.00025   23.6   0.8   25  115-151    70-94  (115)
164 TIGR01562 FdhE formate dehydro  43.7      25 0.00055   26.3   2.6    8   81-88    186-193 (305)
165 COG5151 SSL1 RNA polymerase II  43.7      23  0.0005   26.5   2.4   23  142-164   387-409 (421)
166 COG3677 Transposase and inacti  43.6      12 0.00025   24.2   0.8   16  140-155    50-65  (129)
167 PRK12380 hydrogenase nickel in  42.9      13 0.00027   23.3   0.9   25  115-151    70-94  (113)
168 COG3091 SprT Zn-dependent meta  42.9      12 0.00027   24.7   0.8   36  113-153   115-150 (156)
169 KOG0320|consensus               42.4     3.8 8.1E-05   27.8  -1.6   17    5-21    129-145 (187)
170 PF11672 DUF3268:  Protein of u  42.2      17 0.00037   22.4   1.3    8  144-151    32-39  (102)
171 TIGR00280 L37a ribosomal prote  41.9      14  0.0003   22.2   0.9   12  143-154    53-64  (91)
172 PF03811 Zn_Tnp_IS1:  InsA N-te  41.3     8.4 0.00018   18.8  -0.1   30  116-149     6-35  (36)
173 cd00065 FYVE FYVE domain; Zinc  40.9      21 0.00046   18.8   1.5   14  114-127    17-30  (57)
174 PF07503 zf-HYPF:  HypF finger;  40.6     1.9 4.2E-05   20.9  -2.4   12  143-154    21-32  (35)
175 COG1773 Rubredoxin [Energy pro  40.1      15 0.00033   19.8   0.8   12  143-154     3-14  (55)
176 COG1655 Uncharacterized protei  39.7     6.7 0.00014   27.9  -0.8   38  114-151    18-70  (267)
177 PF14803 Nudix_N_2:  Nudix N-te  39.7     5.6 0.00012   19.1  -0.8    8  144-151    23-30  (34)
178 smart00064 FYVE Protein presen  39.3      20 0.00044   19.8   1.3   13  115-127    26-38  (68)
179 TIGR00686 phnA alkylphosphonat  39.1      23 0.00051   22.0   1.6   14  115-128    19-32  (109)
180 COG4896 Uncharacterized protei  38.9      18 0.00039   19.9   0.9   40   82-128     5-44  (68)
181 PF05129 Elf1:  Transcription e  38.1     6.6 0.00014   23.0  -0.9   43  110-156    17-59  (81)
182 PF14787 zf-CCHC_5:  GAG-polypr  37.7      16 0.00035   17.7   0.6   15  145-159     4-18  (36)
183 PRK00564 hypA hydrogenase nick  37.6      16 0.00034   23.1   0.7   25  115-151    71-96  (117)
184 COG1675 TFA1 Transcription ini  37.4      26 0.00056   23.9   1.7   14    7-20    113-126 (176)
185 PRK10220 hypothetical protein;  37.1      29 0.00062   21.6   1.7   15  115-129    20-34  (111)
186 PF10263 SprT-like:  SprT-like   36.7      11 0.00023   24.8  -0.1   33  114-154   122-154 (157)
187 KOG1280|consensus               36.6      48   0.001   25.2   3.1   27   42-68     78-105 (381)
188 PRK14892 putative transcriptio  36.5      20 0.00044   21.9   1.0   37  112-155    18-54  (99)
189 PF15135 UPF0515:  Uncharacteri  36.4      53  0.0012   23.8   3.2   14  115-128   155-168 (278)
190 PRK14873 primosome assembly pr  36.3      18 0.00039   30.2   1.0   10  143-152   422-431 (665)
191 PF04780 DUF629:  Protein of un  35.8      26 0.00055   27.9   1.7   21  144-164    58-78  (466)
192 KOG3214|consensus               35.3      25 0.00053   21.5   1.2   43  110-156    18-60  (109)
193 PF10013 DUF2256:  Uncharacteri  35.3      22 0.00048   17.9   0.9   13  145-157    10-22  (42)
194 PRK03976 rpl37ae 50S ribosomal  35.3      19 0.00042   21.6   0.8   12  143-154    54-65  (90)
195 KOG2071|consensus               34.9      24 0.00052   28.7   1.5   27  140-166   415-441 (579)
196 PRK03681 hypA hydrogenase nick  34.9      12 0.00025   23.5  -0.2   15   42-56     69-83  (114)
197 KOG1280|consensus               34.6      53  0.0011   25.0   3.1   38  113-150    77-116 (381)
198 COG0068 HypF Hydrogenase matur  33.8     8.1 0.00018   32.1  -1.2   58   82-153   126-183 (750)
199 PF08792 A2L_zn_ribbon:  A2L zi  33.4      25 0.00055   16.7   0.9   13  142-154    20-32  (33)
200 PF14446 Prok-RING_1:  Prokaryo  33.2      39 0.00085   18.2   1.7   15  112-126    18-32  (54)
201 smart00249 PHD PHD zinc finger  32.9      32  0.0007   16.7   1.4   16  112-127    11-26  (47)
202 PTZ00448 hypothetical protein;  32.6      28 0.00061   26.7   1.4   23  143-165   314-336 (373)
203 PF07295 DUF1451:  Protein of u  32.3      32 0.00069   22.7   1.5   32   42-91    111-142 (146)
204 PF12907 zf-met2:  Zinc-binding  32.3      23 0.00051   17.7   0.7    6  117-122     3-8   (40)
205 KOG2906|consensus               32.2     3.5 7.6E-05   25.0  -2.6   17   42-58     20-36  (105)
206 PF03833 PolC_DP2:  DNA polymer  31.1      16 0.00035   31.1   0.0   10  115-124   680-689 (900)
207 PF01155 HypA:  Hydrogenase exp  30.8      17 0.00038   22.7   0.1   26  115-152    70-95  (113)
208 PF07649 C1_3:  C1-like domain;  30.3      25 0.00055   15.9   0.6   10  114-123    14-23  (30)
209 TIGR00595 priA primosomal prot  30.3      44 0.00095   26.9   2.3   10  142-151   252-261 (505)
210 PF04423 Rad50_zn_hook:  Rad50   30.2      23  0.0005   18.7   0.5   11  145-155    22-32  (54)
211 PRK00420 hypothetical protein;  30.0      45 0.00097   20.9   1.8   13  115-127    40-52  (112)
212 PF11781 RRN7:  RNA polymerase   29.9      34 0.00074   16.6   1.0   25  116-151     9-33  (36)
213 PRK05978 hypothetical protein;  29.4      20 0.00043   23.7   0.2   31  116-155    34-64  (148)
214 COG4391 Uncharacterized protei  29.3      36 0.00077   18.8   1.1   42  110-155    19-60  (62)
215 cd00924 Cyt_c_Oxidase_Vb Cytoc  29.0      30 0.00066   21.1   0.9   20  135-155    72-91  (97)
216 PF06397 Desulfoferrod_N:  Desu  28.8      30 0.00065   16.9   0.7   11  143-153     6-16  (36)
217 TIGR00627 tfb4 transcription f  27.3      50  0.0011   24.4   2.0   25  115-153   255-279 (279)
218 PF00301 Rubredoxin:  Rubredoxi  27.0      33  0.0007   17.8   0.7   11  144-154     2-12  (47)
219 PF00628 PHD:  PHD-finger;  Int  26.6      54  0.0012   16.7   1.6   19  110-128     9-27  (51)
220 TIGR01384 TFS_arch transcripti  26.5      16 0.00034   22.3  -0.6   38  115-155    62-102 (104)
221 KOG2636|consensus               26.3      51  0.0011   26.0   1.9   25  138-162   396-421 (497)
222 COG1779 C4-type Zn-finger prot  26.0      15 0.00032   25.5  -0.9   12  144-155    44-55  (201)
223 PF04810 zf-Sec23_Sec24:  Sec23  25.8      15 0.00033   18.1  -0.6   15  139-153    20-34  (40)
224 cd00730 rubredoxin Rubredoxin;  25.5      32 0.00068   18.1   0.5   11  144-154     2-12  (50)
225 PF09963 DUF2197:  Uncharacteri  25.0      33 0.00071   18.6   0.5    7   82-88      5-11  (56)
226 smart00132 LIM Zinc-binding do  24.8      24 0.00053   16.4  -0.0   10   44-53     28-37  (39)
227 PF01927 Mut7-C:  Mut7-C RNAse   24.6      63  0.0014   21.2   1.9   18  142-159   123-140 (147)
228 PF02591 DUF164:  Putative zinc  24.5      98  0.0021   16.4   2.4   31  117-151    24-54  (56)
229 KOG2071|consensus               24.2      58  0.0013   26.7   1.9   28   40-67    415-442 (579)
230 PRK00762 hypA hydrogenase nick  23.9      31 0.00066   22.0   0.3   13  115-128    70-82  (124)
231 PF01286 XPA_N:  XPA protein N-  23.5      30 0.00065   16.6   0.2   13    9-21      5-17  (34)
232 smart00731 SprT SprT homologue  23.5      28  0.0006   22.8   0.1   34  114-154   111-144 (146)
233 PRK04351 hypothetical protein;  23.3      51  0.0011   21.8   1.3   35  114-156   111-145 (149)
234 PF02748 PyrI_C:  Aspartate car  23.2      42 0.00091   17.8   0.7   17  139-155    31-47  (52)
235 PRK12496 hypothetical protein;  22.8      59  0.0013   21.9   1.5   28  115-154   127-154 (164)
236 PF08209 Sgf11:  Sgf11 (transcr  22.5   1E+02  0.0022   14.6   1.9   11   44-54      5-15  (33)
237 PF11494 Ta0938:  Ta0938;  Inte  22.4      68  0.0015   19.5   1.6   40    4-56     11-50  (105)
238 PLN03238 probable histone acet  22.4      69  0.0015   23.8   1.9   24  113-136    46-69  (290)
239 PLN02294 cytochrome c oxidase   22.2      56  0.0012   22.2   1.3   20  135-155   134-153 (174)
240 COG4640 Predicted membrane pro  22.2      65  0.0014   25.1   1.7   18  115-132    15-32  (465)
241 KOG2636|consensus               22.0      61  0.0013   25.6   1.6   28   37-64    395-423 (497)
242 PLN02748 tRNA dimethylallyltra  22.0      59  0.0013   26.0   1.6   24  142-165   417-441 (468)
243 PF09332 Mcm10:  Mcm10 replicat  21.6      31 0.00067   26.3   0.0   16    8-23    253-268 (344)
244 COG5112 UFD2 U1-like Zn-finger  21.5      46   0.001   20.6   0.7   20  144-163    56-75  (126)
245 COG0068 HypF Hydrogenase matur  21.2      19  0.0004   30.1  -1.3   41   10-58    126-166 (750)
246 KOG2857|consensus               21.2      52  0.0011   21.6   1.0   22  115-136    17-38  (157)
247 KOG0717|consensus               20.9      60  0.0013   25.8   1.4   21   44-64    293-313 (508)
248 PF13821 DUF4187:  Domain of un  20.8      53  0.0011   17.6   0.8   17   82-99     30-46  (55)
249 COG4338 Uncharacterized protei  20.8      32  0.0007   17.9  -0.0   14  145-158    14-27  (54)
250 PF05191 ADK_lid:  Adenylate ki  20.7      45 0.00097   16.1   0.5   12  144-155     2-13  (36)
251 KOG4377|consensus               20.6      95  0.0021   24.4   2.3   26   44-69    272-299 (480)
252 KOG0717|consensus               20.4      55  0.0012   26.0   1.1   22  144-165   293-314 (508)
253 KOG1994|consensus               20.2      49  0.0011   23.6   0.8   22  141-162   237-258 (268)
254 TIGR00319 desulf_FeS4 desulfof  20.2      61  0.0013   15.1   0.9   12  142-153     6-17  (34)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=6.1e-31  Score=181.89  Aligned_cols=134  Identities=23%  Similarity=0.346  Sum_probs=125.5

Q ss_pred             CcccccccccccCchHHHHHHhhhhhccccCCCC---CccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCccc
Q psy4421           6 NINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDS---FKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYC   82 (167)
Q Consensus         6 ~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~---~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c   82 (167)
                      .-|.|.+|++.+...++|.        +|.++|-   .++.+.|.+|++.+.+...|..|+++|+  .+.+        |
T Consensus       129 ~r~~c~eCgk~ysT~snLs--------rHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~--------C  190 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLS--------RHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCE--------C  190 (279)
T ss_pred             Cceeccccccccccccccc--------hhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcc--------c
Confidence            4589999999999999999        8888773   3677999999999999999999999998  4777        9


Q ss_pred             ccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHH
Q psy4421          83 IHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSH  162 (167)
Q Consensus        83 ~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  162 (167)
                      .+||+. |+....|.-|+++       ++||+||.|+.|++.|..+++|+.|+++|.+.|+|.|..|+|+|...+.|.+|
T Consensus       191 ~iCGKa-FSRPWLLQGHiRT-------HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH  262 (279)
T KOG2462|consen  191 GICGKA-FSRPWLLQGHIRT-------HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKH  262 (279)
T ss_pred             cccccc-ccchHHhhccccc-------ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHh
Confidence            999999 9999999999999       99999999999999999999999999999999999999999999999999999


Q ss_pred             hhh
Q psy4421         163 MKS  165 (167)
Q Consensus       163 ~~~  165 (167)
                      ..+
T Consensus       263 ~ES  265 (279)
T KOG2462|consen  263 SES  265 (279)
T ss_pred             hhh
Confidence            864


No 2  
>KOG2462|consensus
Probab=99.89  E-value=7.5e-24  Score=146.88  Aligned_cols=109  Identities=25%  Similarity=0.503  Sum_probs=99.5

Q ss_pred             ccceecCccCccccChHHHHHHHHHhhC---CCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCccc
Q psy4421          41 KYKYGCYRCSYFTYESNNLKKHILKHTG---EKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFV  117 (167)
Q Consensus        41 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~---~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~  117 (167)
                      ...|.|+.||+.+.+.++|.+|+++|-.   .+.+.        |..|++. +.....|..|+.+       +.  -+++
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~--------C~~C~K~-YvSmpALkMHirT-------H~--l~c~  189 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFS--------CKYCGKV-YVSMPALKMHIRT-------HT--LPCE  189 (279)
T ss_pred             CCceeccccccccccccccchhhccccccccccccc--------CCCCCce-eeehHHHhhHhhc-------cC--CCcc
Confidence            3459999999999999999999999853   44566        9999999 8899999999988       66  5789


Q ss_pred             CCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         118 CYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       118 C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      |.+||+.|...+-|+.|+|+|+|||||.|..|++.|..+++|+.|++||.
T Consensus       190 C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  190 CGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             cccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999973


No 3  
>KOG1074|consensus
Probab=99.77  E-value=6e-20  Score=143.25  Aligned_cols=56  Identities=18%  Similarity=0.347  Sum_probs=51.2

Q ss_pred             cccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCC
Q psy4421           7 INQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEK   70 (167)
Q Consensus         7 ~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~   70 (167)
                      +.+|..|.+.|...+.|+        .|.+.|++++||+|++||..|..+.+|+.|...|...-
T Consensus       353 khkCr~CakvfgS~SaLq--------iHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~e~~  408 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQ--------IHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRHREKY  408 (958)
T ss_pred             cchhhhhHhhcCchhhhh--------hhhhccCCCCCeeecccccccccccceeeeeeeccccC
Confidence            467999999999999999        99999999999999999999999999999987776543


No 4  
>KOG1074|consensus
Probab=99.75  E-value=4.9e-19  Score=138.23  Aligned_cols=52  Identities=29%  Similarity=0.571  Sum_probs=50.3

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      ..|.+|++.|...+.|..|+++|+|+|||.|..|++.|..+.+|..|+.+|+
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~  931 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHM  931 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhcccc
Confidence            6899999999999999999999999999999999999999999999999875


No 5  
>KOG3608|consensus
Probab=99.71  E-value=8.3e-18  Score=120.46  Aligned_cols=134  Identities=23%  Similarity=0.473  Sum_probs=102.2

Q ss_pred             cccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHH-hhCCCCCCcccccCcccccc
Q psy4421           7 INQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILK-HTGEKPFSYMYENQQYCIHC   85 (167)
Q Consensus         7 ~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~~~~~~~~~c~~c   85 (167)
                      +|.|..|.+.|..+..|.        .|+..|-  ..|+|+.|+.+....+.|..|++. |...+|++        |..|
T Consensus       237 ~fqC~~C~KrFaTeklL~--------~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfK--------Cd~C  298 (467)
T KOG3608|consen  237 SFQCAQCFKRFATEKLLK--------SHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFK--------CDEC  298 (467)
T ss_pred             chHHHHHHHHHhHHHHHH--------HHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCcc--------ccch
Confidence            455555555555555555        5555442  247888888888888888888875 77788888        8889


Q ss_pred             cccccCChHHHHHHHhhcCCCCCCCCCCCcccCCC--CCccccCchhHHHHHhh-hCCCC--ceeCCCCcccccCchhHH
Q psy4421          86 NSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYA--CEYNTYMSGNIKTHLRL-HLDDK--PYKCSLCNYECRQNVHLK  160 (167)
Q Consensus        86 ~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~--C~~~~~~~~~l~~H~~~-h~~~~--~~~C~~C~~~f~~~~~l~  160 (167)
                      +.. +.+..+|.+|..+       +. +..|.|..  |...+.....++.|++. |.|..  +|.|-.|++.|.+..+|.
T Consensus       299 d~~-c~~esdL~kH~~~-------HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~  369 (467)
T KOG3608|consen  299 DTR-CVRESDLAKHVQV-------HS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLS  369 (467)
T ss_pred             hhh-hccHHHHHHHHHh-------cc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHH
Confidence            888 8888899999887       66 67788877  88888888999999664 44544  499999999999999999


Q ss_pred             HHhhhcC
Q psy4421         161 SHMKSNH  167 (167)
Q Consensus       161 ~H~~~hh  167 (167)
                      +|++..|
T Consensus       370 ~HL~kkH  376 (467)
T KOG3608|consen  370 AHLMKKH  376 (467)
T ss_pred             HHHHHhh
Confidence            9987654


No 6  
>KOG3608|consensus
Probab=99.70  E-value=1e-17  Score=119.96  Aligned_cols=106  Identities=21%  Similarity=0.499  Sum_probs=58.4

Q ss_pred             ceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCC
Q psy4421          43 KYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACE  122 (167)
Q Consensus        43 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~  122 (167)
                      +|.|..|.+.|..+..|..|+..|..  .|+        |+.|+.. ....+.|..|+...      +..++||+|+.|.
T Consensus       237 ~fqC~~C~KrFaTeklL~~Hv~rHvn--~yk--------CplCdmt-c~~~ssL~~H~r~r------Hs~dkpfKCd~Cd  299 (467)
T KOG3608|consen  237 SFQCAQCFKRFATEKLLKSHVVRHVN--CYK--------CPLCDMT-CSSASSLTTHIRYR------HSKDKPFKCDECD  299 (467)
T ss_pred             chHHHHHHHHHhHHHHHHHHHHHhhh--ccc--------ccccccC-CCChHHHHHHHHhh------hccCCCccccchh
Confidence            44444444444444444444444432  334        6666655 55556666665552      3445566666666


Q ss_pred             ccccCchhHHHHHhhhCCCCceeCCC--CcccccCchhHHHHhhhc
Q psy4421         123 YNTYMSGNIKTHLRLHLDDKPYKCSL--CNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       123 ~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h  166 (167)
                      +.+...+.|..|..+|. +-.|.|..  |-++|++..+|.+|.+.+
T Consensus       300 ~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~ev  344 (467)
T KOG3608|consen  300 TRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEV  344 (467)
T ss_pred             hhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHh
Confidence            66666666666666555 44466655  666666666666665544


No 7  
>KOG3576|consensus
Probab=99.69  E-value=1.2e-17  Score=111.32  Aligned_cols=110  Identities=23%  Similarity=0.368  Sum_probs=91.9

Q ss_pred             cceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCC
Q psy4421          42 YKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYAC  121 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C  121 (167)
                      ..|.|..|++.|.....|.+|++-|...+.+-        |..||+. |.+.-+|.+|.++       ++|-+||+|..|
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~l--------ct~cgkg-fndtfdlkrh~rt-------htgvrpykc~~c  179 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHL--------CTFCGKG-FNDTFDLKRHTRT-------HTGVRPYKCSLC  179 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhhhccHHHHHH--------HhhccCc-ccchhhhhhhhcc-------ccCccccchhhh
Confidence            34889999999988888888988888888887        8889888 8888888888888       888889999999


Q ss_pred             CccccCchhHHHHHhhhCC-----------CCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         122 EYNTYMSGNIKTHLRLHLD-----------DKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       122 ~~~~~~~~~l~~H~~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      ++.|.++.+|..|.+.-+|           ++.|+|+.||.+-.....+..|++.+|
T Consensus       180 ~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  180 EKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             hHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcC
Confidence            9999999888888663332           566899999988888888888887765


No 8  
>KOG3576|consensus
Probab=99.63  E-value=9.2e-17  Score=107.14  Aligned_cols=122  Identities=20%  Similarity=0.297  Sum_probs=104.9

Q ss_pred             cCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccc
Q psy4421           4 SLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCI   83 (167)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~   83 (167)
                      +...|.|.+|++.|.....|.        +|++.|+..+.+.|.-||+.|.....|++|.++|+|.+||+        |.
T Consensus       114 d~d~ftCrvCgK~F~lQRmln--------rh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpyk--------c~  177 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLN--------RHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYK--------CS  177 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHH--------HHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccc--------hh
Confidence            355699999999999999999        99999999999999999999999999999999999999999        99


Q ss_pred             cccccccCChHHHHHHHhhcCCCCCC----CCCCCcccCCCCCccccCchhHHHHHhhhCCCC
Q psy4421          84 HCNSYISSDIKDLIEHCKSCSHMTRP----DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDK  142 (167)
Q Consensus        84 ~c~~~~~~~~~~l~~h~~~~~~~~~~----~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~  142 (167)
                      .|++. |...-.|..|+..-+.....    ...++.|.|+.||.+-.....+..|+..++-..
T Consensus       178 ~c~ka-ftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~S  239 (267)
T KOG3576|consen  178 LCEKA-FTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFS  239 (267)
T ss_pred             hhhHH-HHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCC
Confidence            99999 99888899998763322211    123578999999999999988999988776433


No 9  
>KOG3623|consensus
Probab=99.63  E-value=1.5e-16  Score=123.16  Aligned_cols=113  Identities=27%  Similarity=0.439  Sum_probs=91.3

Q ss_pred             eecCccCccccChHHHHHHHHHhh--CCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCC------CCCCCc
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKHT--GEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRP------DAFHFK  115 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h~--~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~------~~~~~~  115 (167)
                      ..|++|++.+.....|..|+.-.+  .+..|.        |..|... |.....|.+|+.........      ....+.
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfs--------C~lCsyt-FAyRtQLErhm~~hkpg~dqa~sltqsa~lRK  281 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFS--------CMLCSYT-FAYRTQLERHMQLHKPGGDQAISLTQSALLRK  281 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCc--------chhhhhh-hhhHHHHHHHHHhhcCCCcccccccchhhhcc
Confidence            568888888888888888885432  334466        8888888 88888888888775433322      233567


Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhh
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      |+|..|++.|..+..|+.|+|+|.|||||.|..|+|+|+...++..|+.+
T Consensus       282 FKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  282 FKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999999999999999999999854


No 10 
>KOG3623|consensus
Probab=99.43  E-value=2.9e-14  Score=110.68  Aligned_cols=84  Identities=23%  Similarity=0.390  Sum_probs=78.3

Q ss_pred             CCcCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcc
Q psy4421           2 QESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQY   81 (167)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~   81 (167)
                      .+.+.+|.|..|++.|...+.|.        +|.-.|+|.+||+|.+|.+.|+.+-.|..|+|.|.|||||+        
T Consensus       889 kte~gmyaCDqCDK~FqKqSSLa--------RHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQ--------  952 (1007)
T KOG3623|consen  889 KTEDGMYACDQCDKAFQKQSSLA--------RHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQ--------  952 (1007)
T ss_pred             cCccccchHHHHHHHHHhhHHHH--------HhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcch--------
Confidence            35677899999999999999999        99889999999999999999999999999999999999999        


Q ss_pred             cccccccccCChHHHHHHHhh
Q psy4421          82 CIHCNSYISSDIKDLIEHCKS  102 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~  102 (167)
                      |..|++. |+..-.+.+||.-
T Consensus       953 CdKClKR-FSHSGSYSQHMNH  972 (1007)
T KOG3623|consen  953 CDKCLKR-FSHSGSYSQHMNH  972 (1007)
T ss_pred             hhhhhhh-cccccchHhhhcc
Confidence            9999999 9988888888754


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.27  E-value=1.4e-11  Score=95.48  Aligned_cols=104  Identities=16%  Similarity=0.339  Sum_probs=85.5

Q ss_pred             ccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCC
Q psy4421          41 KYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYA  120 (167)
Q Consensus        41 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~  120 (167)
                      ++.+.|+.|++.|. ...|..|+.+++  +++.        |+ |+.. + ....|..|+..       +...+++.|+.
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~--------Cp-Cg~~-~-~R~~L~~H~~t-------hCp~Kpi~C~f  509 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQ--------CP-CGVV-L-EKEQMVQHQAS-------TCPLRLITCRF  509 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCcc--------CC-CCCC-c-chhHHHhhhhc-------cCCCCceeCCC
Confidence            34578999999995 678999999874  6888        99 9965 4 66899999988       88999999999


Q ss_pred             CCccccC----------chhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         121 CEYNTYM----------SGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       121 C~~~~~~----------~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      |+..+..          ...|..|.... |.+++.|..||+.|..+ +|..|+...|
T Consensus       510 C~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        510 CGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             CCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHhh
Confidence            9999852          34789998875 89999999999988876 6667776543


No 12 
>PHA00733 hypothetical protein
Probab=99.22  E-value=9.9e-12  Score=79.50  Aligned_cols=98  Identities=18%  Similarity=0.220  Sum_probs=66.1

Q ss_pred             HHHHHHHHHhhCCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHh
Q psy4421          57 NNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLR  136 (167)
Q Consensus        57 ~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  136 (167)
                      ..|.++-..-...+++.        |.+|... +.+...|..+......+  ...+.++|.|+.|++.|.....|..|++
T Consensus        26 ~~~~~~~~~~~~~~~~~--------~~~~~~~-~~~~~~l~~~~~l~~~~--~~~~~kPy~C~~Cgk~Fss~s~L~~H~r   94 (128)
T PHA00733         26 EELKRYHSLTPEQKRLI--------RAVVKTL-IYNPQLLDESSYLYKLL--TSKAVSPYVCPLCLMPFSSSVSLKQHIR   94 (128)
T ss_pred             HHhhhhhcCChhhhhHH--------HHHHhhh-ccChhhhcchHHHHhhc--ccCCCCCccCCCCCCcCCCHHHHHHHHh
Confidence            34444333333345566        7777666 55544444331111111  1334678999999999999999999998


Q ss_pred             hhCCCCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         137 LHLDDKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       137 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      .+  +.+|.|..|++.|.....|..|+...|
T Consensus        95 ~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         95 YT--EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             cC--CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            76  457999999999999999999998765


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.12  E-value=3.1e-11  Score=64.49  Aligned_cols=44  Identities=23%  Similarity=0.242  Sum_probs=40.9

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHH
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLK  160 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  160 (167)
                      .|.|+.||+.|...++|..|+++|.  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999998  7999999999999888774


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.98  E-value=5e-10  Score=51.39  Aligned_cols=26  Identities=38%  Similarity=0.925  Sum_probs=23.9

Q ss_pred             hHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         130 NIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       130 ~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      +|..|+++|.|++||.|+.|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58899999999999999999999974


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.96  E-value=1.8e-09  Score=83.92  Aligned_cols=102  Identities=15%  Similarity=0.273  Sum_probs=82.9

Q ss_pred             cCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccc
Q psy4421           4 SLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCI   83 (167)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~   83 (167)
                      .++.+.|+.|+..|. ..+|.        .|+..++  +++.|+ |++.+ ....|..|+.+|-+++++.        |.
T Consensus       450 l~~H~~C~~Cgk~f~-~s~Le--------kH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~--------C~  508 (567)
T PLN03086        450 AKNHVHCEKCGQAFQ-QGEME--------KHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLIT--------CR  508 (567)
T ss_pred             cccCccCCCCCCccc-hHHHH--------HHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCcee--------CC
Confidence            456789999999996 57788        7877664  679999 99765 6689999999999999999        99


Q ss_pred             cccccccC----------ChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHh
Q psy4421          84 HCNSYISS----------DIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLR  136 (167)
Q Consensus        84 ~c~~~~~~----------~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  136 (167)
                      .|+.. +.          ....|..|..+       . +.+++.|..|++.+..+. +..|+.
T Consensus       509 fC~~~-v~~g~~~~d~~d~~s~Lt~HE~~-------C-G~rt~~C~~Cgk~Vrlrd-m~~H~~  561 (567)
T PLN03086        509 FCGDM-VQAGGSAMDVRDRLRGMSEHESI-------C-GSRTAPCDSCGRSVMLKE-MDIHQI  561 (567)
T ss_pred             CCCCc-cccCccccchhhhhhhHHHHHHh-------c-CCcceEccccCCeeeehh-HHHHHH
Confidence            99988 42          24578888876       4 778999999999988874 677754


No 16 
>PHA00733 hypothetical protein
Probab=98.94  E-value=2.1e-09  Score=68.78  Aligned_cols=87  Identities=14%  Similarity=0.107  Sum_probs=60.2

Q ss_pred             CCcCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcc
Q psy4421           2 QESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQY   81 (167)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~   81 (167)
                      +...+++.|..|...|.....|..  .+.+..++.. .+.++|.|+.|++.|.....|..|++.+  +.++.        
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~l~~--~~~l~~~~~~-~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~--------  101 (128)
T PHA00733         35 TPEQKRLIRAVVKTLIYNPQLLDE--SSYLYKLLTS-KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKV--------  101 (128)
T ss_pred             ChhhhhHHHHHHhhhccChhhhcc--hHHHHhhccc-CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCcc--------
Confidence            345677888888888777665551  1112233333 3467788888888888888888888765  34677        


Q ss_pred             cccccccccCChHHHHHHHhh
Q psy4421          82 CIHCNSYISSDIKDLIEHCKS  102 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~  102 (167)
                      |..|++. |.....|..|+..
T Consensus       102 C~~CgK~-F~~~~sL~~H~~~  121 (128)
T PHA00733        102 CPVCGKE-FRNTDSTLDHVCK  121 (128)
T ss_pred             CCCCCCc-cCCHHHHHHHHHH
Confidence            8888888 7877788877665


No 17 
>KOG3993|consensus
Probab=98.90  E-value=5e-10  Score=82.67  Aligned_cols=157  Identities=15%  Similarity=0.155  Sum_probs=105.8

Q ss_pred             CCcCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCC--------CCC
Q psy4421           2 QESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEK--------PFS   73 (167)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~--------~~~   73 (167)
                      .+...-|.|..|...|.+.+.|.        +|.-.-+-...|+|++|++.|....||..|.|+|....        |-+
T Consensus       262 ~n~iGdyiCqLCK~kYeD~F~LA--------QHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k  333 (500)
T KOG3993|consen  262 PNVIGDYICQLCKEKYEDAFALA--------QHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPK  333 (500)
T ss_pred             cccHHHHHHHHHHHhhhhHHHHh--------hccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChh
Confidence            44555689999999999999999        77654444455999999999999999999999986322        111


Q ss_pred             -c----------------ccccCcccccccccccCChHHHHHHHhhcCCCCCCCC-------------------------
Q psy4421          74 -Y----------------MYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDA-------------------------  111 (167)
Q Consensus        74 -~----------------~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~-------------------------  111 (167)
                       -                +.+.-..|..|++. |.....|.+|+.++........                         
T Consensus       334 ~~~~~rae~~ea~rsg~dss~gi~~C~~C~Kk-FrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~  412 (500)
T KOG3993|consen  334 QAVETRAEVQEAERSGDDSSSGIFSCHTCGKK-FRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSS  412 (500)
T ss_pred             hhhhhhhhhhhccccCCcccCceeecHHhhhh-hHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccc
Confidence             0                11223357788888 7777788888666542221110                         


Q ss_pred             ------CCC--------cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         112 ------FHF--------KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       112 ------~~~--------~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                            .+.        ...++.++..+..++.--.+.+.-..+..|.|.+|--.|.+...|.+|+...|
T Consensus       413 a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  413 ASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             cccccccceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcC
Confidence                  000        12445555555555443344443444667889999999999999999987765


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.71  E-value=3.1e-09  Score=56.83  Aligned_cols=42  Identities=19%  Similarity=0.412  Sum_probs=24.8

Q ss_pred             eecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccccCChHHH
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDL   96 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l   96 (167)
                      |.|+.||+.|...+.|..|+++|+  ++++        |..|++. |...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~k--------c~~C~k~-f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLK--------LSNCKRI-SLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--Cccc--------CCcccce-eccccee
Confidence            556666666666666666666666  3555        6666665 4444433


No 19 
>PHA00732 hypothetical protein
Probab=98.51  E-value=9.5e-08  Score=55.80  Aligned_cols=45  Identities=36%  Similarity=0.612  Sum_probs=32.8

Q ss_pred             cccCCCCCccccCchhHHHHHhh-hCCCCceeCCCCcccccCchhHHHHhhh
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRL-HLDDKPYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      ||.|..|++.|....+|..|++. |.   ++.|+.||+.|.   .|..|.++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhcc
Confidence            46788888888888888888774 54   347888888887   46666654


No 20 
>PHA00616 hypothetical protein
Probab=98.47  E-value=5.4e-08  Score=49.62  Aligned_cols=34  Identities=12%  Similarity=0.145  Sum_probs=31.6

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCC
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSL  148 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~  148 (167)
                      ||+|+.||+.|....+|..|++.|+|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999998875


No 21 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.37  E-value=5.8e-07  Score=48.77  Aligned_cols=50  Identities=24%  Similarity=0.531  Sum_probs=37.8

Q ss_pred             cccCCCCCccccCchhHHHHHh-hhCCC-CceeCCCCcccccCchhHHHHhhhcC
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLR-LHLDD-KPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~-~h~~~-~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      .|.||.|++ ..+...|..|.. .|.++ +.+.|++|...+.  .+|..|+..+|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            478999999 566678999955 45544 4689999998655  48999998776


No 22 
>PHA00616 hypothetical protein
Probab=98.29  E-value=4e-07  Score=46.43  Aligned_cols=31  Identities=19%  Similarity=0.488  Sum_probs=25.1

Q ss_pred             ceecCccCccccChHHHHHHHHHhhCCCCCC
Q psy4421          43 KYGCYRCSYFTYESNNLKKHILKHTGEKPFS   73 (167)
Q Consensus        43 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~   73 (167)
                      ||+|..||+.|...+.|.+|++.|++++++.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~   31 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLT   31 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccc
Confidence            4778888888888888888888888888776


No 23 
>KOG3993|consensus
Probab=98.26  E-value=2e-07  Score=69.25  Aligned_cols=78  Identities=22%  Similarity=0.457  Sum_probs=57.7

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhC--------C-------------
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHL--------D-------------  140 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~--------~-------------  140 (167)
                      |..|... +.+.=.|.+|.-.       .....-|+|+.|++.|.-..+|-.|+|=|-        |             
T Consensus       270 CqLCK~k-YeD~F~LAQHrC~-------RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae  341 (500)
T KOG3993|consen  270 CQLCKEK-YEDAFALAQHRCP-------RIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAE  341 (500)
T ss_pred             HHHHHHh-hhhHHHHhhccCC-------eeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhh
Confidence            6677666 5555566666544       444456888888888888888888877442        1             


Q ss_pred             ------------CCceeCCCCcccccCchhHHHHhhhcC
Q psy4421         141 ------------DKPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       141 ------------~~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                                  +.-|.|.+|++.|+...+|+.|+-+||
T Consensus       342 ~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  342 VQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                        224899999999999999999998875


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.23  E-value=6.2e-07  Score=39.71  Aligned_cols=22  Identities=36%  Similarity=0.844  Sum_probs=18.2

Q ss_pred             eeCCCCcccccCchhHHHHhhh
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      |.|+.|++.|...++|..|+++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            6788888888888888888876


No 25 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.19  E-value=8.8e-07  Score=40.46  Aligned_cols=15  Identities=53%  Similarity=1.121  Sum_probs=7.8

Q ss_pred             HHHHHHHhhCCCCCC
Q psy4421          59 LKKHILKHTGEKPFS   73 (167)
Q Consensus        59 l~~H~~~h~~~~~~~   73 (167)
                      |.+|+++|++++||+
T Consensus         2 l~~H~~~H~~~k~~~   16 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYK   16 (26)
T ss_dssp             HHHHHHHHSSSSSEE
T ss_pred             HHHHhhhcCCCCCCC
Confidence            445555555555555


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.18  E-value=1.2e-06  Score=39.08  Aligned_cols=24  Identities=29%  Similarity=0.891  Sum_probs=18.4

Q ss_pred             eeCCCCcccccCchhHHHHhhhcC
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      |.|+.|++.|.+..+|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            678888888888888888888776


No 27 
>PHA00732 hypothetical protein
Probab=98.12  E-value=1.7e-06  Score=50.58  Aligned_cols=47  Identities=17%  Similarity=0.314  Sum_probs=35.1

Q ss_pred             cccccccccccCchHHHHHHhhhhhccccCC-CCCccceecCccCccccChHHHHHHHHHhh
Q psy4421           7 INQCVHCHLTLTKSTEVIVKHAQTCISMVRP-DSFKYKYGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus         7 ~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~-~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      ||.|..|++.|....+|.        .|++. |.+   +.|+.|++.|.   .+..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk--------~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALK--------QHARRNHTL---TKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHH--------HHhhcccCC---CccCCCCCEeC---ChhhhhcccC
Confidence            688999999999888888        78763 543   57999999887   4666765443


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.07  E-value=2.8e-06  Score=39.14  Aligned_cols=25  Identities=24%  Similarity=0.580  Sum_probs=20.5

Q ss_pred             ceeCCCCcccccCchhHHHHhhhcC
Q psy4421         143 PYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      ||.|..|++.|.+..+|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5788888888888888888887764


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.02  E-value=5.6e-06  Score=36.55  Aligned_cols=23  Identities=35%  Similarity=0.660  Sum_probs=18.4

Q ss_pred             eecCccCccccChHHHHHHHHHh
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKH   66 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h   66 (167)
                      |.|++|++.|..+..|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57888888888888888888764


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.81  E-value=1.5e-05  Score=48.73  Aligned_cols=72  Identities=25%  Similarity=0.513  Sum_probs=19.9

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHH
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKS  161 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  161 (167)
                      |..|+.. +.+...+..|+...+.....           ....+.....+....+... ...+.|..|++.|.+...|..
T Consensus         2 C~~C~~~-f~~~~~l~~H~~~~H~~~~~-----------~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~   68 (100)
T PF12756_consen    2 CLFCDES-FSSVDDLLQHMKKKHGFDIP-----------DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQE   68 (100)
T ss_dssp             ------------------------------------------------------------SSEEBSSSS-EESSHHHHHH
T ss_pred             ccccccc-cccccccccccccccccccc-----------ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHH
Confidence            7889999 88899999998763322211           0111112233333333221 236889999999999999999


Q ss_pred             Hhhhc
Q psy4421         162 HMKSN  166 (167)
Q Consensus       162 H~~~h  166 (167)
                      |++.+
T Consensus        69 Hm~~~   73 (100)
T PF12756_consen   69 HMRSK   73 (100)
T ss_dssp             HHHHT
T ss_pred             HHcCc
Confidence            98754


No 31 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.69  E-value=3.8e-05  Score=41.58  Aligned_cols=47  Identities=17%  Similarity=0.255  Sum_probs=23.8

Q ss_pred             ccccccccccCchHHHHHHhhhhhccccC-CCCC-ccceecCccCccccChHHHHHHHHH
Q psy4421           8 NQCVHCHLTLTKSTEVIVKHAQTCISMVR-PDSF-KYKYGCYRCSYFTYESNNLKKHILK   65 (167)
Q Consensus         8 ~~C~~C~~~f~~~~~l~~~~~~~~~~h~~-~~~~-~~~~~C~~C~~~~~~~~~l~~H~~~   65 (167)
                      |.|+.|++. .+..+|.        .|.. .|.. .+.+.|++|...+.  .+|.+|+..
T Consensus         3 f~CP~C~~~-~~~~~L~--------~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLV--------EHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             cCCCCCCCc-cCHHHHH--------HHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHH
Confidence            566666663 3345566        4443 2322 23456666665432  356666554


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.60  E-value=8.2e-05  Score=32.80  Aligned_cols=23  Identities=22%  Similarity=0.519  Sum_probs=16.6

Q ss_pred             eecCccCccccChHHHHHHHHHh
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKH   66 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h   66 (167)
                      |.|+.|++.|.+...|.+|++++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56888888888888888888764


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.50  E-value=4.9e-05  Score=34.86  Aligned_cols=25  Identities=24%  Similarity=0.417  Sum_probs=22.6

Q ss_pred             cccCCCCCccccCchhHHHHHhhhC
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHL  139 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~  139 (167)
                      ||.|..|+..|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5889999999999999999998775


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.47  E-value=5.6e-05  Score=54.66  Aligned_cols=52  Identities=27%  Similarity=0.508  Sum_probs=44.0

Q ss_pred             CCcccCCC--CCccccCchhHHHHHhhhC-------------------CCCceeCCCCcccccCchhHHHHhh
Q psy4421         113 HFKFVCYA--CEYNTYMSGNIKTHLRLHL-------------------DDKPYKCSLCNYECRQNVHLKSHMK  164 (167)
Q Consensus       113 ~~~~~C~~--C~~~~~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  164 (167)
                      ++||+|++  |.+.+.....|+.|+..-+                   .+|||.|+.|+|++....-|.-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            48999986  8999999999999977322                   2589999999999999988887764


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.41  E-value=8.4e-05  Score=33.33  Aligned_cols=23  Identities=30%  Similarity=0.749  Sum_probs=16.7

Q ss_pred             eeCCCCcccccCchhHHHHhhhc
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~h  166 (167)
                      |.|..|++.|...++|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46777777777777777777644


No 36 
>PRK04860 hypothetical protein; Provisional
Probab=97.38  E-value=0.00013  Score=48.57  Aligned_cols=40  Identities=20%  Similarity=0.468  Sum_probs=35.1

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCch
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNV  157 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  157 (167)
                      -+|.|. |+.   ....++.|.+++.|+++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            479998 987   6778899999999999999999999987654


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.27  E-value=0.00018  Score=43.81  Aligned_cols=72  Identities=21%  Similarity=0.370  Sum_probs=20.6

Q ss_pred             ecCccCccccChHHHHHHHHHhhC-CCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCc
Q psy4421          45 GCYRCSYFTYESNNLKKHILKHTG-EKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEY  123 (167)
Q Consensus        45 ~C~~C~~~~~~~~~l~~H~~~h~~-~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~  123 (167)
                      +|..|+..|.....|..|+...++ ..+-.             .. ......+.....        ......+.|..|+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~-------------~~-l~~~~~~~~~~~--------~~~~~~~~C~~C~~   58 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQ-------------KY-LVDPNRLLNYLR--------KKVKESFRCPYCNK   58 (100)
T ss_dssp             ----------------------------------------------------------------------SSEEBSSSS-
T ss_pred             Cccccccccccccccccccccccccccccc-------------cc-cccccccccccc--------cccCCCCCCCccCC
Confidence            478888888888888888854332 21100             00 111122222211        12223688999999


Q ss_pred             cccCchhHHHHHhhh
Q psy4421         124 NTYMSGNIKTHLRLH  138 (167)
Q Consensus       124 ~~~~~~~l~~H~~~h  138 (167)
                      .|.+...|..|++.+
T Consensus        59 ~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   59 TFRSREALQEHMRSK   73 (100)
T ss_dssp             EESSHHHHHHHHHHT
T ss_pred             CCcCHHHHHHHHcCc
Confidence            999999999998864


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.23  E-value=0.00041  Score=36.29  Aligned_cols=34  Identities=24%  Similarity=0.314  Sum_probs=21.1

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCc
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKP  143 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~  143 (167)
                      ...+.|..|++|+..+.+.-+|++|+.+.++.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4455677888888888888888888877776654


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.15  E-value=0.00028  Score=31.58  Aligned_cols=22  Identities=27%  Similarity=0.750  Sum_probs=16.8

Q ss_pred             eeCCCCcccccCchhHHHHhhh
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      |.|..|++.|.+..+|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5677788888888888887765


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.06  E-value=0.00095  Score=34.96  Aligned_cols=33  Identities=24%  Similarity=0.353  Sum_probs=23.5

Q ss_pred             CCccceecCccCccccChHHHHHHHHHhhCCCC
Q psy4421          39 SFKYKYGCYRCSYFTYESNNLKKHILKHTGEKP   71 (167)
Q Consensus        39 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~   71 (167)
                      ..+.|-.|++|+..+....+|.+|++++++.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            345678999999999999999999988887765


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.05  E-value=0.00036  Score=50.63  Aligned_cols=70  Identities=21%  Similarity=0.263  Sum_probs=45.2

Q ss_pred             ccceecCc--cCccccChHHHHHHHHH-hhCCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCccc
Q psy4421          41 KYKYGCYR--CSYFTYESNNLKKHILK-HTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFV  117 (167)
Q Consensus        41 ~~~~~C~~--C~~~~~~~~~l~~H~~~-h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~  117 (167)
                      ++||+|+.  |++.+++...|+-|+.. |...+..+        -+.-.           .+...       -...+||+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~--------~p~p~-----------~~~~F-------~~~~KPYr  400 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHE--------NPSPE-----------KMNIF-------SAKDKPYR  400 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCC--------CCCcc-----------ccccc-------cccCCcee
Confidence            37788875  88888888888877753 43333222        11000           00000       34468999


Q ss_pred             CCCCCccccCchhHHHHHh
Q psy4421         118 CYACEYNTYMSGNIKTHLR  136 (167)
Q Consensus       118 C~~C~~~~~~~~~l~~H~~  136 (167)
                      |++|++.+.....|+.|+.
T Consensus       401 CevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         401 CEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ccccchhhccCccceeccc
Confidence            9999999999999999865


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.99  E-value=0.00084  Score=29.87  Aligned_cols=24  Identities=29%  Similarity=0.546  Sum_probs=16.6

Q ss_pred             eecCccCccccChHHHHHHHHHhh
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            357777777777777777776543


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.95  E-value=0.0013  Score=29.12  Aligned_cols=23  Identities=48%  Similarity=0.938  Sum_probs=17.5

Q ss_pred             eecCccCccccChHHHHHHHHHhh
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      |.|+.|++... +..|.+|++.+.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67999999887 889999988754


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.91  E-value=0.00045  Score=30.63  Aligned_cols=23  Identities=43%  Similarity=0.980  Sum_probs=14.3

Q ss_pred             eeCCCCcccccCchhHHHHhhhcC
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      |.|+.|++... ...|..|++++|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777777666 667777776654


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.62  E-value=0.00089  Score=30.60  Aligned_cols=22  Identities=36%  Similarity=0.680  Sum_probs=18.6

Q ss_pred             eeCCCCcccccCchhHHHHhhh
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788899999988888888865


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.47  E-value=0.0021  Score=28.65  Aligned_cols=22  Identities=23%  Similarity=0.467  Sum_probs=14.7

Q ss_pred             eecCccCccccChHHHHHHHHH
Q psy4421          44 YGCYRCSYFTYESNNLKKHILK   65 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~   65 (167)
                      |.|..|++.|.++..|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4567777777777777776643


No 47 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.59  E-value=0.0096  Score=26.64  Aligned_cols=21  Identities=24%  Similarity=0.504  Sum_probs=12.8

Q ss_pred             eeCCCCcccccCchhHHHHhhh
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      ..|+.||+.| ..+.|.+|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3566777777 44566666643


No 48 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.54  E-value=0.0031  Score=48.23  Aligned_cols=60  Identities=23%  Similarity=0.425  Sum_probs=54.4

Q ss_pred             CcccccccccccCchHHHHHHhhhhhccccC--CCCCc--cceecC--ccCccccChHHHHHHHHHhhCCCCCC
Q psy4421           6 NINQCVHCHLTLTKSTEVIVKHAQTCISMVR--PDSFK--YKYGCY--RCSYFTYESNNLKKHILKHTGEKPFS   73 (167)
Q Consensus         6 ~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~--~~~~~--~~~~C~--~C~~~~~~~~~l~~H~~~h~~~~~~~   73 (167)
                      .++.|..|...|.....+.        .|..  .|.++  +++.|+  .|++.|.....+..|...|.+..+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~--------~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLT--------RHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAK  353 (467)
T ss_pred             cCCCCccccCCcccccccc--------ccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccc
Confidence            4788999999999999999        8988  79999  999999  89999999999999999998877665


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.52  E-value=0.016  Score=26.32  Aligned_cols=17  Identities=12%  Similarity=0.327  Sum_probs=12.7

Q ss_pred             ccccccccccCchHHHH
Q psy4421           8 NQCVHCHLTLTKSTEVI   24 (167)
Q Consensus         8 ~~C~~C~~~f~~~~~l~   24 (167)
                      |.|..|++.|.+...+.
T Consensus         2 ~~C~~C~k~f~~~~~~~   18 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLK   18 (27)
T ss_dssp             CBBTTTTBBBSSHHHHH
T ss_pred             CCcccCCCCcCCHHHHH
Confidence            56777777777777777


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.09  E-value=0.02  Score=27.60  Aligned_cols=23  Identities=26%  Similarity=0.743  Sum_probs=16.6

Q ss_pred             ceeCCCCcccccCchhHHHHhhh
Q psy4421         143 PYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      +|.|..|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46777888877777777777653


No 51 
>PRK04860 hypothetical protein; Provisional
Probab=94.91  E-value=0.023  Score=37.94  Aligned_cols=35  Identities=23%  Similarity=0.618  Sum_probs=31.5

Q ss_pred             cceecCccCccccChHHHHHHHHHhhCCCCCCcccccCccccccccc
Q psy4421          42 YKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSY   88 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~   88 (167)
                      .+|.|. |+.   ....+.+|.+++.++++|.        |..|+..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~Yr--------C~~C~~~  152 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYR--------CRRCGET  152 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEE--------CCCCCce
Confidence            469998 998   6788999999999999999        9999987


No 52 
>KOG2231|consensus
Probab=94.58  E-value=0.12  Score=42.06  Aligned_cols=48  Identities=23%  Similarity=0.437  Sum_probs=32.9

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCC------cccccCchhHHHHhhhcC
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLC------NYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~hh  167 (167)
                      -.|..|...|.....|..|++.++    |.|..|      +.-|....+|..|.+.+|
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            467788888888888888877543    344444      344566778888877765


No 53 
>KOG2893|consensus
Probab=93.77  E-value=0.027  Score=39.55  Aligned_cols=32  Identities=25%  Similarity=0.538  Sum_probs=18.0

Q ss_pred             cCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccc
Q psy4421          46 CYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYI   89 (167)
Q Consensus        46 C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~   89 (167)
                      |.+|++.|..+..|.+|++    .|.|+        |-+|.+.+
T Consensus        13 cwycnrefddekiliqhqk----akhfk--------chichkkl   44 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK----AKHFK--------CHICHKKL   44 (341)
T ss_pred             eeecccccchhhhhhhhhh----hccce--------eeeehhhh
Confidence            5566666666555555554    45555        55555553


No 54 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.53  E-value=0.047  Score=26.14  Aligned_cols=24  Identities=29%  Similarity=0.790  Sum_probs=14.1

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      |.|.+||..+....            .++.|+.||.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            56667766554332            4566777764


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.93  E-value=0.045  Score=29.23  Aligned_cols=24  Identities=17%  Similarity=0.447  Sum_probs=11.9

Q ss_pred             CCCceeCCCCcccccCchhHHHHh
Q psy4421         140 DDKPYKCSLCNYECRQNVHLKSHM  163 (167)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~  163 (167)
                      ||--+.|+.||..|+..-++.+|.
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHV   37 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHV   37 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHh
Confidence            344445555555555554554444


No 56 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.92  E-value=0.11  Score=24.83  Aligned_cols=23  Identities=13%  Similarity=0.312  Sum_probs=18.4

Q ss_pred             ceecCccCccccChHHHHHHHHH
Q psy4421          43 KYGCYRCSYFTYESNNLKKHILK   65 (167)
Q Consensus        43 ~~~C~~C~~~~~~~~~l~~H~~~   65 (167)
                      +|.|.+|+..|.+...+..|...
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47789999988888888888743


No 57 
>PHA00626 hypothetical protein
Probab=92.27  E-value=0.069  Score=28.58  Aligned_cols=13  Identities=31%  Similarity=0.787  Sum_probs=7.8

Q ss_pred             CceeCCCCccccc
Q psy4421         142 KPYKCSLCNYECR  154 (167)
Q Consensus       142 ~~~~C~~C~~~f~  154 (167)
                      ..|+|+.||+.|+
T Consensus        22 nrYkCkdCGY~ft   34 (59)
T PHA00626         22 DDYVCCDCGYNDS   34 (59)
T ss_pred             cceEcCCCCCeec
Confidence            4566666666554


No 58 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.02  E-value=0.052  Score=41.47  Aligned_cols=53  Identities=28%  Similarity=0.505  Sum_probs=48.3

Q ss_pred             CcccCCCCCccccCchhHHHHHh--hhCCC--CceeCC--CCcccccCchhHHHHhhhc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLR--LHLDD--KPYKCS--LCNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h  166 (167)
                      .++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.+...+..|..+|
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  346 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLH  346 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccc
Confidence            36889999999999999999999  89999  999999  7999999999998887765


No 59 
>KOG2231|consensus
Probab=91.80  E-value=0.65  Score=37.95  Aligned_cols=93  Identities=17%  Similarity=0.341  Sum_probs=55.2

Q ss_pred             cccChHHHHHHHHH-hhCCCCCCcccccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCC------Ccc
Q psy4421          52 FTYESNNLKKHILK-HTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYAC------EYN  124 (167)
Q Consensus        52 ~~~~~~~l~~H~~~-h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C------~~~  124 (167)
                      ..+....|..|+.. -.++..+.    +-..|..|... |.....+.+|+..           .-|.|..|      +.-
T Consensus       158 k~Yt~~el~~h~~~gd~d~~s~r----Ghp~C~~C~~~-fld~~el~rH~~~-----------~h~~chfC~~~~~~ney  221 (669)
T KOG2231|consen  158 KLYTRAELNLHLMFGDPDDESCR----GHPLCKFCHER-FLDDDELYRHLRF-----------DHEFCHFCDYKTGQNEY  221 (669)
T ss_pred             ehehHHHHHHHHhcCCCcccccc----CCccchhhhhh-hccHHHHHHhhcc-----------ceeheeecCcccccchh
Confidence            34456677777754 22222221    12339999999 8888889998775           22445554      455


Q ss_pred             ccCchhHHHHHhhhCCCCceeCC--CCc-ccccCchhHHHHhh
Q psy4421         125 TYMSGNIKTHLRLHLDDKPYKCS--LCN-YECRQNVHLKSHMK  164 (167)
Q Consensus       125 ~~~~~~l~~H~~~h~~~~~~~C~--~C~-~~f~~~~~l~~H~~  164 (167)
                      |.....|..|-+.+    -|.|.  .|. +.|.....+..+++
T Consensus       222 y~~~~dLe~HfR~~----HflCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  222 YNDYDDLEEHFRKG----HFLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             cccchHHHHHhhhc----CccccccccccceeeehhHHHHHHH
Confidence            66677888887744    36777  454 34554445545544


No 60 
>KOG2482|consensus
Probab=91.33  E-value=0.63  Score=34.73  Aligned_cols=55  Identities=20%  Similarity=0.348  Sum_probs=35.0

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCc---------------ccCCCCCccccCchhHHHHHh
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFK---------------FVCYACEYNTYMSGNIKTHLR  136 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~---------------~~C~~C~~~~~~~~~l~~H~~  136 (167)
                      |..|......+.+.+..|+-..+.+..+.+..-+               +.|-.|.+.|..+..|+.||+
T Consensus       147 ClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  147 CLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             EEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHH
Confidence            8888887677888888887765555544444322               455555555555555555555


No 61 
>KOG1146|consensus
Probab=91.02  E-value=0.13  Score=44.55  Aligned_cols=55  Identities=31%  Similarity=0.689  Sum_probs=46.6

Q ss_pred             CCCCcccCCCCCccccCchhHHHHHhh-hC------------------------CCCceeCCCCcccccCchhHHHHhhh
Q psy4421         111 AFHFKFVCYACEYNTYMSGNIKTHLRL-HL------------------------DDKPYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       111 ~~~~~~~C~~C~~~~~~~~~l~~H~~~-h~------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      ...+.++|+.|+..|.....|-.|+|. |.                        +-++|.|..|...+....+|.+|+.+
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            345789999999999999999999997 11                        24678999999999999999999864


No 62 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.01  E-value=0.24  Score=26.92  Aligned_cols=36  Identities=25%  Similarity=0.545  Sum_probs=23.6

Q ss_pred             CCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         111 AFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       111 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      .....|.|+.||...-.+..-   -|.+  ..+|.|+.||.
T Consensus        23 e~~v~F~CPnCGe~~I~Rc~~---CRk~--g~~Y~Cp~CGF   58 (61)
T COG2888          23 ETAVKFPCPNCGEVEIYRCAK---CRKL--GNPYRCPKCGF   58 (61)
T ss_pred             CceeEeeCCCCCceeeehhhh---HHHc--CCceECCCcCc
Confidence            344579999999665554321   1222  46899999984


No 63 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.92  E-value=0.25  Score=25.22  Aligned_cols=27  Identities=33%  Similarity=0.603  Sum_probs=16.0

Q ss_pred             CCCceeCCCCcccccC----chhHHHHhhhc
Q psy4421         140 DDKPYKCSLCNYECRQ----NVHLKSHMKSN  166 (167)
Q Consensus       140 ~~~~~~C~~C~~~f~~----~~~l~~H~~~h  166 (167)
                      ++....|..|++.+..    .+.|.+|++..
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            3455778888887765    36788888543


No 64 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=90.20  E-value=0.71  Score=28.64  Aligned_cols=25  Identities=28%  Similarity=0.792  Sum_probs=22.3

Q ss_pred             ceeC----CCCcccccCchhHHHHhhhcC
Q psy4421         143 PYKC----SLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       143 ~~~C----~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      .|.|    ..|++.+.+...+..|++.+|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            4889    899999999999999998876


No 65 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.16  E-value=0.22  Score=30.99  Aligned_cols=14  Identities=29%  Similarity=0.648  Sum_probs=7.1

Q ss_pred             CceeCCCCcccccC
Q psy4421         142 KPYKCSLCNYECRQ  155 (167)
Q Consensus       142 ~~~~C~~C~~~f~~  155 (167)
                      .|..|+.||..|..
T Consensus        25 ~PivCP~CG~~~~~   38 (108)
T PF09538_consen   25 DPIVCPKCGTEFPP   38 (108)
T ss_pred             CCccCCCCCCccCc
Confidence            44555555555543


No 66 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.71  E-value=0.21  Score=33.48  Aligned_cols=23  Identities=35%  Similarity=0.987  Sum_probs=19.3

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCN  150 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~  150 (167)
                      .|.|++||.+             +.|+.|-+|+.||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            7999999876             4567889999998


No 67 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.68  E-value=0.33  Score=23.81  Aligned_cols=33  Identities=18%  Similarity=0.455  Sum_probs=20.8

Q ss_pred             cCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         117 VCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       117 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .|+.|+..|.....-     +..+.+...|+.|+..|.
T Consensus         4 ~CP~C~~~f~v~~~~-----l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDK-----LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHH-----cccCCcEEECCCCCcEee
Confidence            577777777766532     223345677888877664


No 68 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.18  E-value=0.25  Score=23.77  Aligned_cols=25  Identities=32%  Similarity=0.773  Sum_probs=15.3

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      .|+|.+||..+...            +.|..|+.||.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            36777777664432            24567777774


No 69 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=88.99  E-value=0.13  Score=34.16  Aligned_cols=12  Identities=17%  Similarity=0.468  Sum_probs=7.6

Q ss_pred             eeCCCCcccccC
Q psy4421         144 YKCSLCNYECRQ  155 (167)
Q Consensus       144 ~~C~~C~~~f~~  155 (167)
                      +.|+.||++|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            666666666654


No 70 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=88.92  E-value=0.4  Score=23.53  Aligned_cols=35  Identities=20%  Similarity=0.369  Sum_probs=23.1

Q ss_pred             cccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCcccc
Q psy4421           7 INQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTY   54 (167)
Q Consensus         7 ~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~   54 (167)
                      .+.|+.|+..|....+..        .    . ......|+.|+..|.
T Consensus         2 ~~~CP~C~~~~~v~~~~~--------~----~-~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         2 RIQCPNCKTSFRVVDSQL--------G----A-NGGKVRCGKCGHVWY   36 (38)
T ss_pred             EEECCCCCCEEEeCHHHc--------C----C-CCCEEECCCCCCEEE
Confidence            367888998887766544        1    1 112477999988764


No 71 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.33  E-value=0.49  Score=23.07  Aligned_cols=33  Identities=15%  Similarity=0.410  Sum_probs=19.7

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      ..|+.|+..|.-....     +-.+.....|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            3577777777666542     22333456777777666


No 72 
>KOG1146|consensus
Probab=87.91  E-value=0.088  Score=45.58  Aligned_cols=111  Identities=14%  Similarity=0.135  Sum_probs=68.0

Q ss_pred             cccccccccCchHHHHHHhhhhhccccCC--C--CCccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCccccc
Q psy4421           9 QCVHCHLTLTKSTEVIVKHAQTCISMVRP--D--SFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIH   84 (167)
Q Consensus         9 ~C~~C~~~f~~~~~l~~~~~~~~~~h~~~--~--~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~   84 (167)
                      .|..|...|.......        .+..-  +  .....+.|..|++.+.....+. ++   ....+|.        |..
T Consensus      1230 ~~~~~e~~f~~~~~~~--------~~a~~~~~~~~~sGe~~c~~~~~~~~~~~~~~-~l---~~~~~~~--------~~~ 1289 (1406)
T KOG1146|consen 1230 LPNALEQPFPQEPEPT--------ATAPPKPPELPASGEGECGAVDELLTPSFGIS-TL---DVTHRYL--------CRQ 1289 (1406)
T ss_pred             cHHhhhcCccCccccc--------ccCCCCCCcCcCCCcchhhhccccccCcccee-ec---ccchhHH--------HHH
Confidence            4556666666665555        33221  1  1122367888888877766554 33   2344566        888


Q ss_pred             ccccccCChHHHHHHHhhcCCCCCCCCCC----------CcccCCCCCccccCchhHHHHHhhhCCC
Q psy4421          85 CNSYISSDIKDLIEHCKSCSHMTRPDAFH----------FKFVCYACEYNTYMSGNIKTHLRLHLDD  141 (167)
Q Consensus        85 c~~~~~~~~~~l~~h~~~~~~~~~~~~~~----------~~~~C~~C~~~~~~~~~l~~H~~~h~~~  141 (167)
                      |... |.....+..|...+..+.+...+.          ..| |..|...|.....|..|+++-+++
T Consensus      1290 ~~~~-~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~~ 1354 (1406)
T KOG1146|consen 1290 CKMA-FDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAHR 1354 (1406)
T ss_pred             HHhh-hcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhhc
Confidence            8777 888888888876655444332221          124 888888888888888887754443


No 73 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.68  E-value=2  Score=26.89  Aligned_cols=48  Identities=15%  Similarity=0.258  Sum_probs=32.1

Q ss_pred             cCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhhc
Q psy4421         117 VCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       117 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (167)
                      .|-.|+..|........  ..-.....|.|+.|...|-..-++..|...|
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhcc
Confidence            48888888876532110  0012245799999999998888888887655


No 74 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.68  E-value=0.21  Score=35.11  Aligned_cols=43  Identities=19%  Similarity=0.393  Sum_probs=25.0

Q ss_pred             CcccCCCCCccccCchhHHHHHhh----------hCCCCc-----eeCCCCcccccCc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRL----------HLDDKP-----YKCSLCNYECRQN  156 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~----------h~~~~~-----~~C~~C~~~f~~~  156 (167)
                      +.+.||+|+..|....-.....++          -.|..|     ..|+.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            456778888777765433322221          122344     3799999887653


No 75 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=85.99  E-value=0.37  Score=27.57  Aligned_cols=40  Identities=13%  Similarity=0.199  Sum_probs=22.9

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCC--CCcccccCch
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCS--LCNYECRQNV  157 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~--~C~~~f~~~~  157 (167)
                      +.|+.|+.......+-.....  ..+..+.|.  .||.+|....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~--~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT--TKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh--hheeeeecCCCCCCCEEEEEE
Confidence            457777765544433222222  346667887  7888886543


No 76 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=85.99  E-value=0.58  Score=24.10  Aligned_cols=30  Identities=17%  Similarity=0.561  Sum_probs=17.6

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .|.|+.||..+.....          .....|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCceECCCCCCeEE
Confidence            4677777766554321          11567777776543


No 77 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.83  E-value=0.37  Score=31.97  Aligned_cols=43  Identities=12%  Similarity=0.252  Sum_probs=24.4

Q ss_pred             ccccccccccCchHHHHHHhhhhhccccCC-CCCccceecCccCccccChHHH
Q psy4421           8 NQCVHCHLTLTKSTEVIVKHAQTCISMVRP-DSFKYKYGCYRCSYFTYESNNL   59 (167)
Q Consensus         8 ~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~-~~~~~~~~C~~C~~~~~~~~~l   59 (167)
                      +.|+.|+..+....+-+         -+.. ..-++.++|+.||++|.....+
T Consensus         1 m~cp~c~~~~~~~~~s~---------~~~~~~~~~~~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSR---------PAEDGNAIRRRRECLACGKRFTTFERV   44 (154)
T ss_pred             CcCCCCCCCCCEeEecc---------ccCCCCceeeeeeccccCCcceEeEec
Confidence            47999998763221111         0111 1122348999999999866543


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=85.35  E-value=0.87  Score=29.97  Aligned_cols=17  Identities=18%  Similarity=0.188  Sum_probs=9.8

Q ss_pred             ccceecCccCccccChH
Q psy4421          41 KYKYGCYRCSYFTYESN   57 (167)
Q Consensus        41 ~~~~~C~~C~~~~~~~~   57 (167)
                      ..-|.|+.|+..|....
T Consensus        97 ~~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       97 NAYYKCPNCQSKYTFLE  113 (147)
T ss_pred             CcEEECcCCCCEeeHHH
Confidence            33466666666665443


No 79 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=85.35  E-value=0.49  Score=35.35  Aligned_cols=48  Identities=19%  Similarity=0.449  Sum_probs=25.7

Q ss_pred             cCCCCCccccCchhHHHHHhhhCCCCceeCCCCc----ccccCchhHHHHhhh
Q psy4421         117 VCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCN----YECRQNVHLKSHMKS  165 (167)
Q Consensus       117 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~----~~f~~~~~l~~H~~~  165 (167)
                      .|..|...|.....|..|+|..+ |+-|.|..=+    .-|....+|.+|.+.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~~  273 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFRN  273 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhhc
Confidence            56666666666677777766433 3333333222    224455566666653


No 80 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=85.06  E-value=0.81  Score=23.45  Aligned_cols=28  Identities=18%  Similarity=0.627  Sum_probs=17.6

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      .|.|..||..|...           ...+..|+.||.+-
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~irC~~CG~rI   29 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDVVRCRECGYRI   29 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCceECCCCCceE
Confidence            36777777766543           13457788887643


No 81 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.00  E-value=0.41  Score=33.61  Aligned_cols=44  Identities=20%  Similarity=0.341  Sum_probs=28.0

Q ss_pred             CCcccccccccccCchHHHHHHhhhhhccccC---CCC-------Cccc-----eecCccCccccCh
Q psy4421           5 LNINQCVHCHLTLTKSTEVIVKHAQTCISMVR---PDS-------FKYK-----YGCYRCSYFTYES   56 (167)
Q Consensus         5 ~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~---~~~-------~~~~-----~~C~~C~~~~~~~   56 (167)
                      ++.++|++|+..|....-..        ...+   .++       +..|     ..|+.||+.+...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs--------~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRS--------GKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEc--------CCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            57789999999998864322        2221   122       2222     5799999977644


No 82 
>KOG2893|consensus
Probab=84.53  E-value=0.29  Score=34.54  Aligned_cols=45  Identities=31%  Similarity=0.595  Sum_probs=35.3

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHH-Hhhh
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTH-LRLH  138 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H-~~~h  138 (167)
                      |=.|++. |....-|++|++.           +-|+|.+|-+...+...|..| +++|
T Consensus        13 cwycnre-fddekiliqhqka-----------khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNRE-FDDEKILIQHQKA-----------KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccc-cchhhhhhhhhhh-----------ccceeeeehhhhccCCCceeehhhhh
Confidence            8889988 8888888887766           678899998877777777777 5555


No 83 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=84.11  E-value=0.68  Score=29.65  Aligned_cols=15  Identities=20%  Similarity=0.569  Sum_probs=13.1

Q ss_pred             cccccccccccCchH
Q psy4421           7 INQCVHCHLTLTKST   21 (167)
Q Consensus         7 ~~~C~~C~~~f~~~~   21 (167)
                      |+.|..|+..|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678999999998876


No 84 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=83.45  E-value=2.2  Score=23.29  Aligned_cols=34  Identities=26%  Similarity=0.676  Sum_probs=21.9

Q ss_pred             CCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         113 HFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       113 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      ...|.|+.||.....+..   .-|..  ..+|.|+.||.
T Consensus        23 ~~~F~CPnCG~~~I~RC~---~CRk~--~~~Y~CP~CGF   56 (59)
T PRK14890         23 AVKFLCPNCGEVIIYRCE---KCRKQ--SNPYTCPKCGF   56 (59)
T ss_pred             cCEeeCCCCCCeeEeech---hHHhc--CCceECCCCCC
Confidence            356999999987444322   11112  36899999985


No 85 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=82.74  E-value=1  Score=23.63  Aligned_cols=22  Identities=23%  Similarity=0.631  Sum_probs=14.8

Q ss_pred             ceeCCCCcccccCc-----hhHHHHhh
Q psy4421         143 PYKCSLCNYECRQN-----VHLKSHMK  164 (167)
Q Consensus       143 ~~~C~~C~~~f~~~-----~~l~~H~~  164 (167)
                      .-.|..|++.+...     +.|.+|++
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            35677777766554     57777776


No 86 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.54  E-value=1  Score=28.68  Aligned_cols=14  Identities=7%  Similarity=-0.446  Sum_probs=6.8

Q ss_pred             CcccCCCCCccccC
Q psy4421         114 FKFVCYACEYNTYM  127 (167)
Q Consensus       114 ~~~~C~~C~~~~~~  127 (167)
                      .|..|+.||..|..
T Consensus        25 ~p~vcP~cg~~~~~   38 (129)
T TIGR02300        25 RPAVSPYTGEQFPP   38 (129)
T ss_pred             CCccCCCcCCccCc
Confidence            34455555554433


No 87 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=82.33  E-value=0.96  Score=30.39  Aligned_cols=21  Identities=24%  Similarity=0.371  Sum_probs=18.2

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCc
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEY  123 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~  123 (167)
                      |++||..                     ..++.|.+||+|+-
T Consensus       137 C~vCGy~---------------------~~ge~P~~CPiCga  157 (166)
T COG1592         137 CPVCGYT---------------------HEGEAPEVCPICGA  157 (166)
T ss_pred             cCCCCCc---------------------ccCCCCCcCCCCCC
Confidence            9999987                     66688999999994


No 88 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=82.03  E-value=0.43  Score=25.58  Aligned_cols=20  Identities=15%  Similarity=0.514  Sum_probs=10.4

Q ss_pred             CCcccccccccccCchHHHH
Q psy4421           5 LNINQCVHCHLTLTKSTEVI   24 (167)
Q Consensus         5 ~~~~~C~~C~~~f~~~~~l~   24 (167)
                      +.-+.|+-|+..|....++.
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~   34 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYI   34 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHH
Confidence            33445555555555555555


No 89 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=81.72  E-value=1.3  Score=23.91  Aligned_cols=43  Identities=16%  Similarity=0.372  Sum_probs=25.9

Q ss_pred             CcccCCC-CCccccCchhHHHHHhhhCCCCceeCCC----CcccccCc
Q psy4421         114 FKFVCYA-CEYNTYMSGNIKTHLRLHLDDKPYKCSL----CNYECRQN  156 (167)
Q Consensus       114 ~~~~C~~-C~~~~~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~  156 (167)
                      .+..|+. |+..-..+..|..|....-..++..|.+    |+..+...
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEEHH
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccchh
Confidence            4567877 3333334668899998777778889999    88776543


No 90 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=80.90  E-value=0.51  Score=21.61  Aligned_cols=18  Identities=28%  Similarity=0.606  Sum_probs=11.5

Q ss_pred             eeCCCCcccccCchhHHHH
Q psy4421         144 YKCSLCNYECRQNVHLKSH  162 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H  162 (167)
                      |.|..|++.| ...++..|
T Consensus         1 ~sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT-
T ss_pred             CeeecCCCCc-CcCCcCCC
Confidence            5688899888 44444444


No 91 
>KOG2482|consensus
Probab=80.31  E-value=2.3  Score=31.86  Aligned_cols=49  Identities=20%  Similarity=0.358  Sum_probs=37.0

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCC---------------------------CCceeCCCCcccccCchhHHHHhh
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLD---------------------------DKPYKCSLCNYECRQNVHLKSHMK  164 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~  164 (167)
                      .+|-.|.....+...|..||..-+.                           ...-.|-.|...|-....|..|+-
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~  355 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMV  355 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcc
Confidence            6888888888888888888774332                           112357789889999999999874


No 92 
>KOG2186|consensus
Probab=79.93  E-value=0.81  Score=32.66  Aligned_cols=46  Identities=17%  Similarity=0.249  Sum_probs=32.8

Q ss_pred             ccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHH
Q psy4421           8 NQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHIL   64 (167)
Q Consensus         8 ~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~   64 (167)
                      |.|..||.+... ..+.        +|+..-.+ .-|.|-+|+..|.. .....|..
T Consensus         4 FtCnvCgEsvKK-p~ve--------kH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVE--------KHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchH--------HHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            689999998654 4566        67665445 44999999999987 44555643


No 93 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.70  E-value=5.1  Score=26.34  Aligned_cols=41  Identities=15%  Similarity=0.361  Sum_probs=27.1

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      ......|.|+.|+..|.....+..-   .. ...|.|+.||....
T Consensus        94 e~~~~~Y~Cp~C~~~y~~~ea~~~~---d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       94 ETNNAYYKCPNCQSKYTFLEANQLL---DM-DGTFTCPRCGEELE  134 (147)
T ss_pred             ccCCcEEECcCCCCEeeHHHHHHhc---CC-CCcEECCCCCCEEE
Confidence            3445579999999888865443220   12 34499999998664


No 94 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=79.51  E-value=1.5  Score=26.76  Aligned_cols=19  Identities=26%  Similarity=0.503  Sum_probs=14.9

Q ss_pred             CcccccccccccCchHHHH
Q psy4421           6 NINQCVHCHLTLTKSTEVI   24 (167)
Q Consensus         6 ~~~~C~~C~~~f~~~~~l~   24 (167)
                      +|+.|..||..|.+-+...
T Consensus         1 MpH~CtrCG~vf~~g~~~i   19 (112)
T COG3364           1 MPHQCTRCGEVFDDGSEEI   19 (112)
T ss_pred             CCceecccccccccccHHH
Confidence            5788999999998865544


No 95 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=79.23  E-value=1.3  Score=31.14  Aligned_cols=29  Identities=21%  Similarity=0.372  Sum_probs=22.0

Q ss_pred             CCccceecCccCccccChHHHHHHHHHhh
Q psy4421          39 SFKYKYGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus        39 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      ..+..|.|..|+|.|.....+.+|+...+
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            34556999999999999999999997643


No 96 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=79.22  E-value=0.92  Score=27.53  Aligned_cols=42  Identities=17%  Similarity=0.308  Sum_probs=27.9

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      +..++.|.|+.|+..-.+...+.    .........|..||.+|..
T Consensus        17 ~~L~k~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e~   58 (104)
T COG4888          17 QVLPKTFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             ccCCceEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEEE
Confidence            44678899999997665544321    1222345789999998853


No 97 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=79.12  E-value=0.99  Score=21.06  Aligned_cols=24  Identities=21%  Similarity=0.407  Sum_probs=9.9

Q ss_pred             cCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         117 VCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       117 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      +|+.|+..+..           .+...+.|+.|+.
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCcccc
Confidence            46666665555           2344577777764


No 98 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=78.90  E-value=2.3  Score=31.95  Aligned_cols=131  Identities=21%  Similarity=0.402  Sum_probs=72.6

Q ss_pred             cccc--ccccccCchHHHHHHhhhhhccccCCCCCccceecCccCc---cccC------hHHHHHHHHHhhCCCCCCccc
Q psy4421           8 NQCV--HCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSY---FTYE------SNNLKKHILKHTGEKPFSYMY   76 (167)
Q Consensus         8 ~~C~--~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~---~~~~------~~~l~~H~~~h~~~~~~~~~~   76 (167)
                      |.|+  .|..+......|.        .|.+..++  .+.|.+|-.   .|..      ...|..|+..-..+.-|    
T Consensus       152 F~CP~skc~~~C~~~k~lk--------~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GF----  217 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELK--------KHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGF----  217 (493)
T ss_pred             hcCCchhhhhhhhhHHHHH--------HHHHhhcC--cEEhHhhhcCcccCccceeeeecccccccccCCccccCc----
Confidence            4555  3555555566777        66654332  256777743   3332      33444444321111122    


Q ss_pred             ccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCC----ccccCchhHHHHHhhhCCCCceeCCC--Cc
Q psy4421          77 ENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACE----YNTYMSGNIKTHLRLHLDDKPYKCSL--CN  150 (167)
Q Consensus        77 ~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~----~~~~~~~~l~~H~~~h~~~~~~~C~~--C~  150 (167)
                      -+-..|..|... |-+...|..|+..       . -++-+.|..-+    .-|.+-..|-.|-+    ..-|.|..  |-
T Consensus       218 KGHP~C~FC~~~-FYdDDEL~~HcR~-------~-HE~ChICD~v~p~~~QYFK~Y~~Le~HF~----~~hy~ct~qtc~  284 (493)
T COG5236         218 KGHPLCIFCKIY-FYDDDELRRHCRL-------R-HEACHICDMVGPIRYQYFKSYEDLEAHFR----NAHYCCTFQTCR  284 (493)
T ss_pred             CCCchhhhccce-ecChHHHHHHHHh-------h-hhhhhhhhccCccchhhhhCHHHHHHHhh----cCceEEEEEEEe
Confidence            233458999977 8888889999886       2 23333333322    23555566767655    23466654  32


Q ss_pred             ----ccccCchhHHHHhhh
Q psy4421         151 ----YECRQNVHLKSHMKS  165 (167)
Q Consensus       151 ----~~f~~~~~l~~H~~~  165 (167)
                          ..|.....|..|+..
T Consensus       285 ~~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         285 VGKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             cCcEEEeccHHHHHHHHHH
Confidence                468888888888754


No 99 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=78.18  E-value=0.57  Score=24.75  Aligned_cols=13  Identities=23%  Similarity=0.345  Sum_probs=6.6

Q ss_pred             eecCccCccccCh
Q psy4421          44 YGCYRCSYFTYES   56 (167)
Q Consensus        44 ~~C~~C~~~~~~~   56 (167)
                      |.|..|+..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            4555555554443


No 100
>KOG2785|consensus
Probab=77.69  E-value=2.7  Score=31.92  Aligned_cols=52  Identities=15%  Similarity=0.303  Sum_probs=44.3

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCC-----------------------CCceeCCCCc---ccccCchhHHHHhhh
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLD-----------------------DKPYKCSLCN---YECRQNVHLKSHMKS  165 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~-----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~  165 (167)
                      .|-.|..|+..+.+...-..||..++|                       ...+.|-.|+   +.|++..+.+.|+..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            457899999999999988999998886                       3357888898   999999999999964


No 101
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.17  E-value=2.6  Score=28.16  Aligned_cols=36  Identities=11%  Similarity=0.298  Sum_probs=26.9

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .....-|.|+.|+..|+....+.         ..|.|+.||....
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            34445689999998888877763         3699999997654


No 102
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.10  E-value=0.75  Score=22.79  Aligned_cols=29  Identities=24%  Similarity=0.441  Sum_probs=15.8

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      |+|+.|+..|......       .....-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~-------~~~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKI-------SDDPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEec-------CCCCCCCCCCCCC
Confidence            5677777766544322       1123456777775


No 103
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=76.16  E-value=1.4  Score=30.90  Aligned_cols=23  Identities=17%  Similarity=0.548  Sum_probs=10.4

Q ss_pred             ceeCCCCcccccCchhHHHHhhh
Q psy4421         143 PYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      .|.|..|+|.|.-..-+.+|+..
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhh
Confidence            35555555555555555555443


No 104
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.86  E-value=0.6  Score=23.60  Aligned_cols=12  Identities=17%  Similarity=0.512  Sum_probs=6.7

Q ss_pred             ccccccccccCc
Q psy4421           8 NQCVHCHLTLTK   19 (167)
Q Consensus         8 ~~C~~C~~~f~~   19 (167)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            556666655543


No 105
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=75.71  E-value=2.4  Score=18.95  Aligned_cols=18  Identities=28%  Similarity=0.678  Sum_probs=10.0

Q ss_pred             eCCCCcccccCchhHHHHh
Q psy4421         145 KCSLCNYECRQNVHLKSHM  163 (167)
Q Consensus       145 ~C~~C~~~f~~~~~l~~H~  163 (167)
                      .|+.|++.+ ....+.+|+
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            466666665 334555554


No 106
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=74.51  E-value=2.3  Score=20.11  Aligned_cols=9  Identities=22%  Similarity=0.785  Sum_probs=3.9

Q ss_pred             eeCCCCccc
Q psy4421         144 YKCSLCNYE  152 (167)
Q Consensus       144 ~~C~~C~~~  152 (167)
                      ..|+.||.+
T Consensus        18 irC~~CG~R   26 (32)
T PF03604_consen   18 IRCPECGHR   26 (32)
T ss_dssp             SSBSSSS-S
T ss_pred             EECCcCCCe
Confidence            445555543


No 107
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=74.20  E-value=0.9  Score=29.76  Aligned_cols=12  Identities=17%  Similarity=0.429  Sum_probs=6.4

Q ss_pred             eeCCCCcccccC
Q psy4421         144 YKCSLCNYECRQ  155 (167)
Q Consensus       144 ~~C~~C~~~f~~  155 (167)
                      -.|..||++|++
T Consensus        29 ReC~~C~~RFTT   40 (147)
T TIGR00244        29 RECLECHERFTT   40 (147)
T ss_pred             ccCCccCCccce
Confidence            345555555554


No 108
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=74.20  E-value=2  Score=22.54  Aligned_cols=30  Identities=13%  Similarity=0.564  Sum_probs=18.8

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      ..|.|..|+..|...          .......|+.||.+-
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~irCp~Cg~rI   34 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRGIRCPYCGSRI   34 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCceeCCCCCcEE
Confidence            357888888877211          123457888888643


No 109
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=73.51  E-value=3.7  Score=25.40  Aligned_cols=25  Identities=36%  Similarity=0.792  Sum_probs=22.4

Q ss_pred             eec----CccCccccChHHHHHHHHHhhC
Q psy4421          44 YGC----YRCSYFTYESNNLKKHILKHTG   68 (167)
Q Consensus        44 ~~C----~~C~~~~~~~~~l~~H~~~h~~   68 (167)
                      |.|    ..|++.+.+...|.+|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999987653


No 110
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=73.31  E-value=3.2  Score=28.30  Aligned_cols=35  Identities=14%  Similarity=0.452  Sum_probs=25.3

Q ss_pred             CCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         112 FHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       112 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      ...-|.|+.|+..|.....+         +..|.|+.||.....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~---------~~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAM---------EYGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHh---------hcCCcCCCCCCCCee
Confidence            34568999999888777654         236899999975543


No 111
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=71.67  E-value=2  Score=19.26  Aligned_cols=9  Identities=33%  Similarity=0.969  Sum_probs=4.1

Q ss_pred             cCCCCCccc
Q psy4421         117 VCYACEYNT  125 (167)
Q Consensus       117 ~C~~C~~~~  125 (167)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            344444444


No 112
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=71.19  E-value=3.3  Score=29.85  Aligned_cols=15  Identities=27%  Similarity=0.552  Sum_probs=8.6

Q ss_pred             ccceecCccCccccC
Q psy4421          41 KYKYGCYRCSYFTYE   55 (167)
Q Consensus        41 ~~~~~C~~C~~~~~~   55 (167)
                      -+.|.|..|....-.
T Consensus       140 Grif~CsfC~~flCE  154 (314)
T PF06524_consen  140 GRIFKCSFCDNFLCE  154 (314)
T ss_pred             CeEEEeecCCCeeec
Confidence            344777777664433


No 113
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=70.19  E-value=1.3  Score=29.13  Aligned_cols=12  Identities=17%  Similarity=0.407  Sum_probs=5.9

Q ss_pred             eeCCCCcccccC
Q psy4421         144 YKCSLCNYECRQ  155 (167)
Q Consensus       144 ~~C~~C~~~f~~  155 (167)
                      -.|..||.+|++
T Consensus        29 ReC~~C~~RFTT   40 (156)
T COG1327          29 RECLECGERFTT   40 (156)
T ss_pred             hcccccccccch
Confidence            345555555543


No 114
>PF14353 CpXC:  CpXC protein
Probab=70.08  E-value=0.8  Score=29.27  Aligned_cols=15  Identities=13%  Similarity=0.239  Sum_probs=11.1

Q ss_pred             ceecCccCccccChH
Q psy4421          43 KYGCYRCSYFTYESN   57 (167)
Q Consensus        43 ~~~C~~C~~~~~~~~   57 (167)
                      .+.|+.||..|.-..
T Consensus        38 ~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEY   52 (128)
T ss_pred             EEECCCCCCceecCC
Confidence            488999988776544


No 115
>KOG3408|consensus
Probab=69.87  E-value=3  Score=26.30  Aligned_cols=26  Identities=23%  Similarity=0.404  Sum_probs=16.2

Q ss_pred             CCCceeCCCCcccccCchhHHHHhhh
Q psy4421         140 DDKPYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      |...|.|-.|.+-|.....|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            34456666666666666666666654


No 116
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=69.77  E-value=3.1  Score=27.77  Aligned_cols=35  Identities=11%  Similarity=0.294  Sum_probs=23.8

Q ss_pred             CCCccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccc
Q psy4421          38 DSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYI   89 (167)
Q Consensus        38 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~   89 (167)
                      ..+..-|.|+.|+..|.....+..         .|.        |+.||..+
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~~---------~F~--------Cp~Cg~~L  138 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAMEL---------NFT--------CPRCGAML  138 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHHc---------CCc--------CCCCCCEe
Confidence            334455788888887777776651         566        88888774


No 117
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=69.67  E-value=3.6  Score=26.61  Aligned_cols=22  Identities=23%  Similarity=0.513  Sum_probs=10.2

Q ss_pred             ceeCCCCcccccCchhHHHHhhhcC
Q psy4421         143 PYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      ...|-+||+.|...   .+|+++||
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~   93 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHH   93 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT
T ss_pred             eeEEccCCcccchH---HHHHHHcc
Confidence            35566666666543   56666553


No 118
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=69.40  E-value=1.1  Score=22.45  Aligned_cols=11  Identities=36%  Similarity=0.932  Sum_probs=7.8

Q ss_pred             eeCCCCccccc
Q psy4421         144 YKCSLCNYECR  154 (167)
Q Consensus       144 ~~C~~C~~~f~  154 (167)
                      |.|..|+..+.
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            77877877654


No 119
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=68.97  E-value=4.2  Score=21.42  Aligned_cols=12  Identities=25%  Similarity=0.852  Sum_probs=8.9

Q ss_pred             CceeCCCCcccc
Q psy4421         142 KPYKCSLCNYEC  153 (167)
Q Consensus       142 ~~~~C~~C~~~f  153 (167)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            567888888754


No 120
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=68.14  E-value=6.1  Score=20.19  Aligned_cols=23  Identities=30%  Similarity=0.761  Sum_probs=19.1

Q ss_pred             ceecCccCccccChHHHHHHHHH
Q psy4421          43 KYGCYRCSYFTYESNNLKKHILK   65 (167)
Q Consensus        43 ~~~C~~C~~~~~~~~~l~~H~~~   65 (167)
                      .|+|-+|..+...++.|..|++-
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            37899999988888888888864


No 121
>KOG2593|consensus
Probab=67.34  E-value=7.3  Score=30.25  Aligned_cols=40  Identities=18%  Similarity=0.352  Sum_probs=28.6

Q ss_pred             CCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         111 AFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       111 ~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      .....|.|+.|.+.|.....++-   +-.....|.|..|+--.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGGEL  163 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hcccCceEEEecCCCch
Confidence            44457999999999988766542   33335679999998533


No 122
>KOG2593|consensus
Probab=67.21  E-value=4.2  Score=31.48  Aligned_cols=36  Identities=17%  Similarity=0.290  Sum_probs=21.8

Q ss_pred             CCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCc
Q psy4421           5 LNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSY   51 (167)
Q Consensus         5 ~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~   51 (167)
                      ...|.|+.|.+.|...-.+.           ........|.|..|+-
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~-----------L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQ-----------LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccCCccccchhhhHHHH-----------hhcccCceEEEecCCC
Confidence            45577888888776554444           2223344577877764


No 123
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=66.27  E-value=5.2  Score=23.73  Aligned_cols=30  Identities=30%  Similarity=0.549  Sum_probs=19.6

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .|.|+.|++.-        +.++.  -.-+.|..||..|.
T Consensus        35 ~~~Cp~C~~~~--------VkR~a--~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRTT--------VKRIA--TGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCcc--------eeeec--cCeEEcCCCCCeec
Confidence            57888888652        22323  24578888888875


No 124
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=65.72  E-value=6.2  Score=17.34  Aligned_cols=9  Identities=33%  Similarity=0.870  Sum_probs=5.2

Q ss_pred             CcccCCCCC
Q psy4421         114 FKFVCYACE  122 (167)
Q Consensus       114 ~~~~C~~C~  122 (167)
                      ..|.|+.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            456666665


No 125
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.91  E-value=5.8  Score=24.58  Aligned_cols=12  Identities=8%  Similarity=-0.283  Sum_probs=5.8

Q ss_pred             CcccCCCCCccc
Q psy4421         114 FKFVCYACEYNT  125 (167)
Q Consensus       114 ~~~~C~~C~~~~  125 (167)
                      .|..|++||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            344455555444


No 126
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=63.42  E-value=11  Score=19.27  Aligned_cols=28  Identities=25%  Similarity=0.634  Sum_probs=17.5

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      .+.|+.|+..-..  .+       .+...|.|..|++
T Consensus        18 g~~CP~Cg~~~~~--~~-------~~~~~~~C~~C~~   45 (46)
T PF12760_consen   18 GFVCPHCGSTKHY--RL-------KTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCeeeE--Ee-------CCCCeEECCCCCC
Confidence            3779999865111  11       1156799998875


No 127
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=62.32  E-value=0.38  Score=23.92  Aligned_cols=10  Identities=30%  Similarity=0.793  Sum_probs=7.5

Q ss_pred             eeCCCCcccc
Q psy4421         144 YKCSLCNYEC  153 (167)
Q Consensus       144 ~~C~~C~~~f  153 (167)
                      |.|..||..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7787887765


No 128
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=61.87  E-value=4.2  Score=24.25  Aligned_cols=14  Identities=14%  Similarity=0.437  Sum_probs=11.3

Q ss_pred             cceecCccCccccC
Q psy4421          42 YKYGCYRCSYFTYE   55 (167)
Q Consensus        42 ~~~~C~~C~~~~~~   55 (167)
                      .|-.|..||+.|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            46789999998877


No 129
>KOG2186|consensus
Probab=61.30  E-value=5.7  Score=28.57  Aligned_cols=45  Identities=22%  Similarity=0.481  Sum_probs=32.9

Q ss_pred             eecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccccCChHHHHHHH
Q psy4421          44 YGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHC  100 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~  100 (167)
                      |.|+.||....-+ .+.+|+..=++ .-|.        |+.|+.. |.. ..+..|.
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fS--------CIDC~k~-F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFS--------CIDCGKT-FER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeE--------Eeecccc-ccc-chhhhhh
Confidence            8899999876544 57778877666 4566        9999999 665 4455553


No 130
>KOG2907|consensus
Probab=60.61  E-value=4.8  Score=25.08  Aligned_cols=39  Identities=28%  Similarity=0.646  Sum_probs=25.4

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCc---eeCCCCcccccCc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKP---YKCSLCNYECRQN  156 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~---~~C~~C~~~f~~~  156 (167)
                      ..+|+.||-.-+.-..|+  +| .++|..   |.|+.|++.|...
T Consensus        74 ~~kCpkCghe~m~Y~T~Q--lR-SADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTLQ--LR-SADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             hccCcccCCchhhhhhhh--cc-cccCCceEEEEcCccceeeecc
Confidence            368999997654444332  22 344443   8999999998753


No 131
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=60.43  E-value=9.1  Score=20.64  Aligned_cols=18  Identities=33%  Similarity=0.534  Sum_probs=11.4

Q ss_pred             CCCCcccCCCCCccccCc
Q psy4421         111 AFHFKFVCYACEYNTYMS  128 (167)
Q Consensus       111 ~~~~~~~C~~C~~~~~~~  128 (167)
                      .+...|.|+.||..+.-+
T Consensus        10 ~~~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen   10 PAHVNFECPDCGIPTHCS   27 (55)
T ss_pred             ccccCCcCCCCCCcCccC
Confidence            444567888888655443


No 132
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=59.92  E-value=2.9  Score=21.63  Aligned_cols=37  Identities=14%  Similarity=0.261  Sum_probs=20.0

Q ss_pred             CCCCCccccCchhHHHHHhhhCCCCceeCCC--CcccccCc
Q psy4421         118 CYACEYNTYMSGNIKTHLRLHLDDKPYKCSL--CNYECRQN  156 (167)
Q Consensus       118 C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~  156 (167)
                      ||.||....-..+...+.  -..+.-+.|..  ||.+|...
T Consensus         2 CP~Cg~~a~ir~S~~~s~--~~~~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLSP--LTRELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             cCCCCCeeEEEEchhhCc--ceEEEEEEECCCcCCCEEEEE
Confidence            667775544444332221  12245577866  88877654


No 133
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=58.68  E-value=5.1  Score=21.06  Aligned_cols=16  Identities=31%  Similarity=0.503  Sum_probs=13.1

Q ss_pred             CCceeCCCCcccccCc
Q psy4421         141 DKPYKCSLCNYECRQN  156 (167)
Q Consensus       141 ~~~~~C~~C~~~f~~~  156 (167)
                      ++.+.|..||..|...
T Consensus         2 Dk~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFT   17 (49)
T ss_pred             CeeEEcccCCCeEEEe
Confidence            5678999999988764


No 134
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=58.32  E-value=3.9  Score=25.67  Aligned_cols=38  Identities=29%  Similarity=0.564  Sum_probs=23.1

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCC---ceeCCCCcccccC
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDK---PYKCSLCNYECRQ  155 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~---~~~C~~C~~~f~~  155 (167)
                      -+.|+.|+..-.....|+.-   -+++.   -|.|..||.+|+.
T Consensus        72 ~~~CpkCg~~ea~y~~~QtR---saDEp~T~Fy~C~~Cg~~wre  112 (113)
T COG1594          72 KEKCPKCGNKEAYYWQLQTR---SADEPETRFYKCTRCGYRWRE  112 (113)
T ss_pred             cccCCCCCCceeEEEeeehh---ccCCCceEEEEecccCCEeec
Confidence            36788888654444443322   22232   3899999987753


No 135
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=58.09  E-value=11  Score=19.55  Aligned_cols=11  Identities=45%  Similarity=1.262  Sum_probs=5.6

Q ss_pred             cccCCCCCccc
Q psy4421         115 KFVCYACEYNT  125 (167)
Q Consensus       115 ~~~C~~C~~~~  125 (167)
                      .+.|+.|+..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45555555443


No 136
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=57.98  E-value=3.4  Score=21.91  Aligned_cols=16  Identities=13%  Similarity=0.559  Sum_probs=5.3

Q ss_pred             cccCCCCCccccCchh
Q psy4421         115 KFVCYACEYNTYMSGN  130 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~  130 (167)
                      .|+|+.|...|-..-.
T Consensus        21 ~y~C~~C~~~FC~dCD   36 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCD   36 (51)
T ss_dssp             EE--TTTT--B-HHHH
T ss_pred             eEECCCCCCccccCcC
Confidence            4555555555544433


No 137
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=57.39  E-value=6.1  Score=19.86  Aligned_cols=29  Identities=14%  Similarity=0.348  Sum_probs=14.9

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      |.|+.|+......         -....-+.|+.||...
T Consensus         1 m~Cp~Cg~~~~~~---------D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    1 MKCPNCGSKEIVF---------DPERGELVCPNCGLVL   29 (43)
T ss_dssp             ESBTTTSSSEEEE---------ETTTTEEEETTT-BBE
T ss_pred             CCCcCCcCCceEE---------cCCCCeEECCCCCCEe
Confidence            4577777643211         1223456788887644


No 138
>KOG4173|consensus
Probab=56.66  E-value=2.9  Score=29.03  Aligned_cols=70  Identities=17%  Similarity=0.254  Sum_probs=44.8

Q ss_pred             ccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhC----------CCCceeCC--CCccc
Q psy4421          85 CNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHL----------DDKPYKCS--LCNYE  152 (167)
Q Consensus        85 c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~----------~~~~~~C~--~C~~~  152 (167)
                      |... +.....+..|..+       ..+   -.|..|.+.|.+...|..|+.-.+          |.-.|.|-  .|+..
T Consensus        87 c~~~-~d~lD~~E~hY~~-------~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   87 CCQV-FDALDDYEHHYHT-------LHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             hHHH-HhhhhhHHHhhhh-------ccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            4444 5555555555443       222   268888888888888887765332          44458884  48888


Q ss_pred             ccCchhHHHHhhh
Q psy4421         153 CRQNVHLKSHMKS  165 (167)
Q Consensus       153 f~~~~~l~~H~~~  165 (167)
                      |.+.-+-..|+..
T Consensus       156 FkT~r~RkdH~I~  168 (253)
T KOG4173|consen  156 FKTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhhHHHH
Confidence            8887777777643


No 139
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=56.39  E-value=8.2  Score=20.72  Aligned_cols=30  Identities=23%  Similarity=0.461  Sum_probs=14.9

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      |+|+.|+..+......       .|+ ...|+.||..|
T Consensus         3 ~~CP~CG~~iev~~~~-------~Ge-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LGE-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cCC-EEeCCCCCCEE
Confidence            4666666654433221       122 34666666544


No 140
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=56.21  E-value=8.3  Score=21.46  Aligned_cols=27  Identities=15%  Similarity=0.310  Sum_probs=11.0

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      -.|..|++.|...            .+.+.|..||..|=
T Consensus        10 ~~C~~C~~~F~~~------------~rrhhCr~CG~~vC   36 (69)
T PF01363_consen   10 SNCMICGKKFSLF------------RRRHHCRNCGRVVC   36 (69)
T ss_dssp             SB-TTT--B-BSS------------S-EEE-TTT--EEE
T ss_pred             CcCcCcCCcCCCc------------eeeEccCCCCCEEC
Confidence            3577788777431            34566777776653


No 141
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=56.16  E-value=6.9  Score=19.38  Aligned_cols=12  Identities=25%  Similarity=0.578  Sum_probs=9.3

Q ss_pred             ceeCCCCccccc
Q psy4421         143 PYKCSLCNYECR  154 (167)
Q Consensus       143 ~~~C~~C~~~f~  154 (167)
                      |+.|..|++.|=
T Consensus        12 ~f~C~~C~~~FC   23 (39)
T smart00154       12 GFKCRHCGNLFC   23 (39)
T ss_pred             CeECCccCCccc
Confidence            788888887774


No 142
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=55.70  E-value=8.5  Score=29.96  Aligned_cols=28  Identities=21%  Similarity=0.554  Sum_probs=15.9

Q ss_pred             cCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         117 VCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       117 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      .|+.||....+           .|.+-|.|+.||.+++.
T Consensus       352 ~Cp~Cg~~m~S-----------~G~~g~rC~kCg~~~~~  379 (421)
T COG1571         352 VCPRCGGRMKS-----------AGRNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCccCCchhh-----------cCCCCcccccccccCCc
Confidence            56666654333           23336777777766654


No 143
>KOG2785|consensus
Probab=55.32  E-value=19  Score=27.65  Aligned_cols=55  Identities=20%  Similarity=0.445  Sum_probs=38.1

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCC----------------CCcccCCCCC---ccccCchhHHHHHhh
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAF----------------HFKFVCYACE---YNTYMSGNIKTHLRL  137 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~----------------~~~~~C~~C~---~~~~~~~~l~~H~~~  137 (167)
                      |..|+.. +.+...-..||..-+...++...                ...+.|..|+   +.|.+....+.||..
T Consensus       169 CLfC~~~-~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  169 CLFCDKK-SKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             eeecCCC-cccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            7888888 77777777777763322222111                1237888898   899999999999884


No 144
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.03  E-value=4.7  Score=26.15  Aligned_cols=12  Identities=17%  Similarity=0.205  Sum_probs=6.1

Q ss_pred             eecCccCccccC
Q psy4421          44 YGCYRCSYFTYE   55 (167)
Q Consensus        44 ~~C~~C~~~~~~   55 (167)
                      +.|..||..|..
T Consensus        71 ~~C~~CG~~~~~   82 (135)
T PRK03824         71 LKCRNCGNEWSL   82 (135)
T ss_pred             EECCCCCCEEec
Confidence            455555554443


No 145
>PRK04023 DNA polymerase II large subunit; Validated
Probab=54.91  E-value=16  Score=31.86  Aligned_cols=8  Identities=25%  Similarity=0.754  Sum_probs=4.7

Q ss_pred             eeCCCCcc
Q psy4421         144 YKCSLCNY  151 (167)
Q Consensus       144 ~~C~~C~~  151 (167)
                      +.|+.||.
T Consensus       664 y~CPKCG~  671 (1121)
T PRK04023        664 DECEKCGR  671 (1121)
T ss_pred             CcCCCCCC
Confidence            45666664


No 146
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=54.21  E-value=8.3  Score=20.52  Aligned_cols=29  Identities=24%  Similarity=0.400  Sum_probs=18.5

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCCCceeCCCC
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLC  149 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C  149 (167)
                      ..++|+.|+..|...-..+.       .....|+.|
T Consensus        27 v~W~C~~Cgh~w~~~v~~R~-------~~~~~CP~C   55 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASVNDRT-------RRGKGCPYC   55 (55)
T ss_pred             EEEECCCCCCeeEccHhhhc-------cCCCCCCCC
Confidence            35899999888877654433       233456665


No 147
>KOG2807|consensus
Probab=53.33  E-value=37  Score=25.62  Aligned_cols=13  Identities=8%  Similarity=0.414  Sum_probs=7.6

Q ss_pred             cccccccccCchH
Q psy4421           9 QCVHCHLTLTKST   21 (167)
Q Consensus         9 ~C~~C~~~f~~~~   21 (167)
                      .|..=..+|+.++
T Consensus       246 ~~sLvkmGFP~~~  258 (378)
T KOG2807|consen  246 ECSLVKMGFPSRS  258 (378)
T ss_pred             CCceEEecCCCcc
Confidence            4555566676554


No 148
>PHA02998 RNA polymerase subunit; Provisional
Probab=53.00  E-value=4.5  Score=27.45  Aligned_cols=39  Identities=23%  Similarity=0.432  Sum_probs=24.2

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCc---eeCCCCcccccCc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKP---YKCSLCNYECRQN  156 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~---~~C~~C~~~f~~~  156 (167)
                      ...|+.|+..-.....++.  | .++|.+   |.|..||..|..+
T Consensus       143 ~v~CPkCg~~~A~f~qlQT--R-SADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMIQT--R-AADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEEEEee--c-cCCCCceEEEEcCCCCCccCCc
Confidence            4689999865444433322  2 233433   8999999988754


No 149
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=52.85  E-value=6.2  Score=19.91  Aligned_cols=13  Identities=31%  Similarity=0.782  Sum_probs=7.6

Q ss_pred             CceeCCCCccccc
Q psy4421         142 KPYKCSLCNYECR  154 (167)
Q Consensus       142 ~~~~C~~C~~~f~  154 (167)
                      -|+.|..|+..|=
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            4678888888774


No 150
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=51.19  E-value=20  Score=32.10  Aligned_cols=11  Identities=27%  Similarity=0.736  Sum_probs=7.0

Q ss_pred             cccCCCCCccc
Q psy4421         115 KFVCYACEYNT  125 (167)
Q Consensus       115 ~~~C~~C~~~~  125 (167)
                      +|.|+.|+...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            46677777653


No 151
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=51.08  E-value=25  Score=17.52  Aligned_cols=23  Identities=22%  Similarity=0.316  Sum_probs=12.0

Q ss_pred             ccCCCCCccccCc--hhHHHHHhhh
Q psy4421         116 FVCYACEYNTYMS--GNIKTHLRLH  138 (167)
Q Consensus       116 ~~C~~C~~~~~~~--~~l~~H~~~h  138 (167)
                      -.|+.|+..|...  ..-..|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            4677777655443  3334454444


No 152
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=49.80  E-value=8.7  Score=19.21  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=8.4

Q ss_pred             CceeCCCCcccc
Q psy4421         142 KPYKCSLCNYEC  153 (167)
Q Consensus       142 ~~~~C~~C~~~f  153 (167)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356777777766


No 153
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=49.19  E-value=11  Score=24.31  Aligned_cols=21  Identities=19%  Similarity=0.290  Sum_probs=13.3

Q ss_pred             eeCCCCcccccCchhHHHHhhhcC
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      ..|-++|+.|.   +|.+|+.+|+
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~   97 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHY   97 (148)
T ss_pred             EEEeccCcchH---HHHHHHhccc
Confidence            56777777765   3566666653


No 154
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=48.98  E-value=15  Score=20.40  Aligned_cols=13  Identities=23%  Similarity=0.892  Sum_probs=7.4

Q ss_pred             CCceeCCCCcccc
Q psy4421         141 DKPYKCSLCNYEC  153 (167)
Q Consensus       141 ~~~~~C~~C~~~f  153 (167)
                      .+.|.|+.||..+
T Consensus        44 ~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   44 GRVFTCPNCGFEM   56 (69)
T ss_pred             cceEEcCCCCCEE
Confidence            3456666666543


No 155
>KOG4167|consensus
Probab=48.97  E-value=3.7  Score=34.03  Aligned_cols=24  Identities=21%  Similarity=0.376  Sum_probs=21.8

Q ss_pred             ceeCCCCcccccCchhHHHHhhhc
Q psy4421         143 PYKCSLCNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~h  166 (167)
                      -|.|.+|++.|--.-++..|+++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            489999999999999999999887


No 156
>KOG4167|consensus
Probab=48.11  E-value=2.8  Score=34.73  Aligned_cols=26  Identities=15%  Similarity=0.410  Sum_probs=16.9

Q ss_pred             cceecCccCccccChHHHHHHHHHhh
Q psy4421          42 YKYGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      .-|.|..|++.|.-...+..|+++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            34677777777766666666666554


No 157
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=48.11  E-value=12  Score=22.50  Aligned_cols=30  Identities=17%  Similarity=0.421  Sum_probs=16.3

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .|.|+.|++.-..+.          +...+.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vkR~----------a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         36 KYFCPFCGKHAVKRQ----------AVGIWRCKGCKKTVA   65 (90)
T ss_pred             CccCCCCCCCceeee----------eeEEEEcCCCCCEEe
Confidence            467777764422211          124567777777664


No 158
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=47.89  E-value=17  Score=17.99  Aligned_cols=17  Identities=18%  Similarity=0.182  Sum_probs=9.2

Q ss_pred             eeCCCCcccccCchhHH
Q psy4421         144 YKCSLCNYECRQNVHLK  160 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~  160 (167)
                      +.|+.|+-.+-...+|.
T Consensus        20 d~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EECCCCCeEEccHHHHH
Confidence            45666665555555443


No 159
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=47.63  E-value=19  Score=26.82  Aligned_cols=26  Identities=19%  Similarity=0.234  Sum_probs=17.6

Q ss_pred             cceecCccCccccChHHHHHHHHHhh
Q psy4421          42 YKYGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      ..|.|..|...|...-....|...|.
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHhh
Confidence            34778888877777766666665543


No 160
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=46.78  E-value=9  Score=22.97  Aligned_cols=30  Identities=20%  Similarity=0.455  Sum_probs=16.7

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .|.|+.|++.-..+.        .  -.-+.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vkR~--------a--~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRV--------A--TGIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEEEE--------E--TTEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeEEe--------e--eEEeecCCCCCEEe
Confidence            467777776533221        1  23467777777764


No 161
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=46.23  E-value=13  Score=31.21  Aligned_cols=14  Identities=29%  Similarity=0.643  Sum_probs=9.7

Q ss_pred             CCCCceeCCCCccc
Q psy4421         139 LDDKPYKCSLCNYE  152 (167)
Q Consensus       139 ~~~~~~~C~~C~~~  152 (167)
                      ....|..|+.||..
T Consensus       471 ~~~~p~~Cp~Cgs~  484 (730)
T COG1198         471 QEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCC
Confidence            34567888888864


No 162
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=45.19  E-value=17  Score=23.53  Aligned_cols=17  Identities=24%  Similarity=0.393  Sum_probs=10.5

Q ss_pred             ccceecCccCccccChH
Q psy4421          41 KYKYGCYRCSYFTYESN   57 (167)
Q Consensus        41 ~~~~~C~~C~~~~~~~~   57 (167)
                      .+-|+|++|..+...+.
T Consensus        78 ~~lYeCnIC~etS~ee~   94 (140)
T PF05290_consen   78 PKLYECNICKETSAEER   94 (140)
T ss_pred             CCceeccCcccccchhh
Confidence            35577777777654443


No 163
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=44.04  E-value=12  Score=23.56  Aligned_cols=25  Identities=20%  Similarity=0.497  Sum_probs=16.5

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      .+.|..|+..|.....            .+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------LYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCCc------------CccCcCCcC
Confidence            4778888876665421            356888875


No 164
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=43.73  E-value=25  Score=26.28  Aligned_cols=8  Identities=38%  Similarity=0.795  Sum_probs=6.5

Q ss_pred             cccccccc
Q psy4421          81 YCIHCNSY   88 (167)
Q Consensus        81 ~c~~c~~~   88 (167)
                      +|+.||..
T Consensus       186 ~CPvCGs~  193 (305)
T TIGR01562       186 LCPACGSP  193 (305)
T ss_pred             cCCCCCCh
Confidence            59999876


No 165
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=43.68  E-value=23  Score=26.45  Aligned_cols=23  Identities=22%  Similarity=0.492  Sum_probs=13.5

Q ss_pred             CceeCCCCcccccCchhHHHHhh
Q psy4421         142 KPYKCSLCNYECRQNVHLKSHMK  164 (167)
Q Consensus       142 ~~~~C~~C~~~f~~~~~l~~H~~  164 (167)
                      ..|.|+.|...|-...+.-.|..
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~  409 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHET  409 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHH
Confidence            44666666666666555555544


No 166
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=43.58  E-value=12  Score=24.16  Aligned_cols=16  Identities=25%  Similarity=0.605  Sum_probs=12.8

Q ss_pred             CCCceeCCCCcccccC
Q psy4421         140 DDKPYKCSLCNYECRQ  155 (167)
Q Consensus       140 ~~~~~~C~~C~~~f~~  155 (167)
                      |...|.|..|++.|..
T Consensus        50 ~~qRyrC~~C~~tf~~   65 (129)
T COG3677          50 GHQRYKCKSCGSTFTV   65 (129)
T ss_pred             cccccccCCcCcceee
Confidence            3677999999998864


No 167
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=42.93  E-value=13  Score=23.35  Aligned_cols=25  Identities=16%  Similarity=0.483  Sum_probs=16.4

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      .+.|..|+..|....            ..+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------cCccCcCCCC
Confidence            478888886665532            3356888884


No 168
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=42.92  E-value=12  Score=24.72  Aligned_cols=36  Identities=17%  Similarity=0.545  Sum_probs=26.0

Q ss_pred             CCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         113 HFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       113 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      -.+|.|. |+..+...   ++|-.+-.|+ .|.|..|+-..
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gkL  150 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGKL  150 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-eEEeccCCceE
Confidence            3479999 99886654   5565555666 89999998644


No 169
>KOG0320|consensus
Probab=42.40  E-value=3.8  Score=27.83  Aligned_cols=17  Identities=12%  Similarity=0.321  Sum_probs=10.3

Q ss_pred             CCcccccccccccCchH
Q psy4421           5 LNINQCVHCHLTLTKST   21 (167)
Q Consensus         5 ~~~~~C~~C~~~f~~~~   21 (167)
                      +.-|.|+.|...|..+.
T Consensus       129 ~~~~~CPiCl~~~sek~  145 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKV  145 (187)
T ss_pred             ccccCCCceecchhhcc
Confidence            33467777777665544


No 170
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=42.15  E-value=17  Score=22.36  Aligned_cols=8  Identities=38%  Similarity=1.177  Sum_probs=4.9

Q ss_pred             eeCCCCcc
Q psy4421         144 YKCSLCNY  151 (167)
Q Consensus       144 ~~C~~C~~  151 (167)
                      |.|..|+-
T Consensus        32 y~C~~C~A   39 (102)
T PF11672_consen   32 YVCTPCDA   39 (102)
T ss_pred             EECCCCCc
Confidence            66666653


No 171
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=41.92  E-value=14  Score=22.23  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=7.3

Q ss_pred             ceeCCCCccccc
Q psy4421         143 PYKCSLCNYECR  154 (167)
Q Consensus       143 ~~~C~~C~~~f~  154 (167)
                      .+.|..|++.|.
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            456666666664


No 172
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=41.32  E-value=8.4  Score=18.75  Aligned_cols=30  Identities=20%  Similarity=0.548  Sum_probs=16.3

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCC
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLC  149 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C  149 (167)
                      ..|+.|+..-    .+..|=....|...|.|..|
T Consensus         6 v~CP~C~s~~----~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCC----cceeCCCCCCCCEeEecCcC
Confidence            3566665432    12334344556667777776


No 173
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=40.91  E-value=21  Score=18.79  Aligned_cols=14  Identities=14%  Similarity=0.211  Sum_probs=7.0

Q ss_pred             CcccCCCCCccccC
Q psy4421         114 FKFVCYACEYNTYM  127 (167)
Q Consensus       114 ~~~~C~~C~~~~~~  127 (167)
                      +.+.|..||..|-.
T Consensus        17 rk~~Cr~Cg~~~C~   30 (57)
T cd00065          17 RRHHCRNCGRIFCS   30 (57)
T ss_pred             cccccCcCcCCcCh
Confidence            34455555555443


No 174
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=40.64  E-value=1.9  Score=20.86  Aligned_cols=12  Identities=17%  Similarity=0.393  Sum_probs=5.4

Q ss_pred             ceeCCCCccccc
Q psy4421         143 PYKCSLCNYECR  154 (167)
Q Consensus       143 ~~~C~~C~~~f~  154 (167)
                      +..|..||-.++
T Consensus        21 ~isC~~CGPr~~   32 (35)
T PF07503_consen   21 FISCTNCGPRYS   32 (35)
T ss_dssp             T--BTTCC-SCC
T ss_pred             CccCCCCCCCEE
Confidence            456777765543


No 175
>COG1773 Rubredoxin [Energy production and conversion]
Probab=40.15  E-value=15  Score=19.77  Aligned_cols=12  Identities=33%  Similarity=1.065  Sum_probs=8.5

Q ss_pred             ceeCCCCccccc
Q psy4421         143 PYKCSLCNYECR  154 (167)
Q Consensus       143 ~~~C~~C~~~f~  154 (167)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            577777877664


No 176
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.69  E-value=6.7  Score=27.85  Aligned_cols=38  Identities=21%  Similarity=0.473  Sum_probs=23.9

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCC----------Cc-----eeCCCCcc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDD----------KP-----YKCSLCNY  151 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~----------~~-----~~C~~C~~  151 (167)
                      +.+.||+|+..|....-+..-.|+-+|+          .|     ..|+.|..
T Consensus        18 k~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~y   70 (267)
T COG1655          18 KTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYY   70 (267)
T ss_pred             ceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhH
Confidence            4578999988887765444444444442          12     26999986


No 177
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=39.67  E-value=5.6  Score=19.09  Aligned_cols=8  Identities=25%  Similarity=1.082  Sum_probs=4.1

Q ss_pred             eeCCCCcc
Q psy4421         144 YKCSLCNY  151 (167)
Q Consensus       144 ~~C~~C~~  151 (167)
                      +.|+.||.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555554


No 178
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=39.11  E-value=23  Score=21.96  Aligned_cols=14  Identities=21%  Similarity=0.655  Sum_probs=9.2

Q ss_pred             cccCCCCCccccCc
Q psy4421         115 KFVCYACEYNTYMS  128 (167)
Q Consensus       115 ~~~C~~C~~~~~~~  128 (167)
                      .|.|+.|+..|...
T Consensus        19 ~~iCpeC~~EW~~~   32 (109)
T TIGR00686        19 QLICPSCLYEWNEN   32 (109)
T ss_pred             eeECcccccccccc
Confidence            47777777666554


No 180
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.85  E-value=18  Score=19.91  Aligned_cols=40  Identities=18%  Similarity=0.353  Sum_probs=22.2

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCc
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMS  128 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~  128 (167)
                      |++|++.-+.....+..-...       ...-+.|.|+.|.-....+
T Consensus         5 CiiCd~v~~iD~rt~~tKrLr-------N~PIrtymC~eC~~Rva~k   44 (68)
T COG4896           5 CIICDRVDEIDNRTFKTKRLR-------NKPIRTYMCPECEHRVAIK   44 (68)
T ss_pred             EEEecceeeecchhHHHHHhh-------CCCceeEechhhHhhhchh
Confidence            888877644444444433222       2333568888887554443


No 181
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=38.09  E-value=6.6  Score=23.04  Aligned_cols=43  Identities=16%  Similarity=0.247  Sum_probs=17.1

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCc
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQN  156 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  156 (167)
                      ...++.|.|+.|+..-...-.+    ....+.....|..||..|...
T Consensus        17 ~~l~~~F~CPfC~~~~sV~v~i----dkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   17 PKLPKVFDCPFCNHEKSVSVKI----DKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             ---SS----TTT--SS-EEEEE----ETTTTEEEEEESSS--EEEEE
T ss_pred             CCCCceEcCCcCCCCCeEEEEE----EccCCEEEEEecCCCCeEEEc
Confidence            4456789999999332222111    111333457899999988654


No 182
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=37.70  E-value=16  Score=17.74  Aligned_cols=15  Identities=13%  Similarity=0.253  Sum_probs=8.7

Q ss_pred             eCCCCcccccCchhH
Q psy4421         145 KCSLCNYECRQNVHL  159 (167)
Q Consensus       145 ~C~~C~~~f~~~~~l  159 (167)
                      .|..|++.|-+.++-
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            577888888776543


No 183
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.64  E-value=16  Score=23.07  Aligned_cols=25  Identities=20%  Similarity=0.470  Sum_probs=15.9

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCce-eCCCCcc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPY-KCSLCNY  151 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~-~C~~C~~  151 (167)
                      .+.|..|+..|.....            .| .|+.||.
T Consensus        71 ~~~C~~Cg~~~~~~~~------------~~~~CP~Cgs   96 (117)
T PRK00564         71 ELECKDCSHVFKPNAL------------DYGVCEKCHS   96 (117)
T ss_pred             EEEhhhCCCccccCCc------------cCCcCcCCCC
Confidence            4788888866655421            23 4888885


No 184
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=37.42  E-value=26  Score=23.94  Aligned_cols=14  Identities=21%  Similarity=0.605  Sum_probs=6.2

Q ss_pred             cccccccccccCch
Q psy4421           7 INQCVHCHLTLTKS   20 (167)
Q Consensus         7 ~~~C~~C~~~f~~~   20 (167)
                      -|.|+.|...|+..
T Consensus       113 ~y~C~~~~~r~sfd  126 (176)
T COG1675         113 YYVCPNCHVKYSFD  126 (176)
T ss_pred             ceeCCCCCCcccHH
Confidence            34444444444333


No 185
>PRK10220 hypothetical protein; Provisional
Probab=37.09  E-value=29  Score=21.62  Aligned_cols=15  Identities=13%  Similarity=0.397  Sum_probs=10.5

Q ss_pred             cccCCCCCccccCch
Q psy4421         115 KFVCYACEYNTYMSG  129 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~  129 (167)
                      .|.|+.|+..|....
T Consensus        20 ~~vCpeC~hEW~~~~   34 (111)
T PRK10220         20 MYICPECAHEWNDAE   34 (111)
T ss_pred             eEECCcccCcCCccc
Confidence            578888887776543


No 186
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.74  E-value=11  Score=24.79  Aligned_cols=33  Identities=21%  Similarity=0.487  Sum_probs=22.2

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      -.|.|..|+..+....      ++  ....|.|..|+..|.
T Consensus       122 ~~~~C~~C~~~~~r~~------~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHR------RS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeeeec------cc--chhhEECCCCCCEEE
Confidence            3689999997764432      22  234499999997664


No 187
>KOG1280|consensus
Probab=36.61  E-value=48  Score=25.24  Aligned_cols=27  Identities=19%  Similarity=0.573  Sum_probs=22.1

Q ss_pred             cceecCccCccccChHHHHHHHHH-hhC
Q psy4421          42 YKYGCYRCSYFTYESNNLKKHILK-HTG   68 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~l~~H~~~-h~~   68 (167)
                      ..|.|++|+....+...|.-|... |..
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpd  105 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPE  105 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcc
Confidence            359999999999999999999855 554


No 188
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=36.46  E-value=20  Score=21.90  Aligned_cols=37  Identities=22%  Similarity=0.275  Sum_probs=22.4

Q ss_pred             CCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         112 FHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       112 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      ....|.|+.|+.. .....+.      .+..-..|..||..+..
T Consensus        18 lpt~f~CP~Cge~-~v~v~~~------k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         18 LPKIFECPRCGKV-SISVKIK------KNIAIITCGNCGLYTEF   54 (99)
T ss_pred             CCcEeECCCCCCe-EeeeecC------CCcceEECCCCCCccCE
Confidence            3467999999942 2211111      13444789999987754


No 189
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=36.39  E-value=53  Score=23.77  Aligned_cols=14  Identities=29%  Similarity=0.415  Sum_probs=9.1

Q ss_pred             cccCCCCCccccCc
Q psy4421         115 KFVCYACEYNTYMS  128 (167)
Q Consensus       115 ~~~C~~C~~~~~~~  128 (167)
                      -|.|+.|+..|...
T Consensus       155 ef~C~~C~h~F~G~  168 (278)
T PF15135_consen  155 EFHCPKCRHNFRGF  168 (278)
T ss_pred             eeecccccccchhh
Confidence            36777777766644


No 190
>PRK14873 primosome assembly protein PriA; Provisional
Probab=36.31  E-value=18  Score=30.18  Aligned_cols=10  Identities=20%  Similarity=0.949  Sum_probs=6.4

Q ss_pred             ceeCCCCccc
Q psy4421         143 PYKCSLCNYE  152 (167)
Q Consensus       143 ~~~C~~C~~~  152 (167)
                      +..|+.||..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            5667777753


No 191
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.82  E-value=26  Score=27.88  Aligned_cols=21  Identities=24%  Similarity=0.490  Sum_probs=10.9

Q ss_pred             eeCCCCcccccCchhHHHHhh
Q psy4421         144 YKCSLCNYECRQNVHLKSHMK  164 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~  164 (167)
                      ..|+.|++.|....++..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            345555555555555555543


No 192
>KOG3214|consensus
Probab=35.35  E-value=25  Score=21.50  Aligned_cols=43  Identities=14%  Similarity=0.383  Sum_probs=26.5

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCc
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQN  156 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  156 (167)
                      ...+..|.|+.|+-.-.....|    .....-....|.+|+.+|...
T Consensus        18 ~~ldt~FnClfcnHek~v~~~~----Dk~~~iG~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   18 EPLDTQFNCLFCNHEKSVSCTL----DKKHNIGKASCRICEESFQTT   60 (109)
T ss_pred             cchheeeccCccccccceeeee----hhhcCcceeeeeehhhhhccc
Confidence            4456679999998543222222    122234457899999999764


No 193
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=35.30  E-value=22  Score=17.95  Aligned_cols=13  Identities=15%  Similarity=0.414  Sum_probs=8.4

Q ss_pred             eCCCCcccccCch
Q psy4421         145 KCSLCNYECRQNV  157 (167)
Q Consensus       145 ~C~~C~~~f~~~~  157 (167)
                      .|..||+.|++.-
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            5777777776543


No 194
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=35.25  E-value=19  Score=21.56  Aligned_cols=12  Identities=17%  Similarity=0.595  Sum_probs=6.8

Q ss_pred             ceeCCCCccccc
Q psy4421         143 PYKCSLCNYECR  154 (167)
Q Consensus       143 ~~~C~~C~~~f~  154 (167)
                      .+.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PRK03976         54 IWECRKCGAKFA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            356666666553


No 195
>KOG2071|consensus
Probab=34.92  E-value=24  Score=28.71  Aligned_cols=27  Identities=22%  Similarity=0.522  Sum_probs=21.5

Q ss_pred             CCCceeCCCCcccccCchhHHHHhhhc
Q psy4421         140 DDKPYKCSLCNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       140 ~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (167)
                      ...+..|..||.+|........|+-.|
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhh
Confidence            356789999999999888777777554


No 196
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=34.86  E-value=12  Score=23.53  Aligned_cols=15  Identities=13%  Similarity=0.255  Sum_probs=10.6

Q ss_pred             cceecCccCccccCh
Q psy4421          42 YKYGCYRCSYFTYES   56 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~   56 (167)
                      ..+.|..|+..|...
T Consensus        69 ~~~~C~~Cg~~~~~~   83 (114)
T PRK03681         69 AECWCETCQQYVTLL   83 (114)
T ss_pred             cEEEcccCCCeeecC
Confidence            347788888877654


No 197
>KOG1280|consensus
Probab=34.62  E-value=53  Score=25.03  Aligned_cols=38  Identities=21%  Similarity=0.455  Sum_probs=26.2

Q ss_pred             CCcccCCCCCccccCchhHHHHHhhhCCCCc--eeCCCCc
Q psy4421         113 HFKFVCYACEYNTYMSGNIKTHLRLHLDDKP--YKCSLCN  150 (167)
Q Consensus       113 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~--~~C~~C~  150 (167)
                      +..|.|++|+..-.....|..|...-+-+.+  -.|+.|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3468999999888888888999654332332  4566665


No 198
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=33.81  E-value=8.1  Score=32.10  Aligned_cols=58  Identities=19%  Similarity=0.311  Sum_probs=34.7

Q ss_pred             cccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421          82 CIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      |..||-. |+-...|.-....       .+-..---|+.|.+.+....+-+-    |+  +|..|+.||-..
T Consensus       126 CT~CGPR-fTIi~alPYDR~n-------TsM~~F~lC~~C~~EY~dP~nRRf----HA--Qp~aCp~CGP~~  183 (750)
T COG0068         126 CTNCGPR-FTIIEALPYDREN-------TSMADFPLCPFCDKEYKDPLNRRF----HA--QPIACPKCGPHL  183 (750)
T ss_pred             cCCCCcc-eeeeccCCCCccc-------CccccCcCCHHHHHHhcCcccccc----cc--ccccCcccCCCe
Confidence            8888877 6554444333222       111122368888888888766443    43  578899999633


No 199
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=33.44  E-value=25  Score=16.66  Aligned_cols=13  Identities=15%  Similarity=0.340  Sum_probs=8.1

Q ss_pred             CceeCCCCccccc
Q psy4421         142 KPYKCSLCNYECR  154 (167)
Q Consensus       142 ~~~~C~~C~~~f~  154 (167)
                      .-+.|..||..|.
T Consensus        20 ~~~~C~~Cg~~~~   32 (33)
T PF08792_consen   20 DYEVCIFCGSSFP   32 (33)
T ss_pred             CeEEcccCCcEee
Confidence            3466777776654


No 200
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=33.21  E-value=39  Score=18.16  Aligned_cols=15  Identities=20%  Similarity=0.091  Sum_probs=9.6

Q ss_pred             CCCcccCCCCCcccc
Q psy4421         112 FHFKFVCYACEYNTY  126 (167)
Q Consensus       112 ~~~~~~C~~C~~~~~  126 (167)
                      ++....|+.|+..+.
T Consensus        18 ~dDiVvCp~CgapyH   32 (54)
T PF14446_consen   18 GDDIVVCPECGAPYH   32 (54)
T ss_pred             CCCEEECCCCCCccc
Confidence            444567888876643


No 201
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PTZ00448 hypothetical protein; Provisional
Probab=32.57  E-value=28  Score=26.69  Aligned_cols=23  Identities=26%  Similarity=0.479  Sum_probs=18.9

Q ss_pred             ceeCCCCcccccCchhHHHHhhh
Q psy4421         143 PYKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       143 ~~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      .|.|..|+..|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999887888888765


No 203
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=32.32  E-value=32  Score=22.72  Aligned_cols=32  Identities=16%  Similarity=0.270  Sum_probs=20.4

Q ss_pred             cceecCccCccccChHHHHHHHHHhhCCCCCCcccccCcccccccccccC
Q psy4421          42 YKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISS   91 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c~~c~~~~~~   91 (167)
                      ..|.|..||.......         ++..| .        |+.|+...|.
T Consensus       111 G~l~C~~Cg~~~~~~~---------~~~l~-~--------Cp~C~~~~F~  142 (146)
T PF07295_consen  111 GTLVCENCGHEVELTH---------PERLP-P--------CPKCGHTEFT  142 (146)
T ss_pred             ceEecccCCCEEEecC---------CCcCC-C--------CCCCCCCeee
Confidence            4499999998654322         33333 3        9999887443


No 204
>PF12907 zf-met2:  Zinc-binding
Probab=32.30  E-value=23  Score=17.69  Aligned_cols=6  Identities=33%  Similarity=1.309  Sum_probs=2.9

Q ss_pred             cCCCCC
Q psy4421         117 VCYACE  122 (167)
Q Consensus       117 ~C~~C~  122 (167)
                      .|.+|.
T Consensus         3 ~C~iC~    8 (40)
T PF12907_consen    3 ICKICR    8 (40)
T ss_pred             CcHHhh
Confidence            444454


No 205
>KOG2906|consensus
Probab=32.24  E-value=3.5  Score=24.97  Aligned_cols=17  Identities=24%  Similarity=0.618  Sum_probs=13.1

Q ss_pred             cceecCccCccccChHH
Q psy4421          42 YKYGCYRCSYFTYESNN   58 (167)
Q Consensus        42 ~~~~C~~C~~~~~~~~~   58 (167)
                      ..|.|+.|++.|.-...
T Consensus        20 ~rf~C~tCpY~~~I~~e   36 (105)
T KOG2906|consen   20 NRFSCRTCPYVFPISRE   36 (105)
T ss_pred             eeEEcCCCCceeeEeee
Confidence            46899999998876543


No 206
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=31.15  E-value=16  Score=31.14  Aligned_cols=10  Identities=30%  Similarity=0.859  Sum_probs=0.0

Q ss_pred             cccCCCCCcc
Q psy4421         115 KFVCYACEYN  124 (167)
Q Consensus       115 ~~~C~~C~~~  124 (167)
                      .|.|+.|+..
T Consensus       680 ~~~Cp~C~~~  689 (900)
T PF03833_consen  680 VYVCPDCGIE  689 (900)
T ss_dssp             ----------
T ss_pred             ceeccccccc
Confidence            3555555543


No 207
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=30.85  E-value=17  Score=22.66  Aligned_cols=26  Identities=15%  Similarity=0.388  Sum_probs=15.4

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYE  152 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~  152 (167)
                      .+.|..|+..|.....            .+.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDEF------------DFSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHHC------------CHH-SSSSSS
T ss_pred             cEECCCCCCEEecCCC------------CCCCcCCcCC
Confidence            3678888887766432            1448888764


No 208
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=30.35  E-value=25  Score=15.94  Aligned_cols=10  Identities=20%  Similarity=1.075  Sum_probs=3.4

Q ss_pred             CcccCCCCCc
Q psy4421         114 FKFVCYACEY  123 (167)
Q Consensus       114 ~~~~C~~C~~  123 (167)
                      ..|.|.+|..
T Consensus        14 ~~Y~C~~Cdf   23 (30)
T PF07649_consen   14 WFYRCSECDF   23 (30)
T ss_dssp             -EEE-TTT--
T ss_pred             ceEECccCCC
Confidence            3455555544


No 209
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.32  E-value=44  Score=26.93  Aligned_cols=10  Identities=30%  Similarity=0.793  Sum_probs=6.2

Q ss_pred             CceeCCCCcc
Q psy4421         142 KPYKCSLCNY  151 (167)
Q Consensus       142 ~~~~C~~C~~  151 (167)
                      .|..|+.||.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3556777764


No 210
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=30.19  E-value=23  Score=18.71  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=5.8

Q ss_pred             eCCCCcccccC
Q psy4421         145 KCSLCNYECRQ  155 (167)
Q Consensus       145 ~C~~C~~~f~~  155 (167)
                      .|+.|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            89999988875


No 211
>PRK00420 hypothetical protein; Validated
Probab=30.04  E-value=45  Score=20.95  Aligned_cols=13  Identities=15%  Similarity=0.151  Sum_probs=8.3

Q ss_pred             cccCCCCCccccC
Q psy4421         115 KFVCYACEYNTYM  127 (167)
Q Consensus       115 ~~~C~~C~~~~~~  127 (167)
                      ...|+.|+....-
T Consensus        40 ~~~Cp~Cg~~~~v   52 (112)
T PRK00420         40 EVVCPVHGKVYIV   52 (112)
T ss_pred             ceECCCCCCeeee
Confidence            4568888875443


No 212
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=29.89  E-value=34  Score=16.55  Aligned_cols=25  Identities=28%  Similarity=0.546  Sum_probs=13.7

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      ..|++|+..+..           ..+..|.|..||-
T Consensus         9 ~~C~~C~~~~~~-----------~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSRWFY-----------SDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCeEeE-----------ccCCEEEhhhCce
Confidence            347777755222           2245666766663


No 213
>PRK05978 hypothetical protein; Provisional
Probab=29.45  E-value=20  Score=23.74  Aligned_cols=31  Identities=19%  Similarity=0.386  Sum_probs=17.7

Q ss_pred             ccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         116 FVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       116 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      -+|+.|++.-...+-|.         -.-.|+.||..|..
T Consensus        34 grCP~CG~G~LF~g~Lk---------v~~~C~~CG~~~~~   64 (148)
T PRK05978         34 GRCPACGEGKLFRAFLK---------PVDHCAACGEDFTH   64 (148)
T ss_pred             CcCCCCCCCcccccccc---------cCCCccccCCcccc
Confidence            37888876544333222         12358888877754


No 214
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.34  E-value=36  Score=18.79  Aligned_cols=42  Identities=17%  Similarity=0.260  Sum_probs=20.9

Q ss_pred             CCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccC
Q psy4421         110 DAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      ..+..++.|+.-+..+...--+   +.+ ..+.--.|++|+..|+.
T Consensus        19 ~~~~~~l~C~g~~~p~~HPrV~---L~m-g~~gev~CPYC~t~y~l   60 (62)
T COG4391          19 EIGDLPLMCPGPEPPNDHPRVF---LDM-GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             EeCCeeEEcCCCCCCCCCCEEE---EEc-CCCCcEecCccccEEEe
Confidence            3445566666554442222110   111 22344678888888764


No 215
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=28.95  E-value=30  Score=21.07  Aligned_cols=20  Identities=25%  Similarity=0.537  Sum_probs=15.0

Q ss_pred             HhhhCCCCceeCCCCcccccC
Q psy4421         135 LRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       135 ~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      +..+.| +++.|..||.-|.-
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEE
Confidence            445565 78999999988853


No 216
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=28.76  E-value=30  Score=16.86  Aligned_cols=11  Identities=36%  Similarity=0.751  Sum_probs=5.3

Q ss_pred             ceeCCCCcccc
Q psy4421         143 PYKCSLCNYEC  153 (167)
Q Consensus       143 ~~~C~~C~~~f  153 (167)
                      -|+|..||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            47788887644


No 217
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.29  E-value=50  Score=24.41  Aligned_cols=25  Identities=24%  Similarity=0.450  Sum_probs=15.2

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYEC  153 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f  153 (167)
                      .|.|+.|...|-..              |-.|+.||-.|
T Consensus       255 GyvCs~Clsi~C~~--------------p~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQY--------------TPICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCCC--------------CCCCCCCCCCC
Confidence            37777776665532              23677777655


No 218
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=27.02  E-value=33  Score=17.81  Aligned_cols=11  Identities=36%  Similarity=1.210  Sum_probs=7.8

Q ss_pred             eeCCCCccccc
Q psy4421         144 YKCSLCNYECR  154 (167)
Q Consensus       144 ~~C~~C~~~f~  154 (167)
                      |.|..||..+.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            67888886654


No 219
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=26.64  E-value=54  Score=16.70  Aligned_cols=19  Identities=16%  Similarity=0.072  Sum_probs=12.9

Q ss_pred             CCCCCcccCCCCCccccCc
Q psy4421         110 DAFHFKFVCYACEYNTYMS  128 (167)
Q Consensus       110 ~~~~~~~~C~~C~~~~~~~  128 (167)
                      ........|..|+..|...
T Consensus         9 ~~~~~~i~C~~C~~~~H~~   27 (51)
T PF00628_consen    9 DDDGDMIQCDSCNRWYHQE   27 (51)
T ss_dssp             CTTSSEEEBSTTSCEEETT
T ss_pred             CCCCCeEEcCCCChhhCcc
Confidence            4455667888888776654


No 220
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=26.49  E-value=16  Score=22.30  Aligned_cols=38  Identities=26%  Similarity=0.520  Sum_probs=22.4

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCC---ceeCCCCcccccC
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDK---PYKCSLCNYECRQ  155 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~---~~~C~~C~~~f~~  155 (167)
                      ...|+.|+..-.....++  .|. ++|.   -|.|..|+..++.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q--~Rs-adE~~T~fy~C~~C~~~w~~  102 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQ--TRR-ADEPETRFYKCTKCGYVWRE  102 (104)
T ss_pred             cCCCCCCCCCeeEEEEec--cCC-CCCCcEEEEEeCCCCCeeEe
Confidence            368999986554443332  121 3332   2899999977653


No 221
>KOG2636|consensus
Probab=26.32  E-value=51  Score=26.04  Aligned_cols=25  Identities=28%  Similarity=0.639  Sum_probs=11.1

Q ss_pred             hCCCCceeCCCCc-ccccCchhHHHH
Q psy4421         138 HLDDKPYKCSLCN-YECRQNVHLKSH  162 (167)
Q Consensus       138 h~~~~~~~C~~C~-~~f~~~~~l~~H  162 (167)
                      |.-..-|.|.+|| +++.=+-.+.+|
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHH
Confidence            4444455555555 333333344444


No 222
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=26.00  E-value=15  Score=25.51  Aligned_cols=12  Identities=25%  Similarity=0.686  Sum_probs=7.6

Q ss_pred             eeCCCCcccccC
Q psy4421         144 YKCSLCNYECRQ  155 (167)
Q Consensus       144 ~~C~~C~~~f~~  155 (167)
                      +.|..||+++..
T Consensus        44 ~~C~~CgYR~~D   55 (201)
T COG1779          44 GVCERCGYRSTD   55 (201)
T ss_pred             EEccccCCcccc
Confidence            467777766653


No 223
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=25.80  E-value=15  Score=18.13  Aligned_cols=15  Identities=20%  Similarity=0.563  Sum_probs=8.6

Q ss_pred             CCCCceeCCCCcccc
Q psy4421         139 LDDKPYKCSLCNYEC  153 (167)
Q Consensus       139 ~~~~~~~C~~C~~~f  153 (167)
                      .+.+.+.|..|+..-
T Consensus        20 ~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen   20 DGGKTWICNFCGTKN   34 (40)
T ss_dssp             TTTTEEEETTT--EE
T ss_pred             CCCCEEECcCCCCcC
Confidence            345678888887644


No 224
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=25.54  E-value=32  Score=18.12  Aligned_cols=11  Identities=36%  Similarity=1.189  Sum_probs=8.0

Q ss_pred             eeCCCCccccc
Q psy4421         144 YKCSLCNYECR  154 (167)
Q Consensus       144 ~~C~~C~~~f~  154 (167)
                      |+|..||+.+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            67888887665


No 225
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=25.01  E-value=33  Score=18.59  Aligned_cols=7  Identities=43%  Similarity=1.203  Sum_probs=4.2

Q ss_pred             ccccccc
Q psy4421          82 CIHCNSY   88 (167)
Q Consensus        82 c~~c~~~   88 (167)
                      |..|++.
T Consensus         5 C~lCdk~   11 (56)
T PF09963_consen    5 CILCDKK   11 (56)
T ss_pred             EEecCCE
Confidence            5666655


No 226
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=24.79  E-value=24  Score=16.44  Aligned_cols=10  Identities=20%  Similarity=0.700  Sum_probs=6.8

Q ss_pred             eecCccCccc
Q psy4421          44 YGCYRCSYFT   53 (167)
Q Consensus        44 ~~C~~C~~~~   53 (167)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            6777777654


No 227
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=24.58  E-value=63  Score=21.17  Aligned_cols=18  Identities=17%  Similarity=0.429  Sum_probs=11.2

Q ss_pred             CceeCCCCcccccCchhH
Q psy4421         142 KPYKCSLCNYECRQNVHL  159 (167)
Q Consensus       142 ~~~~C~~C~~~f~~~~~l  159 (167)
                      .-+.|+.||+.|=..+-+
T Consensus       123 ~f~~C~~C~kiyW~GsH~  140 (147)
T PF01927_consen  123 EFWRCPGCGKIYWEGSHW  140 (147)
T ss_pred             eEEECCCCCCEecccccH
Confidence            346788888766444443


No 228
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=24.54  E-value=98  Score=16.36  Aligned_cols=31  Identities=16%  Similarity=0.323  Sum_probs=15.7

Q ss_pred             cCCCCCccccCchhHHHHHhhhCCCCceeCCCCcc
Q psy4421         117 VCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY  151 (167)
Q Consensus       117 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~  151 (167)
                      .|..|+.......  .  .++..++....|+.||+
T Consensus        24 ~C~gC~~~l~~~~--~--~~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQE--L--NEIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHH--H--HHHHcCCCeEECcCCCc
Confidence            5666655433321  1  22233355677777775


No 229
>KOG2071|consensus
Probab=24.21  E-value=58  Score=26.65  Aligned_cols=28  Identities=21%  Similarity=0.256  Sum_probs=23.0

Q ss_pred             CccceecCccCccccChHHHHHHHHHhh
Q psy4421          40 FKYKYGCYRCSYFTYESNNLKKHILKHT   67 (167)
Q Consensus        40 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~   67 (167)
                      ...+..|..||..|.......+|+..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4567899999999999988888877664


No 230
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.88  E-value=31  Score=22.01  Aligned_cols=13  Identities=23%  Similarity=0.797  Sum_probs=9.0

Q ss_pred             cccCCCCCccccCc
Q psy4421         115 KFVCYACEYNTYMS  128 (167)
Q Consensus       115 ~~~C~~C~~~~~~~  128 (167)
                      .+.| .|+..|...
T Consensus        70 ~~~C-~Cg~~~~~~   82 (124)
T PRK00762         70 EIEC-ECGYEGVVD   82 (124)
T ss_pred             eEEe-eCcCccccc
Confidence            4788 888776654


No 231
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=23.48  E-value=30  Score=16.61  Aligned_cols=13  Identities=23%  Similarity=0.534  Sum_probs=6.2

Q ss_pred             cccccccccCchH
Q psy4421           9 QCVHCHLTLTKST   21 (167)
Q Consensus         9 ~C~~C~~~f~~~~   21 (167)
                      .|.+|++.|....
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            5788888886644


No 232
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=23.46  E-value=28  Score=22.75  Aligned_cols=34  Identities=18%  Similarity=0.439  Sum_probs=22.2

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      -.|.|..|+..+..      +.+ +..-..|.|..|+-.+.
T Consensus       111 ~~y~C~~C~~~~~~------~rr-~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      111 YPYRCTGCGQRYLR------VRR-SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEEECCCCCCCCce------Ecc-ccCcceEEcCCCCCEEE
Confidence            37899989977642      222 22226699999987664


No 233
>PRK04351 hypothetical protein; Provisional
Probab=23.26  E-value=51  Score=21.83  Aligned_cols=35  Identities=20%  Similarity=0.517  Sum_probs=23.9

Q ss_pred             CcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCc
Q psy4421         114 FKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQN  156 (167)
Q Consensus       114 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  156 (167)
                      -.|.|..|+..+...      ++ + +...|.|..|+-.+...
T Consensus       111 y~Y~C~~Cg~~~~r~------Rr-~-n~~~yrCg~C~g~L~~~  145 (149)
T PRK04351        111 YLYECQSCGQQYLRK------RR-I-NTKRYRCGKCRGKLKLI  145 (149)
T ss_pred             EEEECCCCCCEeeee------ee-c-CCCcEEeCCCCcEeeec
Confidence            369999999765432      22 2 24679999999776544


No 234
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=23.21  E-value=42  Score=17.80  Aligned_cols=17  Identities=12%  Similarity=0.384  Sum_probs=10.6

Q ss_pred             CCCCceeCCCCcccccC
Q psy4421         139 LDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       139 ~~~~~~~C~~C~~~f~~  155 (167)
                      .+...|.|.+|++.|..
T Consensus        31 ~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTTCEEEETTT--EEEH
T ss_pred             CCCCEEEeeCCCCEecc
Confidence            44566889999887754


No 235
>PRK12496 hypothetical protein; Provisional
Probab=22.84  E-value=59  Score=21.87  Aligned_cols=28  Identities=18%  Similarity=0.412  Sum_probs=18.3

Q ss_pred             cccCCCCCccccCchhHHHHHhhhCCCCceeCCCCccccc
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR  154 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  154 (167)
                      .|.|..|++.|....            ..-.|+.||....
T Consensus       127 ~~~C~gC~~~~~~~~------------~~~~C~~CG~~~~  154 (164)
T PRK12496        127 RKVCKGCKKKYPEDY------------PDDVCEICGSPVK  154 (164)
T ss_pred             eEECCCCCccccCCC------------CCCcCCCCCChhh
Confidence            378999998875421            1135999986543


No 236
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.53  E-value=1e+02  Score=14.63  Aligned_cols=11  Identities=18%  Similarity=0.331  Sum_probs=5.5

Q ss_pred             eecCccCcccc
Q psy4421          44 YGCYRCSYFTY   54 (167)
Q Consensus        44 ~~C~~C~~~~~   54 (167)
                      +.|+.|++.+.
T Consensus         5 ~~C~nC~R~v~   15 (33)
T PF08209_consen    5 VECPNCGRPVA   15 (33)
T ss_dssp             EE-TTTSSEEE
T ss_pred             EECCCCcCCcc
Confidence            55666666543


No 237
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=22.44  E-value=68  Score=19.50  Aligned_cols=40  Identities=15%  Similarity=0.188  Sum_probs=16.6

Q ss_pred             cCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccCh
Q psy4421           4 SLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYES   56 (167)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~   56 (167)
                      +.|.-.|..|+.+....             ...+...+--|-|..|.+-|.+.
T Consensus        11 g~ke~~CalCG~tWg~~-------------y~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDY-------------YEEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             -SGGGS-SS---S---S-------------S-B-TT--BSSS--SSSS-TTS-
T ss_pred             ccccccccccCCcHHHH-------------HHhhcCCEEEEEcHHHHHHHHHH
Confidence            56777888888886532             23444444557789999888776


No 238
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=22.37  E-value=69  Score=23.79  Aligned_cols=24  Identities=17%  Similarity=0.283  Sum_probs=14.7

Q ss_pred             CCcccCCCCCccccCchhHHHHHh
Q psy4421         113 HFKFVCYACEYNTYMSGNIKTHLR  136 (167)
Q Consensus       113 ~~~~~C~~C~~~~~~~~~l~~H~~  136 (167)
                      ...|.|+.|-+-|.....|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            345666666666666666666643


No 239
>PLN02294 cytochrome c oxidase subunit Vb
Probab=22.16  E-value=56  Score=22.18  Aligned_cols=20  Identities=20%  Similarity=0.534  Sum_probs=14.8

Q ss_pred             HhhhCCCCceeCCCCcccccC
Q psy4421         135 LRLHLDDKPYKCSLCNYECRQ  155 (167)
Q Consensus       135 ~~~h~~~~~~~C~~C~~~f~~  155 (167)
                      +..+.| +++.|..||..|.-
T Consensus       134 f~L~kG-kp~RCpeCG~~fkL  153 (174)
T PLN02294        134 FWLEKG-KSFECPVCTQYFEL  153 (174)
T ss_pred             EEecCC-CceeCCCCCCEEEE
Confidence            344554 68999999998864


No 240
>COG4640 Predicted membrane protein [Function unknown]
Probab=22.16  E-value=65  Score=25.12  Aligned_cols=18  Identities=11%  Similarity=0.182  Sum_probs=13.4

Q ss_pred             cccCCCCCccccCchhHH
Q psy4421         115 KFVCYACEYNTYMSGNIK  132 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~  132 (167)
                      .+.|++||..|..+..+-
T Consensus        15 ~~qC~qCG~~~t~~~sqa   32 (465)
T COG4640          15 DVQCTQCGHKFTSRQSQA   32 (465)
T ss_pred             cccccccCCcCCchhhhh
Confidence            345999999888876543


No 241
>KOG2636|consensus
Probab=22.04  E-value=61  Score=25.65  Aligned_cols=28  Identities=18%  Similarity=0.484  Sum_probs=20.9

Q ss_pred             CCCCccceecCccC-ccccChHHHHHHHH
Q psy4421          37 PDSFKYKYGCYRCS-YFTYESNNLKKHIL   64 (167)
Q Consensus        37 ~~~~~~~~~C~~C~-~~~~~~~~l~~H~~   64 (167)
                      .|.-...|.|.+|| +++.....+.+|-.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhH
Confidence            34444559999999 67778888888864


No 242
>PLN02748 tRNA dimethylallyltransferase
Probab=22.02  E-value=59  Score=25.99  Aligned_cols=24  Identities=21%  Similarity=0.454  Sum_probs=20.2

Q ss_pred             CceeCCCCcc-cccCchhHHHHhhh
Q psy4421         142 KPYKCSLCNY-ECRQNVHLKSHMKS  165 (167)
Q Consensus       142 ~~~~C~~C~~-~f~~~~~l~~H~~~  165 (167)
                      +.|.|..|++ .+.-..++..|+++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5688999997 78888899999864


No 243
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=21.63  E-value=31  Score=26.29  Aligned_cols=16  Identities=25%  Similarity=0.538  Sum_probs=6.7

Q ss_pred             ccccccccccCchHHH
Q psy4421           8 NQCVHCHLTLTKSTEV   23 (167)
Q Consensus         8 ~~C~~C~~~f~~~~~l   23 (167)
                      +.|..|..+....+..
T Consensus       253 v~C~~C~yt~~~~~~~  268 (344)
T PF09332_consen  253 VTCKQCKYTAFKPSDR  268 (344)
T ss_dssp             EEETTT--EESS--HH
T ss_pred             EEcCCCCCcccCcchh
Confidence            5566666665554443


No 244
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=21.47  E-value=46  Score=20.58  Aligned_cols=20  Identities=20%  Similarity=0.200  Sum_probs=9.7

Q ss_pred             eeCCCCcccccCchhHHHHh
Q psy4421         144 YKCSLCNYECRQNVHLKSHM  163 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~  163 (167)
                      +-|..|.+-|.+.-.|..|.
T Consensus        56 hYCieCaryf~t~~aL~~Hk   75 (126)
T COG5112          56 HYCIECARYFITEKALMEHK   75 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHh
Confidence            44444555555444444444


No 245
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=21.23  E-value=19  Score=30.13  Aligned_cols=41  Identities=17%  Similarity=0.112  Sum_probs=20.2

Q ss_pred             ccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHH
Q psy4421          10 CVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNN   58 (167)
Q Consensus        10 C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~   58 (167)
                      |..||..|.-..+|-        --...-+...--.|+.|.+-+....+
T Consensus       126 CT~CGPRfTIi~alP--------YDR~nTsM~~F~lC~~C~~EY~dP~n  166 (750)
T COG0068         126 CTNCGPRFTIIEALP--------YDRENTSMADFPLCPFCDKEYKDPLN  166 (750)
T ss_pred             cCCCCcceeeeccCC--------CCcccCccccCcCCHHHHHHhcCccc
Confidence            666776666555443        22221122221237777766655554


No 246
>KOG2857|consensus
Probab=21.17  E-value=52  Score=21.56  Aligned_cols=22  Identities=23%  Similarity=0.339  Sum_probs=19.9

Q ss_pred             cccCCCCCccccCchhHHHHHh
Q psy4421         115 KFVCYACEYNTYMSGNIKTHLR  136 (167)
Q Consensus       115 ~~~C~~C~~~~~~~~~l~~H~~  136 (167)
                      .|+|+.|...+-+..-++.|+.
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            5899999999999999999876


No 247
>KOG0717|consensus
Probab=20.93  E-value=60  Score=25.84  Aligned_cols=21  Identities=24%  Similarity=0.284  Sum_probs=18.1

Q ss_pred             eecCccCccccChHHHHHHHH
Q psy4421          44 YGCYRCSYFTYESNNLKKHIL   64 (167)
Q Consensus        44 ~~C~~C~~~~~~~~~l~~H~~   64 (167)
                      +-|..|+++|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            669999999999998888864


No 248
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=20.83  E-value=53  Score=17.64  Aligned_cols=17  Identities=29%  Similarity=0.636  Sum_probs=12.2

Q ss_pred             cccccccccCChHHHHHH
Q psy4421          82 CIHCNSYISSDIKDLIEH   99 (167)
Q Consensus        82 c~~c~~~~~~~~~~l~~h   99 (167)
                      |..|+.. +.+...|..+
T Consensus        30 C~~Cg~~-Y~d~~dL~~~   46 (55)
T PF13821_consen   30 CFWCGTK-YDDEEDLERN   46 (55)
T ss_pred             eeeeCCc-cCCHHHHHhC
Confidence            8888877 7777666654


No 249
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.80  E-value=32  Score=17.90  Aligned_cols=14  Identities=14%  Similarity=0.406  Sum_probs=9.0

Q ss_pred             eCCCCcccccCchh
Q psy4421         145 KCSLCNYECRQNVH  158 (167)
Q Consensus       145 ~C~~C~~~f~~~~~  158 (167)
                      .|+.|++-|++.-.
T Consensus        14 ICpvCqRPFsWRkK   27 (54)
T COG4338          14 ICPVCQRPFSWRKK   27 (54)
T ss_pred             hhhhhcCchHHHHH
Confidence            57777777766543


No 250
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=20.72  E-value=45  Score=16.14  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=7.3

Q ss_pred             eeCCCCcccccC
Q psy4421         144 YKCSLCNYECRQ  155 (167)
Q Consensus       144 ~~C~~C~~~f~~  155 (167)
                      ..|+.||..|.-
T Consensus         2 r~C~~Cg~~Yh~   13 (36)
T PF05191_consen    2 RICPKCGRIYHI   13 (36)
T ss_dssp             EEETTTTEEEET
T ss_pred             cCcCCCCCcccc
Confidence            356777766643


No 251
>KOG4377|consensus
Probab=20.62  E-value=95  Score=24.36  Aligned_cols=26  Identities=27%  Similarity=0.542  Sum_probs=20.4

Q ss_pred             eec--CccCccccChHHHHHHHHHhhCC
Q psy4421          44 YGC--YRCSYFTYESNNLKKHILKHTGE   69 (167)
Q Consensus        44 ~~C--~~C~~~~~~~~~l~~H~~~h~~~   69 (167)
                      |.|  ..|.+.+..+..+.+|..+|...
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkkr  299 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKKR  299 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhhc
Confidence            556  57888888889999999887644


No 252
>KOG0717|consensus
Probab=20.40  E-value=55  Score=26.02  Aligned_cols=22  Identities=32%  Similarity=0.625  Sum_probs=17.6

Q ss_pred             eeCCCCcccccCchhHHHHhhh
Q psy4421         144 YKCSLCNYECRQNVHLKSHMKS  165 (167)
Q Consensus       144 ~~C~~C~~~f~~~~~l~~H~~~  165 (167)
                      +.|..|.++|.+.-+|.-|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6788888888888888777653


No 253
>KOG1994|consensus
Probab=20.21  E-value=49  Score=23.57  Aligned_cols=22  Identities=23%  Similarity=0.607  Sum_probs=19.0

Q ss_pred             CCceeCCCCcccccCchhHHHH
Q psy4421         141 DKPYKCSLCNYECRQNVHLKSH  162 (167)
Q Consensus       141 ~~~~~C~~C~~~f~~~~~l~~H  162 (167)
                      ..-|-|-.||..|....+|..|
T Consensus       237 ~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHh
Confidence            3458899999999999999877


No 254
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=20.15  E-value=61  Score=15.15  Aligned_cols=12  Identities=33%  Similarity=0.888  Sum_probs=8.1

Q ss_pred             CceeCCCCcccc
Q psy4421         142 KPYKCSLCNYEC  153 (167)
Q Consensus       142 ~~~~C~~C~~~f  153 (167)
                      +-|+|..||..+
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            357788887654


Done!