Diaphorina citri psyllid: psy4433

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-

FLFFKFRKSSQKVVLLSGLSLSGKTLLFARLVYSKYFESCTSLKENVGNFTYEKKNIKIVDLPGEDRLRNKFFDQYKSSAKGIVYVLDSSTVQKTLRDVAESLYVILADPQVQSSRVNILVCCNKQDQTLAKSSSVVKTLLQKELNLVRRTKSNQLEDTNDVAANQTFLGNPDKDFEFSDLYNQVSFCDTTGLDSASEYDVEQLQDWMVTL

ccccccccccccEEEEEccccccHHHHHHHHHcccccEEEEcccccCEEEEEcccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccEECccccccccccccccccccEEcccccCEEEEEEccccccccccHHHHHHHHHHc

FLF*****SSQKVVLLSGLSLSGKTLLFARLVYSKYFESCTSLKENVGNFTYEKKNIKIVDLPGEDRLRNKFFDQYKSSAKGIVYVLDSSTVQKTLRDVAESLYVILADPQVQSSRVNILVCCNKQDQTLAKSSSVVKTLLQKELNLVRRTKSNQLEDTNDVAANQTFLGNPDKDFEFSDLYNQVSFCDTTGLDSASEYDVEQLQDWMVTL

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal recognition particle receptor subunit beta	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.	confident	Q4FZX7
Signal recognition particle receptor subunit beta	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.	confident	Q54XX1
Signal recognition particle receptor subunit beta	Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.	confident	P36057

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0005881 [CC]	cytoplasmic microtubule	probable	GO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FH5, chain B
Confidence level:very confident
Coverage over the Query: 12-153,166-210
View the alignment between query and template
View the model in PyMOL