Query         psy4437
Match_columns 131
No_of_seqs    202 out of 1226
Neff          9.4 
Searched_HMMs 46136
Date          Fri Aug 16 17:01:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4437.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4437hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9 1.9E-27   4E-32  173.6   1.5  118    2-129   334-458 (468)
  2 KOG4577|consensus               99.9 9.4E-29   2E-33  172.8  -5.3  115    2-130    33-150 (383)
  3 KOG1701|consensus               99.9 1.3E-27 2.7E-32  174.5  -3.4  112    3-131   275-390 (468)
  4 KOG2272|consensus               99.9 1.6E-26 3.4E-31  159.1  -3.7  127    2-130    73-249 (332)
  5 KOG2272|consensus               99.9 2.2E-24 4.8E-29  148.6  -4.3  112    2-130   195-309 (332)
  6 KOG1044|consensus               99.8 1.5E-22 3.3E-27  152.5   1.7  112    2-129   133-246 (670)
  7 KOG1703|consensus               99.8 2.2E-21 4.8E-26  148.3   1.6  114    2-130   363-478 (479)
  8 KOG1703|consensus               99.8 4.5E-21 9.9E-26  146.6   2.0  113    3-131   304-418 (479)
  9 KOG1044|consensus               99.7 2.1E-18 4.5E-23  130.5   3.7  128    3-131    17-188 (670)
 10 KOG1700|consensus               99.6   5E-17 1.1E-21  111.4   1.0  130    1-130     6-163 (200)
 11 PF00412 LIM:  LIM domain;  Int  99.6 6.6E-17 1.4E-21   90.2   1.1   56    5-60      1-58  (58)
 12 PF00412 LIM:  LIM domain;  Int  99.6 3.1E-16 6.8E-21   87.5   1.4   52   79-130     1-54  (58)
 13 smart00132 LIM Zinc-binding do  99.1   1E-10 2.2E-15   59.6   3.1   37    4-40      1-38  (39)
 14 smart00132 LIM Zinc-binding do  99.0 2.7E-10 5.8E-15   58.0   2.6   36   79-114     2-38  (39)
 15 KOG4577|consensus               98.9 2.2E-11 4.8E-16   86.1  -4.1   57   75-131    32-88  (383)
 16 KOG0490|consensus               98.2 1.3E-07 2.7E-12   66.2  -1.8  107    7-128     1-114 (235)
 17 KOG1702|consensus               98.1 2.4E-07 5.1E-12   63.1  -1.8   60    2-61      4-64  (264)
 18 KOG1700|consensus               98.1 7.8E-07 1.7E-11   61.3   0.3   59    2-60    108-167 (200)
 19 KOG1702|consensus               97.6 5.4E-06 1.2E-10   56.6  -1.4   54   77-130     5-59  (264)
 20 PF14446 Prok-RING_1:  Prokaryo  95.5   0.012 2.7E-07   31.8   2.1   40   61-113     5-51  (54)
 21 KOG0490|consensus               93.8   0.013 2.8E-07   40.8  -0.6   50   82-131     2-53  (235)
 22 PF08394 Arc_trans_TRASH:  Arch  92.0   0.098 2.1E-06   26.1   1.2   25    5-29      1-26  (37)
 23 PF13248 zf-ribbon_3:  zinc-rib  89.5    0.27 5.7E-06   22.4   1.4   14    1-14      1-14  (26)
 24 PF14835 zf-RING_6:  zf-RING of  88.8    0.62 1.4E-05   26.2   2.8   45   30-74      8-53  (65)
 25 PF13240 zinc_ribbon_2:  zinc-r  87.1    0.52 1.1E-05   20.8   1.5    9   64-72      2-10  (23)
 26 PF10367 Vps39_2:  Vacuolar sor  86.7    0.59 1.3E-05   28.4   2.1   29   77-105    79-108 (109)
 27 PF09943 DUF2175:  Uncharacteri  86.2    0.23 5.1E-06   30.4   0.1   29   78-106     4-33  (101)
 28 PF10235 Cript:  Microtubule-as  85.8    0.55 1.2E-05   28.2   1.5   44   24-89     39-82  (90)
 29 PF12773 DZR:  Double zinc ribb  85.1     1.4 2.9E-05   23.1   2.8    9   77-85     30-38  (50)
 30 PF13717 zinc_ribbon_4:  zinc-r  84.7     0.3 6.5E-06   24.1   0.0   33    1-38      1-34  (36)
 31 KOG2462|consensus               84.5    0.68 1.5E-05   33.4   1.8   90   27-116   128-256 (279)
 32 TIGR02098 MJ0042_CXXC MJ0042 f  83.8    0.34 7.4E-06   23.9   0.0   34    1-39      1-35  (38)
 33 PF09943 DUF2175:  Uncharacteri  83.2    0.39 8.4E-06   29.5   0.1   30    4-33      4-34  (101)
 34 KOG1813|consensus               83.0    0.89 1.9E-05   33.2   1.9   46   30-75    242-289 (313)
 35 PRK14559 putative protein seri  82.0     2.2 4.7E-05   34.8   3.9   37   51-88     17-53  (645)
 36 PF13719 zinc_ribbon_5:  zinc-r  81.1    0.55 1.2E-05   23.3   0.2   34    1-39      1-35  (37)
 37 PRK14890 putative Zn-ribbon RN  80.0     1.4 3.1E-05   24.2   1.6   13    3-15      8-20  (59)
 38 PF10886 DUF2685:  Protein of u  79.3     1.8 3.9E-05   23.4   1.8   26    3-28      2-27  (54)
 39 COG1645 Uncharacterized Zn-fin  79.1     1.4   3E-05   28.4   1.5   23   31-57     30-52  (131)
 40 COG2191 Formylmethanofuran deh  78.3     1.4   3E-05   30.5   1.5   30   30-59    173-203 (206)
 41 PF11781 RRN7:  RNA polymerase   76.9     1.9 4.2E-05   21.2   1.4   22  105-129    10-31  (36)
 42 PF06677 Auto_anti-p27:  Sjogre  74.4       2 4.4E-05   21.9   1.1   21  106-129    20-40  (41)
 43 PF02069 Metallothio_Pro:  Prok  73.8     2.2 4.8E-05   22.9   1.2   22  106-127    10-32  (52)
 44 PF05502 Dynactin_p62:  Dynacti  73.5     3.9 8.5E-05   32.2   3.1   38   78-116    28-65  (483)
 45 COG2191 Formylmethanofuran deh  69.1     2.5 5.3E-05   29.3   1.0   27  104-130   173-200 (206)
 46 PF10367 Vps39_2:  Vacuolar sor  69.0     4.5 9.7E-05   24.4   2.1   26   31-56     80-107 (109)
 47 PF13834 DUF4193:  Domain of un  68.3     2.5 5.4E-05   25.8   0.8   27  103-129    70-98  (99)
 48 PF00645 zf-PARP:  Poly(ADP-rib  67.6     1.6 3.5E-05   25.4  -0.1    9   97-105    39-47  (82)
 49 PF07754 DUF1610:  Domain of un  65.3     5.7 0.00012   17.7   1.4    8   81-88      3-10  (24)
 50 PRK00420 hypothetical protein;  65.0       5 0.00011   25.2   1.7   10  120-129    37-46  (112)
 51 PF13920 zf-C3HC4_3:  Zinc fing  64.6     2.2 4.8E-05   22.3   0.0   29   31-59      4-33  (50)
 52 KOG0978|consensus               63.7    0.88 1.9E-05   37.1  -2.3   47   30-76    644-693 (698)
 53 PF01258 zf-dskA_traR:  Prokary  63.6    0.69 1.5E-05   22.7  -1.9   25   32-56      6-31  (36)
 54 COG4847 Uncharacterized protei  63.4     2.7 5.8E-05   25.5   0.3   36   77-112     7-43  (103)
 55 cd02249 ZZ Zinc finger, ZZ typ  62.0     4.5 9.7E-05   20.8   0.9    8   50-57     24-31  (46)
 56 PF07649 C1_3:  C1-like domain;  61.4     4.1 8.8E-05   18.9   0.6    9   64-72      3-11  (30)
 57 PF07503 zf-HYPF:  HypF finger;  61.2       3 6.5E-05   20.4   0.2   31    5-40      2-32  (35)
 58 cd00162 RING RING-finger (Real  60.4     5.4 0.00012   19.4   1.1    8    5-12      2-9   (45)
 59 PF03604 DNA_RNApol_7kD:  DNA d  59.7       9 0.00019   18.3   1.7   14   74-87     15-28  (32)
 60 smart00504 Ubox Modified RING   59.1     4.3 9.3E-05   22.0   0.6   29   30-58      2-30  (63)
 61 PF14471 DUF4428:  Domain of un  57.8     2.5 5.5E-05   22.5  -0.5   28   31-59      1-30  (51)
 62 PF04570 DUF581:  Protein of un  57.6     5.3 0.00011   22.0   0.7   22  106-127    19-43  (58)
 63 COG5152 Uncharacterized conser  56.8     1.9   4E-05   29.9  -1.4   44   30-73    197-242 (259)
 64 smart00659 RPOLCX RNA polymera  55.7     7.1 0.00015   20.1   1.0   14   75-88     18-31  (44)
 65 COG4357 Zinc finger domain con  55.0     1.7 3.6E-05   26.4  -1.6   35    7-41     40-74  (105)
 66 PF06827 zf-FPG_IleRS:  Zinc fi  54.4     4.5 9.8E-05   18.7   0.1    9    4-12      3-11  (30)
 67 COG4357 Zinc finger domain con  53.9       2 4.3E-05   26.1  -1.4   22   95-116    54-75  (105)
 68 PF07191 zinc-ribbons_6:  zinc-  52.7     5.3 0.00012   22.8   0.3   37   31-71      3-40  (70)
 69 PF00628 PHD:  PHD-finger;  Int  52.1      14 0.00031   19.0   1.9    6    5-10      2-7   (51)
 70 KOG3476|consensus               51.9    0.68 1.5E-05   27.5  -3.5   14   77-90     80-93  (100)
 71 smart00291 ZnF_ZZ Zinc-binding  51.6     8.5 0.00018   19.6   0.9    9   50-58     28-36  (44)
 72 PF09723 Zn-ribbon_8:  Zinc rib  51.0     7.1 0.00015   19.7   0.6   11   77-87      6-16  (42)
 73 PF06750 DiS_P_DiS:  Bacterial   50.9     5.4 0.00012   24.0   0.1   12   30-41     34-45  (92)
 74 cd02340 ZZ_NBR1_like Zinc fing  50.2      13 0.00028   19.0   1.4   10    4-13      2-11  (43)
 75 PRK00398 rpoP DNA-directed RNA  50.1     6.5 0.00014   20.2   0.3   29    3-40      4-32  (46)
 76 COG2888 Predicted Zn-ribbon RN  49.3      12 0.00026   20.7   1.3   10   62-71     10-19  (61)
 77 COG2075 RPL24A Ribosomal prote  48.7      15 0.00032   20.7   1.6   21  105-125     5-29  (66)
 78 PF01286 XPA_N:  XPA protein N-  46.4      13 0.00028   18.1   1.0   13    4-16      5-17  (34)
 79 PF08271 TF_Zn_Ribbon:  TFIIB z  45.9      20 0.00042   18.1   1.8   13  104-116    20-32  (43)
 80 PHA02610 uvsY.-2 hypothetical   45.7      15 0.00032   19.7   1.2   24   78-101     3-26  (53)
 81 PF00130 C1_1:  Phorbol esters/  45.0      13 0.00028   19.4   1.0    9   63-71     13-21  (53)
 82 smart00834 CxxC_CXXC_SSSS Puta  44.6      11 0.00023   18.5   0.6   12   77-88      6-17  (41)
 83 PF10083 DUF2321:  Uncharacteri  44.4      22 0.00049   23.6   2.2   11    5-15     42-52  (158)
 84 KOG3579|consensus               44.2      11 0.00024   27.7   0.8   29    5-33    271-299 (352)
 85 COG1996 RPC10 DNA-directed RNA  44.1      10 0.00022   20.1   0.5   13   76-88     24-36  (49)
 86 PF04810 zf-Sec23_Sec24:  Sec23  43.4      18 0.00039   18.0   1.4   29   78-111     4-32  (40)
 87 TIGR01206 lysW lysine biosynth  42.1      18  0.0004   19.5   1.3   33    1-40      1-33  (54)
 88 KOG0320|consensus               41.9     4.5 9.8E-05   27.5  -1.3   52   26-90    128-181 (187)
 89 PF10764 Gin:  Inhibitor of sig  41.7      11 0.00023   19.7   0.3   30    4-41      1-30  (46)
 90 PRK14714 DNA polymerase II lar  41.6      40 0.00087   30.0   3.8   37   50-88    668-704 (1337)
 91 PF00096 zf-C2H2:  Zinc finger,  41.4     9.4  0.0002   16.0   0.1   13  104-116     1-13  (23)
 92 PRK00807 50S ribosomal protein  41.2      21 0.00045   19.1   1.5    9   79-87      4-12  (52)
 93 TIGR02605 CxxC_CxxC_SSSS putat  40.0      14 0.00029   19.3   0.6   12   77-88      6-17  (52)
 94 PF08772 NOB1_Zn_bind:  Nin one  39.5      14  0.0003   21.4   0.6   32   60-91      8-39  (73)
 95 PF06906 DUF1272:  Protein of u  39.3      13 0.00028   20.3   0.5   22   50-71     30-51  (57)
 96 cd02336 ZZ_RSC8 Zinc finger, Z  39.2      15 0.00032   19.0   0.6   28   31-58      2-32  (45)
 97 PF01194 RNA_pol_N:  RNA polyme  39.2      18  0.0004   20.0   1.0   12    2-13      4-15  (60)
 98 PF11571 Med27:  Mediator compl  39.0      10 0.00022   22.6   0.0   16   56-71     49-64  (90)
 99 cd02335 ZZ_ADA2 Zinc finger, Z  38.4      28 0.00061   18.1   1.7   19   64-82      3-21  (49)
100 cd00729 rubredoxin_SM Rubredox  38.3      26 0.00055   16.8   1.4    7   78-84     20-26  (34)
101 PF14634 zf-RING_5:  zinc-RING   38.1      13 0.00028   18.7   0.3   29   32-60      2-33  (44)
102 PF05864 Chordopox_RPO7:  Chord  37.6     8.1 0.00018   21.1  -0.5   15   30-44      5-19  (63)
103 PF08746 zf-RING-like:  RING-li  37.3     8.3 0.00018   19.7  -0.5   26    5-30      1-28  (43)
104 PF13639 zf-RING_2:  Ring finge  36.6     6.7 0.00015   19.7  -0.9   27    4-30      2-30  (44)
105 PHA03082 DNA-dependent RNA pol  36.0     8.6 0.00019   21.0  -0.6   15   30-44      5-19  (63)
106 PF14255 Cys_rich_CPXG:  Cystei  35.9      21 0.00046   19.1   0.9   28   79-106     3-30  (52)
107 cd02334 ZZ_dystrophin Zinc fin  35.7      27 0.00058   18.4   1.3    8   51-58     26-33  (49)
108 PF02591 DUF164:  Putative zinc  34.8      18  0.0004   19.3   0.6   25  105-129    24-52  (56)
109 smart00109 C1 Protein kinase C  34.7      33 0.00071   17.1   1.6    8   64-71     14-21  (49)
110 smart00531 TFIIE Transcription  34.2      11 0.00024   24.6  -0.4   34    4-40    101-134 (147)
111 COG0068 HypF Hydrogenase matur  33.8      21 0.00045   29.6   1.0   82    3-113   102-183 (750)
112 cd02341 ZZ_ZZZ3 Zinc finger, Z  33.7      24 0.00052   18.5   0.9    8   51-58     28-35  (48)
113 PLN03208 E3 ubiquitin-protein   33.6      23 0.00051   24.4   1.1   29   29-57     18-46  (193)
114 PRK04016 DNA-directed RNA poly  33.5      17 0.00037   20.3   0.4   11    3-13      5-15  (62)
115 PLN00032 DNA-directed RNA poly  33.3      18 0.00038   20.8   0.4   12    2-13      4-15  (71)
116 PRK14559 putative protein seri  33.1      54  0.0012   27.0   3.2   40   61-116    15-54  (645)
117 PF12674 Zn_ribbon_2:  Putative  32.8      18  0.0004   21.2   0.4   28   31-58      2-35  (81)
118 PF10571 UPF0547:  Uncharacteri  32.3      42 0.00092   15.1   1.5    6   78-83     16-21  (26)
119 PF14803 Nudix_N_2:  Nudix N-te  32.1      24 0.00052   17.1   0.7    8   79-86      3-10  (34)
120 TIGR00155 pqiA_fam integral me  31.5      26 0.00057   27.0   1.2   26   63-88    217-242 (403)
121 PF13894 zf-C2H2_4:  C2H2-type   30.9      19 0.00041   14.7   0.2   13  104-116     1-13  (24)
122 PRK12496 hypothetical protein;  30.5      30 0.00064   23.1   1.2   26   62-87    128-154 (164)
123 PRK14714 DNA polymerase II lar  30.2 1.1E+02  0.0024   27.5   4.6   53   29-89    667-722 (1337)
124 PF15135 UPF0515:  Uncharacteri  29.9      70  0.0015   23.1   3.0   36    2-41    132-167 (278)
125 smart00249 PHD PHD zinc finger  29.8      47   0.001   16.0   1.7    8   97-104    22-29  (47)
126 KOG3497|consensus               29.3      20 0.00043   19.9   0.2   13    2-14      4-16  (69)
127 PF11331 DUF3133:  Protein of u  29.3      21 0.00046   18.6   0.3   10  104-113    32-41  (46)
128 PRK00085 recO DNA repair prote  28.9      31 0.00066   24.2   1.1   28  102-129   148-176 (247)
129 PF01927 Mut7-C:  Mut7-C RNAse   28.8      37 0.00079   22.1   1.4   12   30-41     92-103 (147)
130 PF13912 zf-C2H2_6:  C2H2-type   28.8      20 0.00043   15.6   0.1   13  104-116     2-14  (27)
131 PRK12495 hypothetical protein;  28.4      40 0.00087   23.8   1.5   27   77-114    43-69  (226)
132 cd00029 C1 Protein kinase C co  28.3      34 0.00073   17.2   1.0    6   64-69     14-19  (50)
133 PF05810 NinF:  NinF protein;    28.2      13 0.00028   20.2  -0.7   19   64-82     20-38  (58)
134 cd02338 ZZ_PCMF_like Zinc fing  28.0      28 0.00062   18.1   0.6    8   51-58     26-33  (49)
135 PF07975 C1_4:  TFIIH C1-like d  27.9      23 0.00051   18.9   0.3    6  105-110    23-28  (51)
136 PRK14873 primosome assembly pr  27.5      72  0.0016   26.4   3.1   55   16-70    370-431 (665)
137 COG0266 Nei Formamidopyrimidin  27.3      44 0.00094   24.4   1.6   26   77-103   246-271 (273)
138 KOG3579|consensus               27.2      41 0.00089   24.8   1.5   35   74-108   266-300 (352)
139 PF12171 zf-C2H2_jaz:  Zinc-fin  27.2      35 0.00076   15.0   0.8   13  104-116     2-14  (27)
140 PF00569 ZZ:  Zinc finger, ZZ t  27.1      21 0.00045   18.3  -0.0    8   50-57     29-36  (46)
141 COG1381 RecO Recombinational D  27.1      31 0.00067   24.7   0.9   29  101-129   152-181 (251)
142 PHA02929 N1R/p28-like protein;  27.1      32 0.00068   24.6   0.9   39   77-115   175-228 (238)
143 COG1644 RPB10 DNA-directed RNA  26.8      27  0.0006   19.4   0.4   12    2-13      4-15  (63)
144 PF12874 zf-met:  Zinc-finger o  26.7      23  0.0005   15.1   0.1   13  104-116     1-13  (25)
145 TIGR00143 hypF [NiFe] hydrogen  26.7      28  0.0006   29.0   0.6   81    4-113    70-150 (711)
146 PRK04023 DNA polymerase II lar  26.6      98  0.0021   27.1   3.7   21   50-70    627-647 (1121)
147 PF03854 zf-P11:  P-11 zinc fin  25.5      45 0.00098   17.6   1.1   12   45-56     11-22  (50)
148 COG1592 Rubrerythrin [Energy p  24.7      58  0.0013   22.0   1.8   23   63-85    136-158 (166)
149 TIGR00595 priA primosomal prot  24.4      98  0.0021   24.6   3.3   54   17-70    201-262 (505)
150 PF06221 zf-C2HC5:  Putative zi  24.3      72  0.0016   17.4   1.8   28   61-88     18-47  (57)
151 cd02342 ZZ_UBA_plant Zinc fing  24.1      41 0.00089   17.3   0.8    7   51-57     26-32  (43)
152 PF12855 Ecl1:  Life-span regul  23.9      26 0.00057   17.9   0.0   19  106-127     9-27  (43)
153 PF03107 C1_2:  C1 domain;  Int  23.9      53  0.0012   15.0   1.1   12   30-41      1-12  (30)
154 smart00214 VWC von Willebrand   23.6      50  0.0011   17.7   1.1   14   93-106     8-22  (59)
155 PF03966 Trm112p:  Trm112p-like  23.3      60  0.0013   18.0   1.4   13  117-129    47-59  (68)
156 PRK06266 transcription initiat  22.9      25 0.00054   23.9  -0.3   11   30-40    137-147 (178)
157 PF11077 DUF2616:  Protein of u  22.9      52  0.0011   22.4   1.3   31  101-131   137-168 (173)
158 PF08792 A2L_zn_ribbon:  A2L zi  22.4      88  0.0019   14.9   1.7   11  119-129    17-27  (33)
159 PF10122 Mu-like_Com:  Mu-like   22.3      31 0.00066   18.4   0.1   11   30-40      5-15  (51)
160 cd00472 Ribosomal_L24e_L24 Rib  22.3      60  0.0013   17.5   1.2   10   78-87      5-14  (54)
161 PF09862 DUF2089:  Protein of u  22.2      39 0.00085   21.2   0.5   11   78-88     14-24  (113)
162 PF03884 DUF329:  Domain of unk  22.1      40 0.00087   18.4   0.5   13    1-13      1-13  (57)
163 KOG2932|consensus               22.0      45 0.00097   25.0   0.9   41   31-71     92-133 (389)
164 PF13695 zf-3CxxC:  Zinc-bindin  21.8      58  0.0013   19.6   1.3   12   30-41      6-17  (98)
165 smart00661 RPOL9 RNA polymeras  21.5 1.1E+02  0.0024   15.5   2.2    7    5-11      3-9   (52)
166 KOG2114|consensus               21.2      42  0.0009   28.5   0.6   36    3-39    841-882 (933)
167 PF10080 DUF2318:  Predicted me  21.1      75  0.0016   19.6   1.6   13  117-129    46-58  (102)
168 COG4306 Uncharacterized protei  21.0 1.1E+02  0.0025   19.7   2.4   11    5-15     42-52  (160)
169 PF02085 Cytochrom_CIII:  Class  20.3      19  0.0004   21.7  -1.2    8   94-101    65-72  (102)
170 PRK14891 50S ribosomal protein  20.3      70  0.0015   20.6   1.4   24    3-26      5-31  (131)
171 PF05502 Dynactin_p62:  Dynacti  20.3      62  0.0013   25.7   1.4   36    5-41     29-64  (483)
172 KOG2893|consensus               20.2      31 0.00067   24.8  -0.2   36   78-116    12-47  (341)
173 PHA00626 hypothetical protein   20.1   1E+02  0.0023   16.8   1.8   36    4-44      2-38  (59)
174 PF08274 PhnA_Zn_Ribbon:  PhnA   20.1      43 0.00094   15.7   0.3    6   78-83     21-26  (30)

No 1  
>KOG1701|consensus
Probab=99.93  E-value=1.9e-27  Score=173.62  Aligned_cols=118  Identities=27%  Similarity=0.662  Sum_probs=105.4

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc--CcCCeeecccCcCCCCCCCCCCCccccCCCCcccc
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF--SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISC   79 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f--~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C   79 (131)
                      +.+|..|+++|.|. ++.|+|+.||+.||+|..|.+.|.+..|  ..++++||..||+++|+++|+.|+++|.+.+..  
T Consensus       334 lekC~~Cg~~I~d~-iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~--  410 (468)
T KOG1701|consen  334 LEKCNKCGEPIMDR-ILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGK--  410 (468)
T ss_pred             HHHHhhhhhHHHHH-HHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCC--
Confidence            35799999999988 7899999999999999999999999988  377999999999999999999999999987653  


Q ss_pred             ccCCcccccceeeeecCCcccccCccccccccccccc-----eeccCCeeecCCC
Q psy4437          80 AGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-----CFSREGKLFCRND  129 (131)
Q Consensus        80 ~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-----~~~~~g~~~C~~c  129 (131)
                             .+...|.++++.||.+|++|..|+..|+.+     .|..||.++|+.|
T Consensus       411 -------~etvRvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~C  458 (468)
T KOG1701|consen  411 -------DETVRVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTC  458 (468)
T ss_pred             -------cceEEEEEccccccccceehhhcCccccccCCCCcceeccCceeechh
Confidence                   134456899999999999999999999832     7999999999987


No 2  
>KOG4577|consensus
Probab=99.93  E-value=9.4e-29  Score=172.76  Aligned_cols=115  Identities=37%  Similarity=0.986  Sum_probs=108.2

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCccCcCCeeecccCcCCCCCCCCCCCccccCCCCcccccc
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAG   81 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~   81 (131)
                      .++|++|++.|.++.++.++++.||..|++|+.|..+|.+..|.++|.+||+++|.++|+.+|++|..+|.+..+++   
T Consensus        33 ip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~drCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVR---  109 (383)
T KOG4577|consen   33 IPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLADRCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVR---  109 (383)
T ss_pred             cccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHHHHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHH---
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999877665   


Q ss_pred             CCcccccceeeeecCCcccccCccccccccccccc--ee-ccCCeeecCCCC
Q psy4437          82 CEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK--CF-SREGKLFCRNDF  130 (131)
Q Consensus        82 C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~--~~-~~~g~~~C~~cy  130 (131)
                                 .|.+..||.+||.|..|++.|..+  || +.|+++.|+.+|
T Consensus       110 -----------kAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DY  150 (383)
T KOG4577|consen  110 -----------KAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDY  150 (383)
T ss_pred             -----------HhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhH
Confidence                       899999999999999999999988  65 578999999987


No 3  
>KOG1701|consensus
Probab=99.92  E-value=1.3e-27  Score=174.50  Aligned_cols=112  Identities=26%  Similarity=0.692  Sum_probs=101.6

Q ss_pred             CccccCCccccCce-eEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCCCCCCCCCccccCCCCccccc
Q psy4437           3 ISCAGCEKPILDKF-LLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCA   80 (131)
Q Consensus         3 ~~C~~C~~~I~~~~-~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~   80 (131)
                      .+|.+|+|.|+++. .+.||++.||..||+|..|++.|.++.| .+|+++||+.||+..                +.+|.
T Consensus       275 ~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~t----------------lekC~  338 (468)
T KOG1701|consen  275 GICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDT----------------LEKCN  338 (468)
T ss_pred             hhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHH----------------HHHHh
Confidence            48999999998754 4889999999999999999999999877 899999999999754                47899


Q ss_pred             cCCcccccceeeeecCCcccccCccccccccccccc-eec-cCCeeecCCCCC
Q psy4437          81 GCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-CFS-REGKLFCRNDFF  131 (131)
Q Consensus        81 ~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~-~~g~~~C~~cy~  131 (131)
                      .|+++|+++.+ .|+|+.||+.||+|..|.+.|++. |.. .++++||..||+
T Consensus       339 ~Cg~~I~d~iL-rA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh  390 (468)
T KOG1701|consen  339 KCGEPIMDRIL-RALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFH  390 (468)
T ss_pred             hhhhHHHHHHH-HhcccccCCCceEEEEeccccCCccccccCCCceeeehhhh
Confidence            99999999888 999999999999999999999998 654 689999999985


No 4  
>KOG2272|consensus
Probab=99.91  E-value=1.6e-26  Score=159.14  Aligned_cols=127  Identities=23%  Similarity=0.680  Sum_probs=108.8

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCC--------------------
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSP--------------------   60 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~--------------------   60 (131)
                      ++-|++|++.|.++ +|.+++.+||+.||+|..|++.|++..| ...|..+|..|..+..                    
T Consensus        73 aPcC~kC~EFiiGr-VikamnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~  151 (332)
T KOG2272|consen   73 APCCGKCGEFIIGR-VIKAMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQP  151 (332)
T ss_pred             chhhcccccchhhH-HHHhhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhccccc
Confidence            46799999999988 7899999999999999999999999877 5678888888876522                    


Q ss_pred             -----------CCCCCCCccccCCC-----------------CccccccCCcccccceeeeecCCcccccCccccccccc
Q psy4437          61 -----------VRFPSGCGVGLSSS-----------------MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHT  112 (131)
Q Consensus        61 -----------~~~C~~c~~~i~~~-----------------~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~  112 (131)
                                 ..+|..|++.+.+.                 ..++|..|.+||.++.+ .++|++||.++|+|+.|.+|
T Consensus       152 l~fr~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIeervi-~amgKhWHveHFvCa~CekP  230 (332)
T KOG2272|consen  152 LTFRGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIEERVI-FAMGKHWHVEHFVCAKCEKP  230 (332)
T ss_pred             ccccCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchHHHHH-HHhccccchhheeehhcCCc
Confidence                       24677777666542                 34899999999998777 99999999999999999999


Q ss_pred             cccc-eeccCCeeecCCCC
Q psy4437         113 LSDK-CFSREGKLFCRNDF  130 (131)
Q Consensus       113 l~~~-~~~~~g~~~C~~cy  130 (131)
                      +-+. .|++.|.+||+.+|
T Consensus       231 FlGHrHYEkkGlaYCe~h~  249 (332)
T KOG2272|consen  231 FLGHRHYEKKGLAYCETHY  249 (332)
T ss_pred             ccchhhhhhcCchhHHHHH
Confidence            9887 89999999999987


No 5  
>KOG2272|consensus
Probab=99.86  E-value=2.2e-24  Score=148.55  Aligned_cols=112  Identities=18%  Similarity=0.619  Sum_probs=98.2

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCC-CccCcCCeeecccCcCCCCCCCCCCCccccCCCCccccc
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSD-KCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCA   80 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~-~~f~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~   80 (131)
                      .++|+.|.++|.++ +|.++|+.||.+.|+|+.|.+|+-+ +.|++.|.+||+.+|.++++..|..|...|.+       
T Consensus       195 ipiCgaC~rpIeer-vi~amgKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G-------  266 (332)
T KOG2272|consen  195 IPICGACRRPIEER-VIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGG-------  266 (332)
T ss_pred             CcccccccCchHHH-HHHHhccccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCc-------
Confidence            47899999999766 6889999999999999999999887 56799999999999999999766666655543       


Q ss_pred             cCCcccccceeeeecCCcccccCccccccccccccc--eeccCCeeecCCCC
Q psy4437          81 GCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK--CFSREGKLFCRNDF  130 (131)
Q Consensus        81 ~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~--~~~~~g~~~C~~cy  130 (131)
                              ..+ ++.++.|-++||+|+.|++.|...  |++.|.+|.|+.||
T Consensus       267 --------~vv-~al~KawCv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~CKkCy  309 (332)
T KOG2272|consen  267 --------DVV-SALNKAWCVECFSCSTCDKKLTQKNKFYEFDMKPVCKKCY  309 (332)
T ss_pred             --------cHH-HHhhhhhccccccccccccccccccceeeeccchHHHHHH
Confidence                    333 999999999999999999999877  99999999999887


No 6  
>KOG1044|consensus
Probab=99.85  E-value=1.5e-22  Score=152.54  Aligned_cols=112  Identities=22%  Similarity=0.581  Sum_probs=96.3

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCccCcCCeeecccCcCCCCCCCCCCCccccCCCCcccccc
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAG   81 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~   81 (131)
                      +..|++|++.|..+.++.|+++.||..||+|..|+..|.+++..+||.|||+.||++.|+.+|..|.+.|.+        
T Consensus       133 ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~gey~skdg~pyce~dy~~~fgvkc~~c~~fisg--------  204 (670)
T KOG1044|consen  133 PSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLNGEYMSKDGVPYCEKDYQAKFGVKCEECEKFISG--------  204 (670)
T ss_pred             CccccchhhhhhccceeeeeccceeeeeeehhhhcccccceeeccCCCcchhhhhhhhcCeehHHhhhhhhh--------
Confidence            457999999998888888999999999999999999999999999999999999999999766666665554        


Q ss_pred             CCcccccceeeeecCCcccccCccccccccccccc--eeccCCeeecCCC
Q psy4437          82 CEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK--CFSREGKLFCRND  129 (131)
Q Consensus        82 C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~--~~~~~g~~~C~~c  129 (131)
                             +.+ .|.|++|||.|-+|++|+.+++.+  +|+....++=..|
T Consensus       205 -------kvL-qag~kh~HPtCARCsRCgqmF~eGEEMYlQGs~iWHP~C  246 (670)
T KOG1044|consen  205 -------KVL-QAGDKHFHPTCARCSRCGQMFGEGEEMYLQGSEIWHPDC  246 (670)
T ss_pred             -------hhh-hccCcccCcchhhhhhhccccccchheeeccccccCCcc
Confidence                   333 899999999999999999999987  7777666654443


No 7  
>KOG1703|consensus
Probab=99.82  E-value=2.2e-21  Score=148.27  Aligned_cols=114  Identities=26%  Similarity=0.634  Sum_probs=99.3

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCCCCCCCCCccccCCCCccccc
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCA   80 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~   80 (131)
                      .+.|.+|+++|.++ .|.++++.||++||.|..|.++|.+..| ..++.+||+.||.+++.++|..|..++...+     
T Consensus       363 ~p~C~~C~~~i~~~-~v~a~~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~-----  436 (479)
T KOG1703|consen  363 RPNCKRCLLPILEE-GVCALGRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGS-----  436 (479)
T ss_pred             CccccccCCchHHh-HhhhccCeechhceeeecccCCCCCCcccccCCccchhhhHhhhccccchhccchhHhhh-----
Confidence            57899999999888 5778899999999999999999998766 8999999999999999877666666554322     


Q ss_pred             cCCcccccceeeeecCCcccccCccccccccccccc-eeccCCeeecCCCC
Q psy4437          81 GCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-CFSREGKLFCRNDF  130 (131)
Q Consensus        81 ~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy  130 (131)
                              ..+ .+++..||.+||+|+.|.+.|.++ |+...++|+|.+|+
T Consensus       437 --------~~i-e~~~~~~h~~~F~c~~c~~~l~~~~~~~~~~~p~c~~~~  478 (479)
T KOG1703|consen  437 --------RQI-EADGSPFHGDCFRCANCMKKLTKKTFFETLDKPLCQKHF  478 (479)
T ss_pred             --------hHh-hccCccccccceehhhhhccccCCceeecCCccccccCC
Confidence                    222 899999999999999999999988 99999999999987


No 8  
>KOG1703|consensus
Probab=99.81  E-value=4.5e-21  Score=146.57  Aligned_cols=113  Identities=23%  Similarity=0.558  Sum_probs=100.2

Q ss_pred             CccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCCCCCCCCCccccCCCCcccccc
Q psy4437           3 ISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAG   81 (131)
Q Consensus         3 ~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~   81 (131)
                      +.|..|++.|.+..++.++++.||+.+|.|..|...+....+ ..+|++||..|+.+.+.++|.+|+++|.+..      
T Consensus       304 p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~------  377 (479)
T KOG1703|consen  304 PLCLSCNQKIRSVKVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEG------  377 (479)
T ss_pred             ccccccccCcccceeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhH------
Confidence            679999999988557889999999999999999999988777 8999999999999999987777666665443      


Q ss_pred             CCcccccceeeeecCCcccccCccccccccccccc-eeccCCeeecCCCCC
Q psy4437          82 CEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-CFSREGKLFCRNDFF  131 (131)
Q Consensus        82 C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy~  131 (131)
                               + .+.++.||++||.|+.|+++|..+ |++.+|.+||+.||+
T Consensus       378 ---------v-~a~~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~  418 (479)
T KOG1703|consen  378 ---------V-CALGRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYK  418 (479)
T ss_pred             ---------h-hhccCeechhceeeecccCCCCCCcccccCCccchhhhHh
Confidence                     3 777999999999999999999988 999999999999884


No 9  
>KOG1044|consensus
Probab=99.73  E-value=2.1e-18  Score=130.47  Aligned_cols=128  Identities=25%  Similarity=0.630  Sum_probs=101.5

Q ss_pred             CccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcC-CeeecccCc------------CCCCCCCCCC--
Q psy4437           3 ISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SRE-GKLFCRNDF------------FRSPVRFPSG--   66 (131)
Q Consensus         3 ~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~-~~~~C~~c~------------~~~~~~~C~~--   66 (131)
                      ..|..|.+.-.+. ++.+.++.||..||+|..|+..|....| .++ ..+|+....            -+.+.++|+.  
T Consensus        17 i~c~~c~~kc~ge-vlrv~d~~fhi~cf~c~~cg~~la~~gff~k~~~~~ygt~~c~~~~~gevvsa~gktyh~~cf~cs   95 (670)
T KOG1044|consen   17 IKCDKCRKKCSGE-VLRVNDNHFHINCFQCKKCGRNLAEGGFFTKPENRLYGTDDCRAFVEGEVVSTLGKTYHPKCFSCS   95 (670)
T ss_pred             eehhhhCCccccc-eeEeeccccceeeeeccccCCCcccccceecccceeecccchhhhccceeEecccceeccccceec
Confidence            4688999988666 7899999999999999999999998644 554 456765332            1223344443  


Q ss_pred             -CccccCCC---------------------------CccccccCCcccccceeeeecCCcccccCcccccccccccccee
Q psy4437          67 -CGVGLSSS---------------------------MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF  118 (131)
Q Consensus        67 -c~~~i~~~---------------------------~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~  118 (131)
                       |..+..++                           ....|+.|++.|..++.+.|+++.||..||+|..|+..|.++|+
T Consensus        96 ~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~gey~  175 (670)
T KOG1044|consen   96 TCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLNGEYM  175 (670)
T ss_pred             ccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeeeccceeeeeeehhhhcccccceee
Confidence             33444322                           34689999999999888899999999999999999999999999


Q ss_pred             ccCCeeecCCCCC
Q psy4437         119 SREGKLFCRNDFF  131 (131)
Q Consensus       119 ~~~g~~~C~~cy~  131 (131)
                      .+||.|||++||+
T Consensus       176 skdg~pyce~dy~  188 (670)
T KOG1044|consen  176 SKDGVPYCEKDYQ  188 (670)
T ss_pred             ccCCCcchhhhhh
Confidence            9999999999984


No 10 
>KOG1700|consensus
Probab=99.63  E-value=5e-17  Score=111.45  Aligned_cols=130  Identities=25%  Similarity=0.497  Sum_probs=108.1

Q ss_pred             CCCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCCCCCCCCCccc---cCC---
Q psy4437           1 MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPVRFPSGCGVG---LSS---   73 (131)
Q Consensus         1 ~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~~~C~~c~~~---i~~---   73 (131)
                      |...|.+|++.++-.+.+...|..||+.||+|..|.+.|....+ .+++.+||+.+|...+++.-..-+..   +.+   
T Consensus         6 ~~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (200)
T KOG1700|consen    6 TTDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGK   85 (200)
T ss_pred             ccchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCc
Confidence            34589999999987777778899999999999999999998766 89999999998777766554444432   111   


Q ss_pred             --------------------CCccccccCCcccccceeeeecCCcccccCccccccccccccc-eeccCCeeecCCCC
Q psy4437          74 --------------------SMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-CFSREGKLFCRNDF  130 (131)
Q Consensus        74 --------------------~~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy  130 (131)
                                          +....|..|++.+++.+.+...+..||..||+|+.|+..|+.. +...+|.+||..++
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~  163 (200)
T KOG1700|consen   86 DGKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHF  163 (200)
T ss_pred             ccccccccccccchhHHhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhh
Confidence                                1347899999999998888999999999999999999999998 78889999987765


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.63  E-value=6.6e-17  Score=90.20  Aligned_cols=56  Identities=30%  Similarity=0.869  Sum_probs=49.8

Q ss_pred             cccCCccccCceeE-eecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCC
Q psy4437           5 CAGCEKPILDKFLL-NVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSP   60 (131)
Q Consensus         5 C~~C~~~I~~~~~~-~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~   60 (131)
                      |.+|+++|.+++++ .++|+.||++||+|+.|+++|.+..| ..+|++||++||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            78999999877665 69999999999999999999998766 8999999999987643


No 12 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.59  E-value=3.1e-16  Score=87.45  Aligned_cols=52  Identities=31%  Similarity=0.963  Sum_probs=46.6

Q ss_pred             cccCCcccccceee-eecCCcccccCccccccccccccc-eeccCCeeecCCCC
Q psy4437          79 CAGCEKPILDKFLL-NVLERTWHADCVRCYDCHHTLSDK-CFSREGKLFCRNDF  130 (131)
Q Consensus        79 C~~C~~~I~~~~~~-~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy  130 (131)
                      |.+|+++|.+...+ .++|+.||++||+|+.|+++|.++ +++.+|+|||+.||
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~   54 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCY   54 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHH
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHH
Confidence            67788888876664 699999999999999999999988 89999999999887


No 13 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=99.09  E-value=1e-10  Score=59.58  Aligned_cols=37  Identities=41%  Similarity=1.078  Sum_probs=33.6

Q ss_pred             ccccCCccccCc-eeEeecCCccccCCcccCCCcCcCC
Q psy4437           4 SCAGCEKPILDK-FLLNVLERTWHADCVRCYDCHHTLS   40 (131)
Q Consensus         4 ~C~~C~~~I~~~-~~~~~~~~~~H~~Cf~C~~C~~~l~   40 (131)
                      +|.+|+++|.+. ..+.++++.||++||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            589999999886 6788899999999999999999986


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=99.01  E-value=2.7e-10  Score=57.99  Aligned_cols=36  Identities=42%  Similarity=1.107  Sum_probs=30.9

Q ss_pred             cccCCcccccc-eeeeecCCcccccCccccccccccc
Q psy4437          79 CAGCEKPILDK-FLLNVLERTWHADCVRCYDCHHTLS  114 (131)
Q Consensus        79 C~~C~~~I~~~-~~~~~~~~~~H~~Cf~C~~C~~~l~  114 (131)
                      |..|+++|.+. ..+.+.++.||++||+|..|+++|.
T Consensus         2 C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        2 CAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             ccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            67788888775 5558899999999999999999986


No 15 
>KOG4577|consensus
Probab=98.94  E-value=2.2e-11  Score=86.09  Aligned_cols=57  Identities=54%  Similarity=1.371  Sum_probs=53.8

Q ss_pred             CccccccCCcccccceeeeecCCcccccCccccccccccccceeccCCeeecCCCCC
Q psy4437          75 MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFF  131 (131)
Q Consensus        75 ~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~g~~~C~~cy~  131 (131)
                      +.++|+.|.+.|+++.++.+++++||..|++|+.|+.+|....|.++|.+||+++||
T Consensus        32 eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~drCFsR~~s~yCkedFf   88 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLADRCFSREGSVYCKEDFF   88 (383)
T ss_pred             ccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHHHHhhcCCceeehHHHH
Confidence            457899999999999999999999999999999999999999999999999999986


No 16 
>KOG0490|consensus
Probab=98.20  E-value=1.3e-07  Score=66.23  Aligned_cols=107  Identities=31%  Similarity=0.712  Sum_probs=80.3

Q ss_pred             cCCccccCceeEeecCCccccCCcccCCCcCcCC--CCccCcCCeeecccCcCC--CCCCCCCCCccccCCCCccccccC
Q psy4437           7 GCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS--DKCFSREGKLFCRNDFFR--SPVRFPSGCGVGLSSSMLISCAGC   82 (131)
Q Consensus         7 ~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~--~~~f~~~~~~~C~~c~~~--~~~~~C~~c~~~i~~~~~~~C~~C   82 (131)
                      .|+..|.+...+.+.+..||..|..|..|...|.  ...|.++|..||..++.+  .+..+|.+|...+...+...    
T Consensus         1 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~~le----   76 (235)
T KOG0490|consen    1 GCGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKFSKRCARCKFTISQLDELE----   76 (235)
T ss_pred             CCCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchhhhhccccccCCCCCcCHHHHHH----
Confidence            4778888888788889999999999999999998  677766999999999998  66667777776664433221    


Q ss_pred             CcccccceeeeecCCcccccCccccccccccccc--eecc-CCeeecCC
Q psy4437          83 EKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK--CFSR-EGKLFCRN  128 (131)
Q Consensus        83 ~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~--~~~~-~g~~~C~~  128 (131)
                                .+..+. |..||.|..|...+...  +.+. ..+..+.+
T Consensus        77 ----------r~f~~~-h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak  114 (235)
T KOG0490|consen   77 ----------RAFEKV-HLPCFACRECLALLLTGDEFRVQVWFQNRRAK  114 (235)
T ss_pred             ----------HhhcCC-CcCccchHHHHhhcCCCCeeeeehhhhhhcHh
Confidence                      556666 99999999988877655  4332 33555543


No 17 
>KOG1702|consensus
Probab=98.11  E-value=2.4e-07  Score=63.06  Aligned_cols=60  Identities=22%  Similarity=0.535  Sum_probs=52.9

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCCC
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPV   61 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~   61 (131)
                      ...|..|++.++..+.|.-+++.||..||+|..|+.+|..+.+ .-+.++||..+|.+..+
T Consensus         4 k~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~a   64 (264)
T KOG1702|consen    4 KCNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQVA   64 (264)
T ss_pred             cchhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCccccccee
Confidence            4457889999988777888999999999999999999999888 68999999999987654


No 18 
>KOG1700|consensus
Probab=98.09  E-value=7.8e-07  Score=61.27  Aligned_cols=59  Identities=29%  Similarity=0.584  Sum_probs=51.8

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCcc-CcCCeeecccCcCCCC
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF-SREGKLFCRNDFFRSP   60 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~   60 (131)
                      ...|..|.+.+++.+.+...+..||..||+|+.|+..|+...+ ..++.+||...+...+
T Consensus       108 ~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~  167 (200)
T KOG1700|consen  108 KEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLF  167 (200)
T ss_pred             ccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhheee
Confidence            4679999999998877888999999999999999999999888 7888998887776654


No 19 
>KOG1702|consensus
Probab=97.65  E-value=5.4e-06  Score=56.56  Aligned_cols=54  Identities=24%  Similarity=0.579  Sum_probs=46.4

Q ss_pred             cccccCCcccccceeeeecCCcccccCccccccccccccc-eeccCCeeecCCCC
Q psy4437          77 ISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK-CFSREGKLFCRNDF  130 (131)
Q Consensus        77 ~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy  130 (131)
                      ..+..|++.+++.+.+.-+++.||..||+|..|+.+|.-. +-..+.++||..+|
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hY   59 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHY   59 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCccc
Confidence            3467788888876666889999999999999999999877 66789999999887


No 20 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=95.51  E-value=0.012  Score=31.83  Aligned_cols=40  Identities=23%  Similarity=0.605  Sum_probs=24.7

Q ss_pred             CCCCCCCccccC-CCCccccccCCcccccceeeeecCCcccccCc----cccc--ccccc
Q psy4437          61 VRFPSGCGVGLS-SSMLISCAGCEKPILDKFLLNVLERTWHADCV----RCYD--CHHTL  113 (131)
Q Consensus        61 ~~~C~~c~~~i~-~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf----~C~~--C~~~l  113 (131)
                      +.+|..|++.+. +.+.++|+.|+.             .||++|.    .|..  |+.++
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~Cga-------------pyHR~C~~~~g~C~~~~c~~~~   51 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGA-------------PYHRDCWEKAGGCINYSCGTGF   51 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCC-------------cccHHHHhhCCceEeccCCCCc
Confidence            456777777765 445566666654             4898887    3554  55443


No 21 
>KOG0490|consensus
Probab=93.81  E-value=0.013  Score=40.85  Aligned_cols=50  Identities=46%  Similarity=1.270  Sum_probs=40.7

Q ss_pred             CCcccccceeeeecCCcccccCccccccccccc--cceeccCCeeecCCCCC
Q psy4437          82 CEKPILDKFLLNVLERTWHADCVRCYDCHHTLS--DKCFSREGKLFCRNDFF  131 (131)
Q Consensus        82 C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~--~~~~~~~g~~~C~~cy~  131 (131)
                      |+..|.+...+.+.+..||..|..|..|...+.  ...+..+|..||..+|.
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~   53 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQ   53 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccch
Confidence            566777777778889999999999999999998  44444499999998773


No 22 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=92.03  E-value=0.098  Score=26.08  Aligned_cols=25  Identities=16%  Similarity=0.429  Sum_probs=18.7

Q ss_pred             cccCCccccCcee-EeecCCccccCC
Q psy4437           5 CAGCEKPILDKFL-LNVLERTWHADC   29 (131)
Q Consensus         5 C~~C~~~I~~~~~-~~~~~~~~H~~C   29 (131)
                      |.-|+.+|.+..+ +...++.|+.-|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC   26 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCC   26 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEEC
Confidence            6789999987654 666788887544


No 23 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=89.51  E-value=0.27  Score=22.38  Aligned_cols=14  Identities=29%  Similarity=0.536  Sum_probs=9.7

Q ss_pred             CCCccccCCccccC
Q psy4437           1 MLISCAGCEKPILD   14 (131)
Q Consensus         1 ~~~~C~~C~~~I~~   14 (131)
                      |...|..|+..|.+
T Consensus         1 m~~~Cp~Cg~~~~~   14 (26)
T PF13248_consen    1 MEMFCPNCGAEIDP   14 (26)
T ss_pred             CcCCCcccCCcCCc
Confidence            66778888876643


No 24 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=88.80  E-value=0.62  Score=26.17  Aligned_cols=45  Identities=16%  Similarity=0.208  Sum_probs=19.6

Q ss_pred             cccCCCcCcCCCCcc-CcCCeeecccCcCCCCCCCCCCCccccCCC
Q psy4437          30 VRCYDCHHTLSDKCF-SREGKLFCRNDFFRSPVRFPSGCGVGLSSS   74 (131)
Q Consensus        30 f~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~   74 (131)
                      ++|+.|...|....- ..=+.+||..|-.+.++..|..|..|....
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~q   53 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQ   53 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-S
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHH
Confidence            578888777765322 344677888888776666566666555443


No 25 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=87.06  E-value=0.52  Score=20.81  Aligned_cols=9  Identities=22%  Similarity=0.671  Sum_probs=3.6

Q ss_pred             CCCCccccC
Q psy4437          64 PSGCGVGLS   72 (131)
Q Consensus        64 C~~c~~~i~   72 (131)
                      |..|+..|.
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            333444443


No 26 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=86.75  E-value=0.59  Score=28.42  Aligned_cols=29  Identities=21%  Similarity=0.576  Sum_probs=19.4

Q ss_pred             cccccCCcccccceeeee-cCCcccccCcc
Q psy4437          77 ISCAGCEKPILDKFLLNV-LERTWHADCVR  105 (131)
Q Consensus        77 ~~C~~C~~~I~~~~~~~~-~~~~~H~~Cf~  105 (131)
                      ..|+.|+++|.....+.+ .|..+|..|++
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CCccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            568888888876554344 45667887753


No 27 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=86.23  E-value=0.23  Score=30.42  Aligned_cols=29  Identities=31%  Similarity=0.600  Sum_probs=22.8

Q ss_pred             ccccCCcccccceeeeec-CCcccccCccc
Q psy4437          78 SCAGCEKPILDKFLLNVL-ERTWHADCVRC  106 (131)
Q Consensus        78 ~C~~C~~~I~~~~~~~~~-~~~~H~~Cf~C  106 (131)
                      .|..|+++|..++.+++. +..-|.+||+=
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~   33 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFRE   33 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHH
Confidence            588899999887777764 46779999874


No 28 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=85.79  E-value=0.55  Score=28.24  Aligned_cols=44  Identities=25%  Similarity=0.588  Sum_probs=26.7

Q ss_pred             ccccCCcccCCCcCcCCCCccCcCCeeecccCcCCCCCCCCCCCccccCCCCccccccCCcccccc
Q psy4437          24 TWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILDK   89 (131)
Q Consensus        24 ~~H~~Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~C~~~I~~~   89 (131)
                      .|-+.=-.|..|...+..     .|.-||..|..+.                 -+|+.|++.|.+.
T Consensus        39 Py~~~~~~C~~CK~~v~q-----~g~~YCq~CAYkk-----------------GiCamCGKki~dt   82 (90)
T PF10235_consen   39 PYAPYSSKCKICKTKVHQ-----PGAKYCQTCAYKK-----------------GICAMCGKKILDT   82 (90)
T ss_pred             cccccCcccccccccccc-----CCCccChhhhccc-----------------CcccccCCeeccc
Confidence            344433456667655532     3667888887664                 3577777777653


No 29 
>PF12773 DZR:  Double zinc ribbon
Probab=85.07  E-value=1.4  Score=23.08  Aligned_cols=9  Identities=22%  Similarity=0.671  Sum_probs=4.0

Q ss_pred             cccccCCcc
Q psy4437          77 ISCAGCEKP   85 (131)
Q Consensus        77 ~~C~~C~~~   85 (131)
                      ..|..|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            344444443


No 30 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=84.70  E-value=0.3  Score=24.12  Aligned_cols=33  Identities=33%  Similarity=0.753  Sum_probs=19.6

Q ss_pred             CCCccccCCccc-cCceeEeecCCccccCCcccCCCcCc
Q psy4437           1 MLISCAGCEKPI-LDKFLLNVLERTWHADCVRCYDCHHT   38 (131)
Q Consensus         1 ~~~~C~~C~~~I-~~~~~~~~~~~~~H~~Cf~C~~C~~~   38 (131)
                      |...|..|+... .+.+.|...+..     ++|+.|+..
T Consensus         1 M~i~Cp~C~~~y~i~d~~ip~~g~~-----v~C~~C~~~   34 (36)
T PF13717_consen    1 MIITCPNCQAKYEIDDEKIPPKGRK-----VRCSKCGHV   34 (36)
T ss_pred             CEEECCCCCCEEeCCHHHCCCCCcE-----EECCCCCCE
Confidence            667788888764 233334444443     677777654


No 31 
>KOG2462|consensus
Probab=84.52  E-value=0.68  Score=33.44  Aligned_cols=90  Identities=21%  Similarity=0.404  Sum_probs=50.8

Q ss_pred             cCCcccCCCcCcCCCCc-cCcCCe-------------eecccCcCCCC-----------CCCCCCCccccC---------
Q psy4437          27 ADCVRCYDCHHTLSDKC-FSREGK-------------LFCRNDFFRSP-----------VRFPSGCGVGLS---------   72 (131)
Q Consensus        27 ~~Cf~C~~C~~~l~~~~-f~~~~~-------------~~C~~c~~~~~-----------~~~C~~c~~~i~---------   72 (131)
                      ...++|..|++.++... ..+...             .+|..-|..+-           .-.|..|++.+.         
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhccc
Confidence            34588899998887632 122222             23333332221           136777777653         


Q ss_pred             ----CCCccccccCCcccccceeeeec-CCcccccCccccccccccccc
Q psy4437          73 ----SSMLISCAGCEKPILDKFLLNVL-ERTWHADCVRCYDCHHTLSDK  116 (131)
Q Consensus        73 ----~~~~~~C~~C~~~I~~~~~~~~~-~~~~H~~Cf~C~~C~~~l~~~  116 (131)
                          |+..+.|+.|+|...|+--++|. .-+=+..=|.|..|++.++..
T Consensus       208 RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHH
Confidence                34457888888888776443432 122233457788888877654


No 32 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=83.76  E-value=0.34  Score=23.93  Aligned_cols=34  Identities=29%  Similarity=0.512  Sum_probs=19.4

Q ss_pred             CCCccccCCcccc-CceeEeecCCccccCCcccCCCcCcC
Q psy4437           1 MLISCAGCEKPIL-DKFLLNVLERTWHADCVRCYDCHHTL   39 (131)
Q Consensus         1 ~~~~C~~C~~~I~-~~~~~~~~~~~~H~~Cf~C~~C~~~l   39 (131)
                      |...|..|+..+. +.+.+...+.     -++|..|+..+
T Consensus         1 M~~~CP~C~~~~~v~~~~~~~~~~-----~v~C~~C~~~~   35 (38)
T TIGR02098         1 MRIQCPNCKTSFRVVDSQLGANGG-----KVRCGKCGHVW   35 (38)
T ss_pred             CEEECCCCCCEEEeCHHHcCCCCC-----EEECCCCCCEE
Confidence            6678888888752 2212222221     26778887665


No 33 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=83.19  E-value=0.39  Score=29.46  Aligned_cols=30  Identities=30%  Similarity=0.548  Sum_probs=22.7

Q ss_pred             ccccCCccccCceeEee-cCCccccCCcccC
Q psy4437           4 SCAGCEKPILDKFLLNV-LERTWHADCVRCY   33 (131)
Q Consensus         4 ~C~~C~~~I~~~~~~~~-~~~~~H~~Cf~C~   33 (131)
                      +|..|+++|..++..++ .+..-|-.||+=.
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~   34 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFREK   34 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHHH
Confidence            68899999988777555 3567888888654


No 34 
>KOG1813|consensus
Probab=83.03  E-value=0.89  Score=33.22  Aligned_cols=46  Identities=15%  Similarity=0.327  Sum_probs=36.1

Q ss_pred             cccCCCcCcCCCCccCcCCeeecccCcCCCC--CCCCCCCccccCCCC
Q psy4437          30 VRCYDCHHTLSDKCFSREGKLFCRNDFFRSP--VRFPSGCGVGLSSSM   75 (131)
Q Consensus        30 f~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~--~~~C~~c~~~i~~~~   75 (131)
                      |.|..|++.........-+..+|+.|..+.+  +++|..|++.+.+..
T Consensus       242 f~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~~  289 (313)
T KOG1813|consen  242 FKCFICRKYFYRPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHGSF  289 (313)
T ss_pred             ccccccccccccchhhcCCceeehhhhccccccCCcceeccccccccc
Confidence            7888888887765556678899999998776  468888888887643


No 35 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=81.99  E-value=2.2  Score=34.82  Aligned_cols=37  Identities=16%  Similarity=0.306  Sum_probs=21.6

Q ss_pred             ecccCcCCCCCCCCCCCccccCCCCccccccCCccccc
Q psy4437          51 FCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILD   88 (131)
Q Consensus        51 ~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~C~~~I~~   88 (131)
                      ||..|-.+.-...|..|+..+.++.. -|..|+.+...
T Consensus        17 FC~~CG~~l~~~~Cp~CG~~~~~~~~-fC~~CG~~~~~   53 (645)
T PRK14559         17 FCQKCGTSLTHKPCPQCGTEVPVDEA-HCPNCGAETGT   53 (645)
T ss_pred             cccccCCCCCCCcCCCCCCCCCcccc-cccccCCcccc
Confidence            44444433333467777777665554 57777776543


No 36 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=81.12  E-value=0.55  Score=23.27  Aligned_cols=34  Identities=32%  Similarity=0.658  Sum_probs=19.3

Q ss_pred             CCCccccCCcccc-CceeEeecCCccccCCcccCCCcCcC
Q psy4437           1 MLISCAGCEKPIL-DKFLLNVLERTWHADCVRCYDCHHTL   39 (131)
Q Consensus         1 ~~~~C~~C~~~I~-~~~~~~~~~~~~H~~Cf~C~~C~~~l   39 (131)
                      |..+|..|+.... +.+.+...+..     .+|+.|+..+
T Consensus         1 M~i~CP~C~~~f~v~~~~l~~~~~~-----vrC~~C~~~f   35 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPDDKLPAGGRK-----VRCPKCGHVF   35 (37)
T ss_pred             CEEECCCCCceEEcCHHHcccCCcE-----EECCCCCcEe
Confidence            6778888887642 22224333332     6677776543


No 37 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=80.01  E-value=1.4  Score=24.24  Aligned_cols=13  Identities=23%  Similarity=0.588  Sum_probs=7.4

Q ss_pred             CccccCCccccCc
Q psy4437           3 ISCAGCEKPILDK   15 (131)
Q Consensus         3 ~~C~~C~~~I~~~   15 (131)
                      +.|..|+..|.+.
T Consensus         8 ~~CtSCg~~i~~~   20 (59)
T PRK14890          8 PKCTSCGIEIAPR   20 (59)
T ss_pred             ccccCCCCcccCC
Confidence            3566666666443


No 38 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=79.28  E-value=1.8  Score=23.37  Aligned_cols=26  Identities=23%  Similarity=0.471  Sum_probs=19.4

Q ss_pred             CccccCCccccCceeEeecCCccccC
Q psy4437           3 ISCAGCEKPILDKFLLNVLERTWHAD   28 (131)
Q Consensus         3 ~~C~~C~~~I~~~~~~~~~~~~~H~~   28 (131)
                      .+|..|+++|.+...+...+..-|+.
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~g   27 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHPG   27 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCcH
Confidence            57889999998776666666677774


No 39 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=79.07  E-value=1.4  Score=28.42  Aligned_cols=23  Identities=30%  Similarity=0.830  Sum_probs=18.6

Q ss_pred             ccCCCcCcCCCCccCcCCeeecccCcC
Q psy4437          31 RCYDCHHTLSDKCFSREGKLFCRNDFF   57 (131)
Q Consensus        31 ~C~~C~~~l~~~~f~~~~~~~C~~c~~   57 (131)
                      .|..|+.+|    |.++|.+||..|-.
T Consensus        30 hCp~Cg~PL----F~KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPL----FRKDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCcc----eeeCCeEECCCCCc
Confidence            477888888    56899999988864


No 40 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=78.34  E-value=1.4  Score=30.48  Aligned_cols=30  Identities=23%  Similarity=0.419  Sum_probs=25.4

Q ss_pred             cccCCCcCcCCCCcc-CcCCeeecccCcCCC
Q psy4437          30 VRCYDCHHTLSDKCF-SREGKLFCRNDFFRS   59 (131)
Q Consensus        30 f~C~~C~~~l~~~~f-~~~~~~~C~~c~~~~   59 (131)
                      -+|+.|+.......- ..+|++.|..|+.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            689999998887655 789999999999754


No 41 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=76.86  E-value=1.9  Score=21.22  Aligned_cols=22  Identities=23%  Similarity=0.552  Sum_probs=13.8

Q ss_pred             cccccccccccceeccCCeeecCCC
Q psy4437         105 RCYDCHHTLSDKCFSREGKLFCRND  129 (131)
Q Consensus       105 ~C~~C~~~l~~~~~~~~g~~~C~~c  129 (131)
                      .|..|+..   .+...||..||..|
T Consensus        10 ~C~~C~~~---~~~~~dG~~yC~~c   31 (36)
T PF11781_consen   10 PCPVCGSR---WFYSDDGFYYCDRC   31 (36)
T ss_pred             cCCCCCCe---EeEccCCEEEhhhC
Confidence            46666543   35667888888544


No 42 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=74.42  E-value=2  Score=21.86  Aligned_cols=21  Identities=33%  Similarity=0.844  Sum_probs=12.4

Q ss_pred             ccccccccccceeccCCeeecCCC
Q psy4437         106 CYDCHHTLSDKCFSREGKLFCRND  129 (131)
Q Consensus       106 C~~C~~~l~~~~~~~~g~~~C~~c  129 (131)
                      |..|+.||-   -.++|+.||..|
T Consensus        20 Cp~C~~PL~---~~k~g~~~Cv~C   40 (41)
T PF06677_consen   20 CPDCGTPLM---RDKDGKIYCVSC   40 (41)
T ss_pred             cCCCCCeeE---EecCCCEECCCC
Confidence            555654442   246777777665


No 43 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=73.78  E-value=2.2  Score=22.93  Aligned_cols=22  Identities=27%  Similarity=0.910  Sum_probs=11.7

Q ss_pred             ccccccccccc-eeccCCeeecC
Q psy4437         106 CYDCHHTLSDK-CFSREGKLFCR  127 (131)
Q Consensus       106 C~~C~~~l~~~-~~~~~g~~~C~  127 (131)
                      |..|...++.. -+.+||+.||.
T Consensus        10 C~~C~C~V~~~~Ai~~dGk~YCS   32 (52)
T PF02069_consen   10 CPSCSCVVSEEEAIQKDGKYYCS   32 (52)
T ss_dssp             STT----B-TTTSEESSS-EESS
T ss_pred             CCCCEeEECchHhHHhCCEeeec
Confidence            56777777755 77888888884


No 44 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=73.55  E-value=3.9  Score=32.16  Aligned_cols=38  Identities=18%  Similarity=0.377  Sum_probs=22.6

Q ss_pred             ccccCCcccccceeeeecCCcccccCccccccccccccc
Q psy4437          78 SCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK  116 (131)
Q Consensus        78 ~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~  116 (131)
                      .|+.|-..+-..++ .+.+..--.+||.|..|..+|+..
T Consensus        28 yCp~CL~~~p~~e~-~~~~nrC~r~Cf~CP~C~~~L~~~   65 (483)
T PF05502_consen   28 YCPNCLFEVPSSEA-RSEKNRCSRNCFDCPICFSPLSVR   65 (483)
T ss_pred             ECccccccCChhhh-eeccceeccccccCCCCCCcceeE
Confidence            45555544443332 344444445888888888888755


No 45 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=69.14  E-value=2.5  Score=29.31  Aligned_cols=27  Identities=26%  Similarity=0.541  Sum_probs=22.0

Q ss_pred             ccccccccccccc-eeccCCeeecCCCC
Q psy4437         104 VRCYDCHHTLSDK-CFSREGKLFCRNDF  130 (131)
Q Consensus       104 f~C~~C~~~l~~~-~~~~~g~~~C~~cy  130 (131)
                      -+|..|+..+... -...+|+++|..||
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~  200 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCA  200 (206)
T ss_pred             eeccccCcccccchhhhcCCceeccccc
Confidence            5788898887766 56678999999987


No 46 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=69.04  E-value=4.5  Score=24.42  Aligned_cols=26  Identities=19%  Similarity=0.410  Sum_probs=15.7

Q ss_pred             ccCCCcCcCCCCcc--CcCCeeecccCc
Q psy4437          31 RCYDCHHTLSDKCF--SREGKLFCRNDF   56 (131)
Q Consensus        31 ~C~~C~~~l~~~~f--~~~~~~~C~~c~   56 (131)
                      .|..|+++|....|  ..+|.++...|.
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEecccc
Confidence            46777777766555  245566655554


No 47 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=68.27  E-value=2.5  Score=25.84  Aligned_cols=27  Identities=19%  Similarity=0.483  Sum_probs=19.2

Q ss_pred             Cccccccccccccc--eeccCCeeecCCC
Q psy4437         103 CVRCYDCHHTLSDK--CFSREGKLFCRND  129 (131)
Q Consensus       103 Cf~C~~C~~~l~~~--~~~~~g~~~C~~c  129 (131)
                      =|+|+.|=..-...  -...+|+++|..|
T Consensus        70 EFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   70 EFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             ceeeeeeeeEechhhhccccCCCEecccc
Confidence            48888885544333  3467899999987


No 48 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=67.59  E-value=1.6  Score=25.39  Aligned_cols=9  Identities=33%  Similarity=0.697  Sum_probs=6.6

Q ss_pred             CcccccCcc
Q psy4437          97 RTWHADCVR  105 (131)
Q Consensus        97 ~~~H~~Cf~  105 (131)
                      .-||.+||.
T Consensus        39 ~W~H~~C~~   47 (82)
T PF00645_consen   39 KWYHWDCFF   47 (82)
T ss_dssp             EEEEHHHHH
T ss_pred             ceECccccc
Confidence            456888887


No 49 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=65.31  E-value=5.7  Score=17.75  Aligned_cols=8  Identities=38%  Similarity=0.978  Sum_probs=3.2

Q ss_pred             cCCccccc
Q psy4437          81 GCEKPILD   88 (131)
Q Consensus        81 ~C~~~I~~   88 (131)
                      +|+.+|.+
T Consensus         3 sC~~~i~~   10 (24)
T PF07754_consen    3 SCGRPIAP   10 (24)
T ss_pred             cCCCcccC
Confidence            34444433


No 50 
>PRK00420 hypothetical protein; Validated
Probab=65.05  E-value=5  Score=25.18  Aligned_cols=10  Identities=20%  Similarity=0.797  Sum_probs=4.5

Q ss_pred             cCCeeecCCC
Q psy4437         120 REGKLFCRND  129 (131)
Q Consensus       120 ~~g~~~C~~c  129 (131)
                      ++|+.||..|
T Consensus        37 k~g~~~Cp~C   46 (112)
T PRK00420         37 KDGEVVCPVH   46 (112)
T ss_pred             CCCceECCCC
Confidence            4444444443


No 51 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=64.57  E-value=2.2  Score=22.26  Aligned_cols=29  Identities=28%  Similarity=0.438  Sum_probs=16.8

Q ss_pred             ccCCCcCcCCCCccCcCCee-ecccCcCCC
Q psy4437          31 RCYDCHHTLSDKCFSREGKL-FCRNDFFRS   59 (131)
Q Consensus        31 ~C~~C~~~l~~~~f~~~~~~-~C~~c~~~~   59 (131)
                      .|..|.....+..+..=|.. +|..|..+.
T Consensus         4 ~C~iC~~~~~~~~~~pCgH~~~C~~C~~~~   33 (50)
T PF13920_consen    4 ECPICFENPRDVVLLPCGHLCFCEECAERL   33 (50)
T ss_dssp             B-TTTSSSBSSEEEETTCEEEEEHHHHHHH
T ss_pred             CCccCCccCCceEEeCCCChHHHHHHhHHh
Confidence            45666665554434444666 888887654


No 52 
>KOG0978|consensus
Probab=63.74  E-value=0.88  Score=37.12  Aligned_cols=47  Identities=17%  Similarity=0.429  Sum_probs=31.8

Q ss_pred             cccCCCcCcCCCCccCcCCeeecccCcCCCCC---CCCCCCccccCCCCc
Q psy4437          30 VRCYDCHHTLSDKCFSREGKLFCRNDFFRSPV---RFPSGCGVGLSSSML   76 (131)
Q Consensus        30 f~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~~---~~C~~c~~~i~~~~~   76 (131)
                      ++|+.|+....+....+=+..||..|-..++.   .+|..|+.++.+++.
T Consensus       644 LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  644 LKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDV  693 (698)
T ss_pred             eeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCcccc
Confidence            68888886665544456678889998877664   366666666655543


No 53 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=63.63  E-value=0.69  Score=22.66  Aligned_cols=25  Identities=20%  Similarity=0.549  Sum_probs=11.5

Q ss_pred             cCCCcCcCCCCcc-CcCCeeecccCc
Q psy4437          32 CYDCHHTLSDKCF-SREGKLFCRNDF   56 (131)
Q Consensus        32 C~~C~~~l~~~~f-~~~~~~~C~~c~   56 (131)
                      |..|+.++..... ...+..+|..|.
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~   31 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQ   31 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHh
Confidence            5555555554433 345555555443


No 54 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=63.41  E-value=2.7  Score=25.46  Aligned_cols=36  Identities=14%  Similarity=0.298  Sum_probs=25.4

Q ss_pred             cccccCCcccccceeeeec-CCcccccCccccccccc
Q psy4437          77 ISCAGCEKPILDKFLLNVL-ERTWHADCVRCYDCHHT  112 (131)
Q Consensus        77 ~~C~~C~~~I~~~~~~~~~-~~~~H~~Cf~C~~C~~~  112 (131)
                      ..|..|+.+|..++.+++- ..+-|-+||.=+.=+++
T Consensus         7 wkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~~~k~   43 (103)
T COG4847           7 WKCYVCGGTIIEGQKFTFTKKGSVHYECLAESKRKKP   43 (103)
T ss_pred             eeEeeeCCEeeeccEEEEeeCCcchHHHHHHHHhcCc
Confidence            4688999988877665653 56789999875544443


No 55 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=62.00  E-value=4.5  Score=20.84  Aligned_cols=8  Identities=13%  Similarity=0.409  Sum_probs=4.1

Q ss_pred             eecccCcC
Q psy4437          50 LFCRNDFF   57 (131)
Q Consensus        50 ~~C~~c~~   57 (131)
                      -+|.+||.
T Consensus        24 dLC~~Cf~   31 (46)
T cd02249          24 DLCSSCYA   31 (46)
T ss_pred             cCHHHHHC
Confidence            34555554


No 56 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=61.37  E-value=4.1  Score=18.91  Aligned_cols=9  Identities=22%  Similarity=0.593  Sum_probs=1.6

Q ss_pred             CCCCccccC
Q psy4437          64 PSGCGVGLS   72 (131)
Q Consensus        64 C~~c~~~i~   72 (131)
                      |..|++++.
T Consensus         3 C~~C~~~~~   11 (30)
T PF07649_consen    3 CDACGKPID   11 (30)
T ss_dssp             -TTTS----
T ss_pred             CCcCCCcCC
Confidence            334444433


No 57 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=61.22  E-value=3  Score=20.44  Aligned_cols=31  Identities=29%  Similarity=0.682  Sum_probs=18.3

Q ss_pred             cccCCccccCceeEeecCCccccCCcccCCCcCcCC
Q psy4437           5 CAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS   40 (131)
Q Consensus         5 C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   40 (131)
                      |..|.+.+.+     ..++.||..=..|..|+-.++
T Consensus         2 C~~C~~Ey~~-----p~~RR~~~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFD-----PSNRRFHYQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCS-----TTSTTTT-TT--BTTCC-SCC
T ss_pred             CHHHHHHHcC-----CCCCcccCcCccCCCCCCCEE
Confidence            5556555543     357899999999999987664


No 58 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=60.38  E-value=5.4  Score=19.38  Aligned_cols=8  Identities=25%  Similarity=0.737  Sum_probs=4.6

Q ss_pred             cccCCccc
Q psy4437           5 CAGCEKPI   12 (131)
Q Consensus         5 C~~C~~~I   12 (131)
                      |..|.+.+
T Consensus         2 C~iC~~~~    9 (45)
T cd00162           2 CPICLEEF    9 (45)
T ss_pred             CCcCchhh
Confidence            55566555


No 59 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=59.68  E-value=9  Score=18.32  Aligned_cols=14  Identities=36%  Similarity=0.674  Sum_probs=7.3

Q ss_pred             CCccccccCCcccc
Q psy4437          74 SMLISCAGCEKPIL   87 (131)
Q Consensus        74 ~~~~~C~~C~~~I~   87 (131)
                      .+.++|..|+-.|+
T Consensus        15 ~~~irC~~CG~RIl   28 (32)
T PF03604_consen   15 GDPIRCPECGHRIL   28 (32)
T ss_dssp             SSTSSBSSSS-SEE
T ss_pred             CCcEECCcCCCeEE
Confidence            34456666666554


No 60 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=59.10  E-value=4.3  Score=21.96  Aligned_cols=29  Identities=14%  Similarity=0.228  Sum_probs=18.9

Q ss_pred             cccCCCcCcCCCCccCcCCeeecccCcCC
Q psy4437          30 VRCYDCHHTLSDKCFSREGKLFCRNDFFR   58 (131)
Q Consensus        30 f~C~~C~~~l~~~~f~~~~~~~C~~c~~~   58 (131)
                      |.|..|+..+.+......|..||..+..+
T Consensus         2 ~~Cpi~~~~~~~Pv~~~~G~v~~~~~i~~   30 (63)
T smart00504        2 FLCPISLEVMKDPVILPSGQTYERRAIEK   30 (63)
T ss_pred             cCCcCCCCcCCCCEECCCCCEEeHHHHHH
Confidence            46777777776543355678888777643


No 61 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=57.80  E-value=2.5  Score=22.53  Aligned_cols=28  Identities=21%  Similarity=0.594  Sum_probs=18.1

Q ss_pred             ccCCCcCcCCC-Ccc-CcCCeeecccCcCCC
Q psy4437          31 RCYDCHHTLSD-KCF-SREGKLFCRNDFFRS   59 (131)
Q Consensus        31 ~C~~C~~~l~~-~~f-~~~~~~~C~~c~~~~   59 (131)
                      .|..|++.+.- ..+ ..|| ..|.+|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            36777777765 235 5666 5788887654


No 62 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=57.56  E-value=5.3  Score=21.98  Aligned_cols=22  Identities=36%  Similarity=0.822  Sum_probs=15.1

Q ss_pred             ccccccccccc---eeccCCeeecC
Q psy4437         106 CYDCHHTLSDK---CFSREGKLFCR  127 (131)
Q Consensus       106 C~~C~~~l~~~---~~~~~g~~~C~  127 (131)
                      |..|++.|..+   |.-+..+.+|.
T Consensus        19 C~~C~k~L~~~~DiymYrGd~aFCS   43 (58)
T PF04570_consen   19 CYLCKKKLDPGKDIYMYRGDKAFCS   43 (58)
T ss_pred             HHccCCCCCCCCCeeeecccccccc
Confidence            66678888854   55566777774


No 63 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=56.78  E-value=1.9  Score=29.87  Aligned_cols=44  Identities=18%  Similarity=0.241  Sum_probs=28.8

Q ss_pred             cccCCCcCcCCCCccCcCCeeecccCcCCCC--CCCCCCCccccCC
Q psy4437          30 VRCYDCHHTLSDKCFSREGKLFCRNDFFRSP--VRFPSGCGVGLSS   73 (131)
Q Consensus        30 f~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~--~~~C~~c~~~i~~   73 (131)
                      |.|..|.+...+.....=|..+|..|+.+.+  ++.|..|++...+
T Consensus       197 F~C~iCKkdy~spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G  242 (259)
T COG5152         197 FLCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDECGVCGKATYG  242 (259)
T ss_pred             eeehhchhhccchhhhhcchhHHHHHHHHHhccCCcceecchhhcc
Confidence            7788887776554334557788888887655  4566666655443


No 64 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=55.68  E-value=7.1  Score=20.12  Aligned_cols=14  Identities=29%  Similarity=0.589  Sum_probs=8.9

Q ss_pred             CccccccCCccccc
Q psy4437          75 MLISCAGCEKPILD   88 (131)
Q Consensus        75 ~~~~C~~C~~~I~~   88 (131)
                      +...|..|+-.|+-
T Consensus        18 ~~irC~~CG~rIly   31 (44)
T smart00659       18 DVVRCRECGYRILY   31 (44)
T ss_pred             CceECCCCCceEEE
Confidence            44667777776654


No 65 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=54.99  E-value=1.7  Score=26.45  Aligned_cols=35  Identities=14%  Similarity=0.286  Sum_probs=16.2

Q ss_pred             cCCccccCceeEeecCCccccCCcccCCCcCcCCC
Q psy4437           7 GCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSD   41 (131)
Q Consensus         7 ~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~   41 (131)
                      .|+..+.+-......-..+++.+..|-.|++.|+-
T Consensus        40 ~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~   74 (105)
T COG4357          40 HCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTR   74 (105)
T ss_pred             HHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhH
Confidence            34444433333333334455555555555555544


No 66 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=54.45  E-value=4.5  Score=18.71  Aligned_cols=9  Identities=33%  Similarity=0.734  Sum_probs=3.1

Q ss_pred             ccccCCccc
Q psy4437           4 SCAGCEKPI   12 (131)
Q Consensus         4 ~C~~C~~~I   12 (131)
                      .|..|+..|
T Consensus         3 ~C~rC~~~~   11 (30)
T PF06827_consen    3 KCPRCWNYI   11 (30)
T ss_dssp             B-TTT--BB
T ss_pred             cCccCCCcc
Confidence            455555554


No 67 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=53.92  E-value=2  Score=26.09  Aligned_cols=22  Identities=14%  Similarity=0.332  Sum_probs=10.7

Q ss_pred             cCCcccccCccccccccccccc
Q psy4437          95 LERTWHADCVRCYDCHHTLSDK  116 (131)
Q Consensus        95 ~~~~~H~~Cf~C~~C~~~l~~~  116 (131)
                      .-..+++.+..|..|.+.|+-.
T Consensus        54 ~~~~~~~~~iiCGvC~~~LT~~   75 (105)
T COG4357          54 GLQEFNPKAIICGVCRKLLTRA   75 (105)
T ss_pred             ChhhcCCccEEhhhhhhhhhHH
Confidence            3344455555555555555433


No 68 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=52.71  E-value=5.3  Score=22.85  Aligned_cols=37  Identities=24%  Similarity=0.450  Sum_probs=16.8

Q ss_pred             ccCCCcCcCCCCccCcCCeeecccCcCCCC-CCCCCCCcccc
Q psy4437          31 RCYDCHHTLSDKCFSREGKLFCRNDFFRSP-VRFPSGCGVGL   71 (131)
Q Consensus        31 ~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~-~~~C~~c~~~i   71 (131)
                      .|..|+.+|..    .++..+|..|...-. ...|..|++++
T Consensus         3 ~CP~C~~~L~~----~~~~~~C~~C~~~~~~~a~CPdC~~~L   40 (70)
T PF07191_consen    3 TCPKCQQELEW----QGGHYHCEACQKDYKKEAFCPDCGQPL   40 (70)
T ss_dssp             B-SSS-SBEEE----ETTEEEETTT--EEEEEEE-TTT-SB-
T ss_pred             cCCCCCCccEE----eCCEEECccccccceecccCCCcccHH
Confidence            56778777754    246777877754311 23444444443


No 69 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=52.14  E-value=14  Score=19.02  Aligned_cols=6  Identities=33%  Similarity=1.149  Sum_probs=2.9

Q ss_pred             cccCCc
Q psy4437           5 CAGCEK   10 (131)
Q Consensus         5 C~~C~~   10 (131)
                      |..|++
T Consensus         2 C~vC~~    7 (51)
T PF00628_consen    2 CPVCGQ    7 (51)
T ss_dssp             BTTTTS
T ss_pred             CcCCCC
Confidence            444555


No 70 
>KOG3476|consensus
Probab=51.90  E-value=0.68  Score=27.51  Aligned_cols=14  Identities=43%  Similarity=0.581  Sum_probs=9.9

Q ss_pred             cccccCCcccccce
Q psy4437          77 ISCAGCEKPILDKF   90 (131)
Q Consensus        77 ~~C~~C~~~I~~~~   90 (131)
                      -+|+-|++.|.+..
T Consensus        80 giCAMCGKki~nTK   93 (100)
T KOG3476|consen   80 GICAMCGKKILNTK   93 (100)
T ss_pred             hHHHHhhhHhhccc
Confidence            46888888877643


No 71 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=51.59  E-value=8.5  Score=19.59  Aligned_cols=9  Identities=22%  Similarity=0.596  Sum_probs=4.9

Q ss_pred             eecccCcCC
Q psy4437          50 LFCRNDFFR   58 (131)
Q Consensus        50 ~~C~~c~~~   58 (131)
                      -+|.+||.+
T Consensus        28 dlC~~Cf~~   36 (44)
T smart00291       28 DLCQSCFAK   36 (44)
T ss_pred             cchHHHHhC
Confidence            356666643


No 72 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=51.03  E-value=7.1  Score=19.73  Aligned_cols=11  Identities=18%  Similarity=0.570  Sum_probs=5.7

Q ss_pred             cccccCCcccc
Q psy4437          77 ISCAGCEKPIL   87 (131)
Q Consensus        77 ~~C~~C~~~I~   87 (131)
                      ..|..|+....
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            34566665443


No 73 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=50.89  E-value=5.4  Score=24.01  Aligned_cols=12  Identities=42%  Similarity=0.711  Sum_probs=7.1

Q ss_pred             cccCCCcCcCCC
Q psy4437          30 VRCYDCHHTLSD   41 (131)
Q Consensus        30 f~C~~C~~~l~~   41 (131)
                      -.|..|+++|.-
T Consensus        34 S~C~~C~~~L~~   45 (92)
T PF06750_consen   34 SHCPHCGHPLSW   45 (92)
T ss_pred             CcCcCCCCcCcc
Confidence            456666666653


No 74 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=50.24  E-value=13  Score=18.97  Aligned_cols=10  Identities=50%  Similarity=1.381  Sum_probs=5.2

Q ss_pred             ccccCCcccc
Q psy4437           4 SCAGCEKPIL   13 (131)
Q Consensus         4 ~C~~C~~~I~   13 (131)
                      .|.+|+++|.
T Consensus         2 ~Cd~C~~~i~   11 (43)
T cd02340           2 ICDGCQGPIV   11 (43)
T ss_pred             CCCCCCCcCc
Confidence            4555655443


No 75 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=50.11  E-value=6.5  Score=20.18  Aligned_cols=29  Identities=24%  Similarity=0.388  Sum_probs=15.5

Q ss_pred             CccccCCccccCceeEeecCCccccCCcccCCCcCcCC
Q psy4437           3 ISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS   40 (131)
Q Consensus         3 ~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   40 (131)
                      -+|..|+..+.-....   +      =++|..|+.++.
T Consensus         4 y~C~~CG~~~~~~~~~---~------~~~Cp~CG~~~~   32 (46)
T PRK00398          4 YKCARCGREVELDEYG---T------GVRCPYCGYRIL   32 (46)
T ss_pred             EECCCCCCEEEECCCC---C------ceECCCCCCeEE
Confidence            4577777765322111   0      267777766553


No 76 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=49.25  E-value=12  Score=20.67  Aligned_cols=10  Identities=20%  Similarity=0.537  Sum_probs=4.9

Q ss_pred             CCCCCCcccc
Q psy4437          62 RFPSGCGVGL   71 (131)
Q Consensus        62 ~~C~~c~~~i   71 (131)
                      +.|..|+..|
T Consensus        10 ~~CtSCg~~i   19 (61)
T COG2888          10 PVCTSCGREI   19 (61)
T ss_pred             ceeccCCCEe
Confidence            4455555444


No 77 
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=48.67  E-value=15  Score=20.75  Aligned_cols=21  Identities=19%  Similarity=0.494  Sum_probs=12.2

Q ss_pred             cccccccccccc----eeccCCeee
Q psy4437         105 RCYDCHHTLSDK----CFSREGKLF  125 (131)
Q Consensus       105 ~C~~C~~~l~~~----~~~~~g~~~  125 (131)
                      +|+-|+..|..+    |+..||.++
T Consensus         5 ~CsFcG~~I~PGtG~m~Vr~Dg~v~   29 (66)
T COG2075           5 VCSFCGKKIEPGTGIMYVRNDGKVL   29 (66)
T ss_pred             EecCcCCccCCCceEEEEecCCeEE
Confidence            366667776554    344566654


No 78 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=46.41  E-value=13  Score=18.09  Aligned_cols=13  Identities=38%  Similarity=1.170  Sum_probs=4.6

Q ss_pred             ccccCCccccCce
Q psy4437           4 SCAGCEKPILDKF   16 (131)
Q Consensus         4 ~C~~C~~~I~~~~   16 (131)
                      .|..|++++.+.+
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            4555555555443


No 79 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=45.94  E-value=20  Score=18.05  Aligned_cols=13  Identities=23%  Similarity=0.675  Sum_probs=8.2

Q ss_pred             ccccccccccccc
Q psy4437         104 VRCYDCHHTLSDK  116 (131)
Q Consensus       104 f~C~~C~~~l~~~  116 (131)
                      +.|..|+..|...
T Consensus        20 ~vC~~CG~Vl~e~   32 (43)
T PF08271_consen   20 LVCPNCGLVLEEN   32 (43)
T ss_dssp             EEETTT-BBEE-T
T ss_pred             EECCCCCCEeecc
Confidence            5788888877654


No 80 
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=45.74  E-value=15  Score=19.69  Aligned_cols=24  Identities=21%  Similarity=0.519  Sum_probs=17.0

Q ss_pred             ccccCCcccccceeeeecCCcccc
Q psy4437          78 SCAGCEKPILDKFLLNVLERTWHA  101 (131)
Q Consensus        78 ~C~~C~~~I~~~~~~~~~~~~~H~  101 (131)
                      +|..|+.||...-.+......-|+
T Consensus         3 iCvvCK~Pi~~al~v~T~~Gpvh~   26 (53)
T PHA02610          3 ICVVCKQPIEKALVVETEKGPVHP   26 (53)
T ss_pred             eeeeeCCchhhceEEecCCCCCCC
Confidence            577788888666666666677776


No 81 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=44.95  E-value=13  Score=19.41  Aligned_cols=9  Identities=22%  Similarity=0.490  Sum_probs=3.4

Q ss_pred             CCCCCcccc
Q psy4437          63 FPSGCGVGL   71 (131)
Q Consensus        63 ~C~~c~~~i   71 (131)
                      .|..|++.|
T Consensus        13 ~C~~C~~~i   21 (53)
T PF00130_consen   13 YCDVCGKFI   21 (53)
T ss_dssp             B-TTSSSBE
T ss_pred             CCcccCccc
Confidence            344444444


No 82 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=44.64  E-value=11  Score=18.50  Aligned_cols=12  Identities=17%  Similarity=0.484  Sum_probs=7.4

Q ss_pred             cccccCCccccc
Q psy4437          77 ISCAGCEKPILD   88 (131)
Q Consensus        77 ~~C~~C~~~I~~   88 (131)
                      ..|..|++.+..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            457777775543


No 83 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=44.36  E-value=22  Score=23.62  Aligned_cols=11  Identities=36%  Similarity=1.029  Sum_probs=5.3

Q ss_pred             cccCCccccCc
Q psy4437           5 CAGCEKPILDK   15 (131)
Q Consensus         5 C~~C~~~I~~~   15 (131)
                      |..|+-+|.+.
T Consensus        42 Cp~C~~~IrG~   52 (158)
T PF10083_consen   42 CPNCSTPIRGD   52 (158)
T ss_pred             CcCCCCCCCCc
Confidence            44455555443


No 84 
>KOG3579|consensus
Probab=44.22  E-value=11  Score=27.67  Aligned_cols=29  Identities=21%  Similarity=0.497  Sum_probs=15.9

Q ss_pred             cccCCccccCceeEeecCCccccCCcccC
Q psy4437           5 CAGCEKPILDKFLLNVLERTWHADCVRCY   33 (131)
Q Consensus         5 C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~   33 (131)
                      |.-|++.+.|.-.|.--.-.-|+-||-|+
T Consensus       271 CTLC~ERLEDTHFVQCPSVp~HKFCFPCS  299 (352)
T KOG3579|consen  271 CTLCHERLEDTHFVQCPSVPSHKFCFPCS  299 (352)
T ss_pred             ehhhhhhhccCceeecCCCcccceecccC
Confidence            55566666555444444455566666554


No 85 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=44.08  E-value=10  Score=20.07  Aligned_cols=13  Identities=38%  Similarity=0.570  Sum_probs=7.5

Q ss_pred             ccccccCCccccc
Q psy4437          76 LISCAGCEKPILD   88 (131)
Q Consensus        76 ~~~C~~C~~~I~~   88 (131)
                      ...|+.|+-.|+-
T Consensus        24 ~irCp~Cg~rIl~   36 (49)
T COG1996          24 GIRCPYCGSRILV   36 (49)
T ss_pred             ceeCCCCCcEEEE
Confidence            3566666665543


No 86 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=43.44  E-value=18  Score=17.99  Aligned_cols=29  Identities=21%  Similarity=0.461  Sum_probs=11.5

Q ss_pred             ccccCCcccccceeeeecCCcccccCcccccccc
Q psy4437          78 SCAGCEKPILDKFLLNVLERTWHADCVRCYDCHH  111 (131)
Q Consensus        78 ~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~  111 (131)
                      +|..|+..|-.-..+...++.|     +|..|+.
T Consensus         4 rC~~C~aylNp~~~~~~~~~~w-----~C~~C~~   32 (40)
T PF04810_consen    4 RCRRCRAYLNPFCQFDDGGKTW-----ICNFCGT   32 (40)
T ss_dssp             B-TTT--BS-TTSEEETTTTEE-----EETTT--
T ss_pred             ccCCCCCEECCcceEcCCCCEE-----ECcCCCC
Confidence            4555555554433334445554     5665554


No 87 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=42.13  E-value=18  Score=19.52  Aligned_cols=33  Identities=27%  Similarity=0.442  Sum_probs=18.9

Q ss_pred             CCCccccCCccccCceeEeecCCccccCCcccCCCcCcCC
Q psy4437           1 MLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS   40 (131)
Q Consensus         1 ~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   40 (131)
                      |...|..|+..|.-....  .|.     -..|..|+..|.
T Consensus         1 ~~~~CP~CG~~iev~~~~--~Ge-----iV~Cp~CGaele   33 (54)
T TIGR01206         1 MQFECPDCGAEIELENPE--LGE-----LVICDECGAELE   33 (54)
T ss_pred             CccCCCCCCCEEecCCCc--cCC-----EEeCCCCCCEEE
Confidence            566788888877322211  132     246777777664


No 88 
>KOG0320|consensus
Probab=41.89  E-value=4.5  Score=27.50  Aligned_cols=52  Identities=23%  Similarity=0.457  Sum_probs=33.4

Q ss_pred             ccCCcccCCCcCcCCCCc-c-CcCCeeecccCcCCCCCCCCCCCccccCCCCccccccCCcccccce
Q psy4437          26 HADCVRCYDCHHTLSDKC-F-SREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILDKF   90 (131)
Q Consensus        26 H~~Cf~C~~C~~~l~~~~-f-~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~C~~~I~~~~   90 (131)
                      -..++.|-.|-.....+. + .+=|.+||..|......             ....|+.|+|.|..++
T Consensus       128 ~~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk-------------~~~~CP~C~kkIt~k~  181 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALK-------------NTNKCPTCRKKITHKQ  181 (187)
T ss_pred             cccccCCCceecchhhccccccccchhHHHHHHHHHHH-------------hCCCCCCcccccchhh
Confidence            345788888877776644 5 56688999888754321             1246777777665544


No 89 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=41.70  E-value=11  Score=19.71  Aligned_cols=30  Identities=20%  Similarity=0.598  Sum_probs=19.7

Q ss_pred             ccccCCccccCceeEeecCCccccCCcccCCCcCcCCC
Q psy4437           4 SCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSD   41 (131)
Q Consensus         4 ~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~   41 (131)
                      .|..|+++..++  +.+.++      |.|..|.+.|..
T Consensus         1 ~CiiC~~~~~~G--I~I~~~------fIC~~CE~~iv~   30 (46)
T PF10764_consen    1 KCIICGKEKEEG--IHIYGK------FICSDCEKEIVN   30 (46)
T ss_pred             CeEeCCCcCCCC--EEEECe------EehHHHHHHhcc
Confidence            366777777665  334444      788888777754


No 90 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=41.62  E-value=40  Score=29.99  Aligned_cols=37  Identities=14%  Similarity=0.225  Sum_probs=19.9

Q ss_pred             eecccCcCCCCCCCCCCCccccCCCCccccccCCccccc
Q psy4437          50 LFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCEKPILD   88 (131)
Q Consensus        50 ~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~C~~~I~~   88 (131)
                      ..|.+|-...+..+|..|+....+  ...|+.|+..+..
T Consensus       668 rkCPkCG~~t~~~fCP~CGs~te~--vy~CPsCGaev~~  704 (1337)
T PRK14714        668 RRCPSCGTETYENRCPDCGTHTEP--VYVCPDCGAEVPP  704 (1337)
T ss_pred             EECCCCCCccccccCcccCCcCCC--ceeCccCCCccCC
Confidence            455555544444566666665533  2356666665543


No 91 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=41.39  E-value=9.4  Score=16.01  Aligned_cols=13  Identities=31%  Similarity=0.674  Sum_probs=9.2

Q ss_pred             ccccccccccccc
Q psy4437         104 VRCYDCHHTLSDK  116 (131)
Q Consensus       104 f~C~~C~~~l~~~  116 (131)
                      |+|..|++.+...
T Consensus         1 y~C~~C~~~f~~~   13 (23)
T PF00096_consen    1 YKCPICGKSFSSK   13 (23)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCCCCCccCCH
Confidence            5678888777654


No 92 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=41.20  E-value=21  Score=19.05  Aligned_cols=9  Identities=44%  Similarity=0.814  Sum_probs=4.1

Q ss_pred             cccCCcccc
Q psy4437          79 CAGCEKPIL   87 (131)
Q Consensus        79 C~~C~~~I~   87 (131)
                      |+.|+..|.
T Consensus         4 C~fcG~~I~   12 (52)
T PRK00807          4 CSFCGKEIE   12 (52)
T ss_pred             cCCCCCeEc
Confidence            444444444


No 93 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=40.04  E-value=14  Score=19.33  Aligned_cols=12  Identities=17%  Similarity=0.484  Sum_probs=7.7

Q ss_pred             cccccCCccccc
Q psy4437          77 ISCAGCEKPILD   88 (131)
Q Consensus        77 ~~C~~C~~~I~~   88 (131)
                      ..|..|+.....
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            467788775543


No 94 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=39.50  E-value=14  Score=21.36  Aligned_cols=32  Identities=16%  Similarity=0.084  Sum_probs=10.5

Q ss_pred             CCCCCCCCccccCCCCccccccCCccccccee
Q psy4437          60 PVRFPSGCGVGLSSSMLISCAGCEKPILDKFL   91 (131)
Q Consensus        60 ~~~~C~~c~~~i~~~~~~~C~~C~~~I~~~~~   91 (131)
                      +..+|.+|..........-|+.|+..-+.+..
T Consensus         8 ~vlrC~aCf~~t~~~~k~FCp~CGn~TL~rvs   39 (73)
T PF08772_consen    8 WVLRCHACFKITKDMTKQFCPKCGNATLKRVS   39 (73)
T ss_dssp             EEEE-SSS--EES-SS--S-SSS--S--EEEE
T ss_pred             eeEEccccccCcCCCCceeCcccCCCcceEEE
Confidence            34455555555444444556666665444433


No 95 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=39.29  E-value=13  Score=20.28  Aligned_cols=22  Identities=23%  Similarity=0.276  Sum_probs=12.4

Q ss_pred             eecccCcCCCCCCCCCCCcccc
Q psy4437          50 LFCRNDFFRSPVRFPSGCGVGL   71 (131)
Q Consensus        50 ~~C~~c~~~~~~~~C~~c~~~i   71 (131)
                      .||.+|........|..|+..+
T Consensus        30 TFC~~C~e~~l~~~CPNCgGel   51 (57)
T PF06906_consen   30 TFCADCAETMLNGVCPNCGGEL   51 (57)
T ss_pred             cccHHHHHHHhcCcCcCCCCcc
Confidence            3566666655555555555544


No 96 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=39.18  E-value=15  Score=19.04  Aligned_cols=28  Identities=11%  Similarity=0.444  Sum_probs=17.5

Q ss_pred             ccCCCcCcCCCCcc--Cc-CCeeecccCcCC
Q psy4437          31 RCYDCHHTLSDKCF--SR-EGKLFCRNDFFR   58 (131)
Q Consensus        31 ~C~~C~~~l~~~~f--~~-~~~~~C~~c~~~   58 (131)
                      .|..|+..++...|  .+ .+..+|.+||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            46777777776444  22 245678888764


No 97 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=39.18  E-value=18  Score=20.01  Aligned_cols=12  Identities=33%  Similarity=0.567  Sum_probs=6.5

Q ss_pred             CCccccCCcccc
Q psy4437           2 LISCAGCEKPIL   13 (131)
Q Consensus         2 ~~~C~~C~~~I~   13 (131)
                      +.+|..||++|.
T Consensus         4 PVRCFTCGkvi~   15 (60)
T PF01194_consen    4 PVRCFTCGKVIG   15 (60)
T ss_dssp             SSS-STTTSBTC
T ss_pred             ceecCCCCCChh
Confidence            455666666663


No 98 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=39.00  E-value=10  Score=22.61  Aligned_cols=16  Identities=19%  Similarity=0.069  Sum_probs=11.9

Q ss_pred             cCCCCCCCCCCCcccc
Q psy4437          56 FFRSPVRFPSGCGVGL   71 (131)
Q Consensus        56 ~~~~~~~~C~~c~~~i   71 (131)
                      |...|..+|..|++.+
T Consensus        49 Y~~lfs~pC~~C~klL   64 (90)
T PF11571_consen   49 YRNLFSTPCKKCGKLL   64 (90)
T ss_pred             HhhhccchhhHHHhHh
Confidence            5667777888888777


No 99 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=38.39  E-value=28  Score=18.11  Aligned_cols=19  Identities=26%  Similarity=0.683  Sum_probs=8.7

Q ss_pred             CCCCccccCCCCccccccC
Q psy4437          64 PSGCGVGLSSSMLISCAGC   82 (131)
Q Consensus        64 C~~c~~~i~~~~~~~C~~C   82 (131)
                      |.+|.+.+..+....|..|
T Consensus         3 Cd~C~~~~~~g~r~~C~~C   21 (49)
T cd02335           3 CDYCSKDITGTIRIKCAEC   21 (49)
T ss_pred             CCCcCCCCCCCcEEECCCC
Confidence            4455544444333444444


No 100
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=38.32  E-value=26  Score=16.83  Aligned_cols=7  Identities=29%  Similarity=0.842  Sum_probs=3.3

Q ss_pred             ccccCCc
Q psy4437          78 SCAGCEK   84 (131)
Q Consensus        78 ~C~~C~~   84 (131)
                      .|+.|+.
T Consensus        20 ~CP~Cg~   26 (34)
T cd00729          20 KCPICGA   26 (34)
T ss_pred             cCcCCCC
Confidence            4444443


No 101
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=38.07  E-value=13  Score=18.75  Aligned_cols=29  Identities=21%  Similarity=0.495  Sum_probs=14.5

Q ss_pred             cCCCcCcCCC--Ccc-CcCCeeecccCcCCCC
Q psy4437          32 CYDCHHTLSD--KCF-SREGKLFCRNDFFRSP   60 (131)
Q Consensus        32 C~~C~~~l~~--~~f-~~~~~~~C~~c~~~~~   60 (131)
                      |..|...+++  ..+ ..=|..+|..|..+..
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~   33 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLK   33 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhc
Confidence            4455555522  122 2336667777765544


No 102
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=37.61  E-value=8.1  Score=21.15  Aligned_cols=15  Identities=27%  Similarity=0.735  Sum_probs=12.3

Q ss_pred             cccCCCcCcCCCCcc
Q psy4437          30 VRCYDCHHTLSDKCF   44 (131)
Q Consensus        30 f~C~~C~~~l~~~~f   44 (131)
                      +.|++|+..|+++.|
T Consensus         5 lvCSTCGrDlSeeRy   19 (63)
T PF05864_consen    5 LVCSTCGRDLSEERY   19 (63)
T ss_pred             eeecccCCcchHHHH
Confidence            578999999988655


No 103
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=37.27  E-value=8.3  Score=19.67  Aligned_cols=26  Identities=19%  Similarity=0.460  Sum_probs=9.2

Q ss_pred             cccCCccccCceeEee--cCCccccCCc
Q psy4437           5 CAGCEKPILDKFLLNV--LERTWHADCV   30 (131)
Q Consensus         5 C~~C~~~I~~~~~~~~--~~~~~H~~Cf   30 (131)
                      |..|++.++-+..-.-  =+..||..|+
T Consensus         1 C~~C~~iv~~G~~C~~~~C~~r~H~~C~   28 (43)
T PF08746_consen    1 CEACKEIVTQGQRCSNRDCNVRLHDDCF   28 (43)
T ss_dssp             -TTT-SB-SSSEE-SS--S--EE-HHHH
T ss_pred             CcccchhHeeeccCCCCccCchHHHHHH
Confidence            5667776655533211  1234565554


No 104
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=36.60  E-value=6.7  Score=19.69  Aligned_cols=27  Identities=22%  Similarity=0.476  Sum_probs=12.9

Q ss_pred             ccccCCccccCceeEeec--CCccccCCc
Q psy4437           4 SCAGCEKPILDKFLLNVL--ERTWHADCV   30 (131)
Q Consensus         4 ~C~~C~~~I~~~~~~~~~--~~~~H~~Cf   30 (131)
                      .|..|.+.+.+++.+..+  +-.||.+|+
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci   30 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCI   30 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHH
Confidence            466677777432222222  444555443


No 105
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=35.99  E-value=8.6  Score=21.04  Aligned_cols=15  Identities=27%  Similarity=0.735  Sum_probs=12.3

Q ss_pred             cccCCCcCcCCCCcc
Q psy4437          30 VRCYDCHHTLSDKCF   44 (131)
Q Consensus        30 f~C~~C~~~l~~~~f   44 (131)
                      ++|++|+..|+++.|
T Consensus         5 lVCsTCGrDlSeeRy   19 (63)
T PHA03082          5 LVCSTCGRDLSEERY   19 (63)
T ss_pred             eeecccCcchhHHHH
Confidence            579999999988655


No 106
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=35.88  E-value=21  Score=19.11  Aligned_cols=28  Identities=25%  Similarity=0.526  Sum_probs=14.1

Q ss_pred             cccCCcccccceeeeecCCcccccCccc
Q psy4437          79 CAGCEKPILDKFLLNVLERTWHADCVRC  106 (131)
Q Consensus        79 C~~C~~~I~~~~~~~~~~~~~H~~Cf~C  106 (131)
                      |+-|+.+|.-..-.+..++.|=.+|-.|
T Consensus         3 CPyCge~~~~~iD~s~~~Q~yiEDC~vC   30 (52)
T PF14255_consen    3 CPYCGEPIEILIDPSAGDQEYIEDCQVC   30 (52)
T ss_pred             CCCCCCeeEEEEecCCCCeeEEeehhhc
Confidence            4555555543222244566666666554


No 107
>cd02334 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger present in dystrophin and dystrobrevin. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dystrophin attaches actin filaments to an integral membrane glycoprotein complex in muscle cells. The ZZ domain in dystrophin has been shown to be essential for binding to the membrane protein beta-dystroglycan.
Probab=35.66  E-value=27  Score=18.40  Aligned_cols=8  Identities=38%  Similarity=1.103  Sum_probs=4.4

Q ss_pred             ecccCcCC
Q psy4437          51 FCRNDFFR   58 (131)
Q Consensus        51 ~C~~c~~~   58 (131)
                      +|..||..
T Consensus        26 LC~~Cf~~   33 (49)
T cd02334          26 LCQSCFFS   33 (49)
T ss_pred             chHHHHhC
Confidence            56666643


No 108
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=34.85  E-value=18  Score=19.31  Aligned_cols=25  Identities=28%  Similarity=0.603  Sum_probs=14.6

Q ss_pred             cccccccccccc-eec---cCCeeecCCC
Q psy4437         105 RCYDCHHTLSDK-CFS---REGKLFCRND  129 (131)
Q Consensus       105 ~C~~C~~~l~~~-~~~---~~g~~~C~~c  129 (131)
                      +|..|...|+.. +..   .++.++|+.|
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~C   52 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNC   52 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCC
Confidence            577777777666 221   2355667665


No 109
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=34.69  E-value=33  Score=17.07  Aligned_cols=8  Identities=13%  Similarity=0.239  Sum_probs=3.3

Q ss_pred             CCCCcccc
Q psy4437          64 PSGCGVGL   71 (131)
Q Consensus        64 C~~c~~~i   71 (131)
                      |..|.+.|
T Consensus        14 C~~C~~~i   21 (49)
T smart00109       14 CCVCRKSI   21 (49)
T ss_pred             cccccccc
Confidence            44444433


No 110
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=34.20  E-value=11  Score=24.58  Aligned_cols=34  Identities=18%  Similarity=0.371  Sum_probs=15.8

Q ss_pred             ccccCCccccCceeEeecCCccccCCcccCCCcCcCC
Q psy4437           4 SCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS   40 (131)
Q Consensus         4 ~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   40 (131)
                      .|..|+...+..+++...+.   ..=|.|..|+..|.
T Consensus       101 ~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l~  134 (147)
T smart00531      101 KCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEELE  134 (147)
T ss_pred             ECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEEE
Confidence            35666655543332222121   22266666666664


No 111
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=33.79  E-value=21  Score=29.60  Aligned_cols=82  Identities=24%  Similarity=0.484  Sum_probs=46.9

Q ss_pred             CccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCccCcCCeeecccCcCCCCCCCCCCCccccCCCCccccccC
Q psy4437           3 ISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGC   82 (131)
Q Consensus         3 ~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~C   82 (131)
                      .+|..|-+.|.+.     .++.||--=-.|+.|+-.++-    ....||     .+...          .-.+.++|..|
T Consensus       102 a~C~~Cl~Ei~dp-----~~rrY~YPF~~CT~CGPRfTI----i~alPY-----DR~nT----------sM~~F~lC~~C  157 (750)
T COG0068         102 ATCEDCLEEIFDP-----NSRRYLYPFINCTNCGPRFTI----IEALPY-----DRENT----------SMADFPLCPFC  157 (750)
T ss_pred             hhhHHHHHHhcCC-----CCcceeccccccCCCCcceee----eccCCC-----CcccC----------ccccCcCCHHH
Confidence            4577777777554     466777776778888755542    222221     11100          00223456666


Q ss_pred             CcccccceeeeecCCcccccCcccccccccc
Q psy4437          83 EKPILDKFLLNVLERTWHADCVRCYDCHHTL  113 (131)
Q Consensus        83 ~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l  113 (131)
                      .+.     +....++.||..=..|..|+-.+
T Consensus       158 ~~E-----Y~dP~nRRfHAQp~aCp~CGP~~  183 (750)
T COG0068         158 DKE-----YKDPLNRRFHAQPIACPKCGPHL  183 (750)
T ss_pred             HHH-----hcCccccccccccccCcccCCCe
Confidence            542     11567888999888899987644


No 112
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=33.68  E-value=24  Score=18.47  Aligned_cols=8  Identities=13%  Similarity=0.704  Sum_probs=4.1

Q ss_pred             ecccCcCC
Q psy4437          51 FCRNDFFR   58 (131)
Q Consensus        51 ~C~~c~~~   58 (131)
                      +|.+||.+
T Consensus        28 lC~~C~~~   35 (48)
T cd02341          28 LCQDCVVK   35 (48)
T ss_pred             cCHHHHhC
Confidence            45555543


No 113
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=33.57  E-value=23  Score=24.43  Aligned_cols=29  Identities=24%  Similarity=0.460  Sum_probs=19.8

Q ss_pred             CcccCCCcCcCCCCccCcCCeeecccCcC
Q psy4437          29 CVRCYDCHHTLSDKCFSREGKLFCRNDFF   57 (131)
Q Consensus        29 Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~   57 (131)
                      -|.|..|...+.+.....=|..||..|..
T Consensus        18 ~~~CpICld~~~dPVvT~CGH~FC~~CI~   46 (193)
T PLN03208         18 DFDCNICLDQVRDPVVTLCGHLFCWPCIH   46 (193)
T ss_pred             ccCCccCCCcCCCcEEcCCCchhHHHHHH
Confidence            47788887776554334567788888864


No 114
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=33.49  E-value=17  Score=20.25  Aligned_cols=11  Identities=36%  Similarity=0.785  Sum_probs=6.1

Q ss_pred             CccccCCcccc
Q psy4437           3 ISCAGCEKPIL   13 (131)
Q Consensus         3 ~~C~~C~~~I~   13 (131)
                      .+|..||++|.
T Consensus         5 vRCFTCGkvi~   15 (62)
T PRK04016          5 VRCFTCGKVIA   15 (62)
T ss_pred             eEecCCCCChH
Confidence            45555665553


No 115
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=33.32  E-value=18  Score=20.77  Aligned_cols=12  Identities=33%  Similarity=0.567  Sum_probs=7.6

Q ss_pred             CCccccCCcccc
Q psy4437           2 LISCAGCEKPIL   13 (131)
Q Consensus         2 ~~~C~~C~~~I~   13 (131)
                      +.+|..||++|.
T Consensus         4 PVRCFTCGkvig   15 (71)
T PLN00032          4 PVRCFTCGKVIG   15 (71)
T ss_pred             ceeecCCCCCcH
Confidence            456677777663


No 116
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=33.08  E-value=54  Score=27.05  Aligned_cols=40  Identities=23%  Similarity=0.496  Sum_probs=25.8

Q ss_pred             CCCCCCCccccCCCCccccccCCcccccceeeeecCCcccccCccccccccccccc
Q psy4437          61 VRFPSGCGVGLSSSMLISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK  116 (131)
Q Consensus        61 ~~~C~~c~~~i~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~  116 (131)
                      +..|..|+.++..   ..|..|+..+.....             .|..|+..++..
T Consensus        15 akFC~~CG~~l~~---~~Cp~CG~~~~~~~~-------------fC~~CG~~~~~~   54 (645)
T PRK14559         15 NRFCQKCGTSLTH---KPCPQCGTEVPVDEA-------------HCPNCGAETGTI   54 (645)
T ss_pred             CccccccCCCCCC---CcCCCCCCCCCcccc-------------cccccCCcccch
Confidence            5578888777643   368888887544332             367777777654


No 117
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=32.84  E-value=18  Score=21.19  Aligned_cols=28  Identities=25%  Similarity=0.571  Sum_probs=19.4

Q ss_pred             ccCCCcCcCCCCc-c--CcCC---eeecccCcCC
Q psy4437          31 RCYDCHHTLSDKC-F--SREG---KLFCRNDFFR   58 (131)
Q Consensus        31 ~C~~C~~~l~~~~-f--~~~~---~~~C~~c~~~   58 (131)
                      .|..|+.||.... +  ..||   .-||.-||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            4788999998754 3  2343   4699999865


No 118
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=32.26  E-value=42  Score=15.09  Aligned_cols=6  Identities=33%  Similarity=1.016  Sum_probs=2.5

Q ss_pred             ccccCC
Q psy4437          78 SCAGCE   83 (131)
Q Consensus        78 ~C~~C~   83 (131)
                      .|+.|+
T Consensus        16 ~Cp~CG   21 (26)
T PF10571_consen   16 FCPHCG   21 (26)
T ss_pred             cCCCCC
Confidence            344443


No 119
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=32.14  E-value=24  Score=17.07  Aligned_cols=8  Identities=38%  Similarity=1.281  Sum_probs=2.2

Q ss_pred             cccCCccc
Q psy4437          79 CAGCEKPI   86 (131)
Q Consensus        79 C~~C~~~I   86 (131)
                      |+.|+.++
T Consensus         3 C~~CG~~l   10 (34)
T PF14803_consen    3 CPQCGGPL   10 (34)
T ss_dssp             -TTT--B-
T ss_pred             cccccChh
Confidence            55555554


No 120
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=31.54  E-value=26  Score=26.97  Aligned_cols=26  Identities=19%  Similarity=0.395  Sum_probs=14.3

Q ss_pred             CCCCCccccCCCCccccccCCccccc
Q psy4437          63 FPSGCGVGLSSSMLISCAGCEKPILD   88 (131)
Q Consensus        63 ~C~~c~~~i~~~~~~~C~~C~~~I~~   88 (131)
                      .|..|+..+.+++...|++|+..+..
T Consensus       217 ~C~~Cd~~~~~~~~a~CpRC~~~L~~  242 (403)
T TIGR00155       217 SCSACHTTILPAQEPVCPRCSTPLYV  242 (403)
T ss_pred             cCCCCCCccCCCCCcCCcCCCCcccC
Confidence            35555554444444566666666543


No 121
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=30.86  E-value=19  Score=14.70  Aligned_cols=13  Identities=23%  Similarity=0.613  Sum_probs=6.8

Q ss_pred             ccccccccccccc
Q psy4437         104 VRCYDCHHTLSDK  116 (131)
Q Consensus       104 f~C~~C~~~l~~~  116 (131)
                      |.|..|+..+...
T Consensus         1 ~~C~~C~~~~~~~   13 (24)
T PF13894_consen    1 FQCPICGKSFRSK   13 (24)
T ss_dssp             EE-SSTS-EESSH
T ss_pred             CCCcCCCCcCCcH
Confidence            4677777766543


No 122
>PRK12496 hypothetical protein; Provisional
Probab=30.46  E-value=30  Score=23.13  Aligned_cols=26  Identities=19%  Similarity=0.390  Sum_probs=14.7

Q ss_pred             CCCCCCccccCCC-CccccccCCcccc
Q psy4437          62 RFPSGCGVGLSSS-MLISCAGCEKPIL   87 (131)
Q Consensus        62 ~~C~~c~~~i~~~-~~~~C~~C~~~I~   87 (131)
                      .+|.+|++..... ....|+.||.++.
T Consensus       128 ~~C~gC~~~~~~~~~~~~C~~CG~~~~  154 (164)
T PRK12496        128 KVCKGCKKKYPEDYPDDVCEICGSPVK  154 (164)
T ss_pred             EECCCCCccccCCCCCCcCCCCCChhh
Confidence            4566666655432 2245777776654


No 123
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=30.24  E-value=1.1e+02  Score=27.49  Aligned_cols=53  Identities=17%  Similarity=0.356  Sum_probs=32.8

Q ss_pred             CcccCCCcCcCCCCccCcCCeeecccCcCCCC-CCCCCCCccccCCCC--ccccccCCcccccc
Q psy4437          29 CVRCYDCHHTLSDKCFSREGKLFCRNDFFRSP-VRFPSGCGVGLSSSM--LISCAGCEKPILDK   89 (131)
Q Consensus        29 Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~-~~~C~~c~~~i~~~~--~~~C~~C~~~I~~~   89 (131)
                      =++|..|+.....        .+|..|-.... ...|..|+..+.+.+  ...|+.|+.++...
T Consensus       667 ~rkCPkCG~~t~~--------~fCP~CGs~te~vy~CPsCGaev~~des~a~~CP~CGtplv~~  722 (1337)
T PRK14714        667 RRRCPSCGTETYE--------NRCPDCGTHTEPVYVCPDCGAEVPPDESGRVECPRCDVELTPY  722 (1337)
T ss_pred             EEECCCCCCcccc--------ccCcccCCcCCCceeCccCCCccCCCccccccCCCCCCccccc
Confidence            3778888775432        16777654432 236888887765432  34788888777653


No 124
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=29.93  E-value=70  Score=23.14  Aligned_cols=36  Identities=19%  Similarity=0.561  Sum_probs=21.6

Q ss_pred             CCccccCCccccCceeEeecCCccccCCcccCCCcCcCCC
Q psy4437           2 LISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSD   41 (131)
Q Consensus         2 ~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~   41 (131)
                      .++|.+|.+.-..   | ..++.|=..=|.|..|+..+.+
T Consensus       132 VSRCr~C~~rYDP---V-P~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  132 VSRCRKCRKRYDP---V-PCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cccccccccccCC---C-ccccccceeeeecccccccchh
Confidence            3566677664311   1 1456666666788888777765


No 125
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the KOG3497|consensus
Probab=29.35  E-value=20  Score=19.90  Aligned_cols=13  Identities=46%  Similarity=0.667  Sum_probs=7.5

Q ss_pred             CCccccCCccccC
Q psy4437           2 LISCAGCEKPILD   14 (131)
Q Consensus         2 ~~~C~~C~~~I~~   14 (131)
                      +.+|..|++.|.+
T Consensus         4 PiRCFtCGKvig~   16 (69)
T KOG3497|consen    4 PIRCFTCGKVIGD   16 (69)
T ss_pred             eeEeeeccccccc
Confidence            3456666666643


No 127
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=29.31  E-value=21  Score=18.62  Aligned_cols=10  Identities=40%  Similarity=0.979  Sum_probs=5.0

Q ss_pred             cccccccccc
Q psy4437         104 VRCYDCHHTL  113 (131)
Q Consensus       104 f~C~~C~~~l  113 (131)
                      ++|..|...|
T Consensus        32 lrCGaCs~vl   41 (46)
T PF11331_consen   32 LRCGACSEVL   41 (46)
T ss_pred             EeCCCCceeE
Confidence            4455555444


No 128
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=28.93  E-value=31  Score=24.23  Aligned_cols=28  Identities=21%  Similarity=0.387  Sum_probs=15.5

Q ss_pred             cCccccccccccccc-eeccCCeeecCCC
Q psy4437         102 DCVRCYDCHHTLSDK-CFSREGKLFCRND  129 (131)
Q Consensus       102 ~Cf~C~~C~~~l~~~-~~~~~g~~~C~~c  129 (131)
                      +=..|..|++++... |...+|.++|..|
T Consensus       148 ~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c  176 (247)
T PRK00085        148 DLDHCAVCGAPGDHRYFSPKEGGAVCSEC  176 (247)
T ss_pred             chhhHhcCCCCCCceEEecccCCcccccc
Confidence            334566666665533 3345666666555


No 129
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=28.85  E-value=37  Score=22.10  Aligned_cols=12  Identities=33%  Similarity=0.753  Sum_probs=6.6

Q ss_pred             cccCCCcCcCCC
Q psy4437          30 VRCYDCHHTLSD   41 (131)
Q Consensus        30 f~C~~C~~~l~~   41 (131)
                      -+|..|+.+|..
T Consensus        92 sRC~~CN~~L~~  103 (147)
T PF01927_consen   92 SRCPKCNGPLRP  103 (147)
T ss_pred             CccCCCCcEeee
Confidence            456666665543


No 130
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=28.82  E-value=20  Score=15.64  Aligned_cols=13  Identities=31%  Similarity=0.710  Sum_probs=9.9

Q ss_pred             ccccccccccccc
Q psy4437         104 VRCYDCHHTLSDK  116 (131)
Q Consensus       104 f~C~~C~~~l~~~  116 (131)
                      |.|..|++.+...
T Consensus         2 ~~C~~C~~~F~~~   14 (27)
T PF13912_consen    2 FECDECGKTFSSL   14 (27)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCccCCccCCh
Confidence            5788888888765


No 131
>PRK12495 hypothetical protein; Provisional
Probab=28.36  E-value=40  Score=23.82  Aligned_cols=27  Identities=26%  Similarity=0.716  Sum_probs=17.2

Q ss_pred             cccccCCcccccceeeeecCCcccccCccccccccccc
Q psy4437          77 ISCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLS  114 (131)
Q Consensus        77 ~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  114 (131)
                      ..|..|+.||.          . ++.+-.|..|+....
T Consensus        43 ~hC~~CG~PIp----------a-~pG~~~Cp~CQ~~~~   69 (226)
T PRK12495         43 AHCDECGDPIF----------R-HDGQEFCPTCQQPVT   69 (226)
T ss_pred             hhcccccCccc----------C-CCCeeECCCCCCccc
Confidence            56888888876          1 144556777776554


No 132
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=28.34  E-value=34  Score=17.23  Aligned_cols=6  Identities=17%  Similarity=0.163  Sum_probs=2.2

Q ss_pred             CCCCcc
Q psy4437          64 PSGCGV   69 (131)
Q Consensus        64 C~~c~~   69 (131)
                      |..|.+
T Consensus        14 C~~C~~   19 (50)
T cd00029          14 CDVCRK   19 (50)
T ss_pred             hhhcch
Confidence            333333


No 133
>PF05810 NinF:  NinF protein;  InterPro: IPR008712 This family consists of several bacteriophage NinF proteins as well as related sequences from Escherichia coli.
Probab=28.19  E-value=13  Score=20.24  Aligned_cols=19  Identities=26%  Similarity=0.602  Sum_probs=10.6

Q ss_pred             CCCCccccCCCCccccccC
Q psy4437          64 PSGCGVGLSSSMLISCAGC   82 (131)
Q Consensus        64 C~~c~~~i~~~~~~~C~~C   82 (131)
                      |.+|++.+.+.+...|..|
T Consensus        20 Ca~C~~~L~~~E~h~Ce~C   38 (58)
T PF05810_consen   20 CANCGQKLHPDETHVCEEC   38 (58)
T ss_pred             HhccCcccccchhhHHHHH
Confidence            5666666655555444444


No 134
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=28.02  E-value=28  Score=18.14  Aligned_cols=8  Identities=13%  Similarity=0.513  Sum_probs=4.5

Q ss_pred             ecccCcCC
Q psy4437          51 FCRNDFFR   58 (131)
Q Consensus        51 ~C~~c~~~   58 (131)
                      +|.+||..
T Consensus        26 lC~~Cf~~   33 (49)
T cd02338          26 LCADCYDS   33 (49)
T ss_pred             cchhHHhC
Confidence            56666643


No 135
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=27.95  E-value=23  Score=18.87  Aligned_cols=6  Identities=50%  Similarity=1.425  Sum_probs=1.5

Q ss_pred             cccccc
Q psy4437         105 RCYDCH  110 (131)
Q Consensus       105 ~C~~C~  110 (131)
                      +|.+|+
T Consensus        23 ~C~~C~   28 (51)
T PF07975_consen   23 RCPKCK   28 (51)
T ss_dssp             --TTTT
T ss_pred             ECCCCC
Confidence            333333


No 136
>PRK14873 primosome assembly protein PriA; Provisional
Probab=27.49  E-value=72  Score=26.42  Aligned_cols=55  Identities=20%  Similarity=0.188  Sum_probs=29.7

Q ss_pred             eeEeecCCccccCCcccCCCcCcCCC----C--cc-CcCCeeecccCcCCCCCCCCCCCccc
Q psy4437          16 FLLNVLERTWHADCVRCYDCHHTLSD----K--CF-SREGKLFCRNDFFRSPVRFPSGCGVG   70 (131)
Q Consensus        16 ~~~~~~~~~~H~~Cf~C~~C~~~l~~----~--~f-~~~~~~~C~~c~~~~~~~~C~~c~~~   70 (131)
                      .++..+++.-...=+.|..|+..+.=    .  .| ..++.+.|.-|-.......|..|+..
T Consensus       370 qvll~lnRrGyap~l~C~~Cg~~~~C~~C~~~L~~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        370 PVLVQVPRRGYVPSLACARCRTPARCRHCTGPLGLPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             cEEEEecCCCCCCeeEhhhCcCeeECCCCCCceeEecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            34444444323333555555554431    1  12 34567888888665556678888764


No 137
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=27.26  E-value=44  Score=24.44  Aligned_cols=26  Identities=23%  Similarity=0.395  Sum_probs=13.1

Q ss_pred             cccccCCcccccceeeeecCCcccccC
Q psy4437          77 ISCAGCEKPILDKFLLNVLERTWHADC  103 (131)
Q Consensus        77 ~~C~~C~~~I~~~~~~~~~~~~~H~~C  103 (131)
                      ..|.+|+.+|.-..+ .-.+..|.|.|
T Consensus       246 epC~~CGt~I~k~~~-~gR~t~~CP~C  271 (273)
T COG0266         246 EPCRRCGTPIEKIKL-GGRSTFYCPVC  271 (273)
T ss_pred             CCCCccCCEeEEEEE-cCCcCEeCCCC
Confidence            445556555544433 44455554444


No 138
>KOG3579|consensus
Probab=27.24  E-value=41  Score=24.83  Aligned_cols=35  Identities=20%  Similarity=0.429  Sum_probs=28.7

Q ss_pred             CCccccccCCcccccceeeeecCCcccccCccccc
Q psy4437          74 SMLISCAGCEKPILDKFLLNVLERTWHADCVRCYD  108 (131)
Q Consensus        74 ~~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~  108 (131)
                      +....|.-|++.+.|...|.--.-.-|+=||-|++
T Consensus       266 ~apLcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSR  300 (352)
T KOG3579|consen  266 SAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSR  300 (352)
T ss_pred             CCceeehhhhhhhccCceeecCCCcccceecccCH
Confidence            34468999999999988777778888999999975


No 139
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=27.20  E-value=35  Score=15.01  Aligned_cols=13  Identities=23%  Similarity=0.595  Sum_probs=9.9

Q ss_pred             ccccccccccccc
Q psy4437         104 VRCYDCHHTLSDK  116 (131)
Q Consensus       104 f~C~~C~~~l~~~  116 (131)
                      |.|..|++.+.+.
T Consensus         2 ~~C~~C~k~f~~~   14 (27)
T PF12171_consen    2 FYCDACDKYFSSE   14 (27)
T ss_dssp             CBBTTTTBBBSSH
T ss_pred             CCcccCCCCcCCH
Confidence            5688888888765


No 140
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=27.10  E-value=21  Score=18.33  Aligned_cols=8  Identities=25%  Similarity=0.546  Sum_probs=4.4

Q ss_pred             eecccCcC
Q psy4437          50 LFCRNDFF   57 (131)
Q Consensus        50 ~~C~~c~~   57 (131)
                      -+|.+||.
T Consensus        29 dLC~~C~~   36 (46)
T PF00569_consen   29 DLCEDCFS   36 (46)
T ss_dssp             EEEHHHHH
T ss_pred             chhhHHHh
Confidence            35666654


No 141
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=27.08  E-value=31  Score=24.66  Aligned_cols=29  Identities=14%  Similarity=0.434  Sum_probs=17.7

Q ss_pred             ccCccccccccccccc-eeccCCeeecCCC
Q psy4437         101 ADCVRCYDCHHTLSDK-CFSREGKLFCRND  129 (131)
Q Consensus       101 ~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~c  129 (131)
                      ++=-.|+.|+.+.... +..+.|...|..|
T Consensus       152 ~~l~~Ca~cg~~~~~~~~s~~~~~~~C~~~  181 (251)
T COG1381         152 PNLTSCARCGTPVDPVYFSPKSGGFLCSKC  181 (251)
T ss_pred             cchHHHhCcCCcCCCcceeeccCcccchhc
Confidence            3334567777777654 5566666666654


No 142
>PHA02929 N1R/p28-like protein; Provisional
Probab=27.08  E-value=32  Score=24.61  Aligned_cols=39  Identities=23%  Similarity=0.572  Sum_probs=25.7

Q ss_pred             cccccCCcccccce-------eeeecCCcccccCc--------ccccccccccc
Q psy4437          77 ISCAGCEKPILDKF-------LLNVLERTWHADCV--------RCYDCHHTLSD  115 (131)
Q Consensus        77 ~~C~~C~~~I~~~~-------~~~~~~~~~H~~Cf--------~C~~C~~~l~~  115 (131)
                      ..|+.|...+.+..       ++..=+..||.+|+        +|..|..++..
T Consensus       175 ~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~~  228 (238)
T PHA02929        175 KECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFIS  228 (238)
T ss_pred             CCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEeeE
Confidence            46777777665432       22334677888887        68888877764


No 143
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=26.79  E-value=27  Score=19.41  Aligned_cols=12  Identities=33%  Similarity=0.609  Sum_probs=6.9

Q ss_pred             CCccccCCcccc
Q psy4437           2 LISCAGCEKPIL   13 (131)
Q Consensus         2 ~~~C~~C~~~I~   13 (131)
                      +.+|..||++|.
T Consensus         4 PiRCFsCGkvi~   15 (63)
T COG1644           4 PVRCFSCGKVIG   15 (63)
T ss_pred             ceEeecCCCCHH
Confidence            345666666663


No 144
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=26.73  E-value=23  Score=15.08  Aligned_cols=13  Identities=23%  Similarity=0.613  Sum_probs=9.6

Q ss_pred             ccccccccccccc
Q psy4437         104 VRCYDCHHTLSDK  116 (131)
Q Consensus       104 f~C~~C~~~l~~~  116 (131)
                      |.|..|++.+.+.
T Consensus         1 ~~C~~C~~~f~s~   13 (25)
T PF12874_consen    1 FYCDICNKSFSSE   13 (25)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCCCCCCcCCH
Confidence            5688888877765


No 145
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=26.65  E-value=28  Score=28.97  Aligned_cols=81  Identities=25%  Similarity=0.545  Sum_probs=40.6

Q ss_pred             ccccCCccccCceeEeecCCccccCCcccCCCcCcCCCCccCcCCeeecccCcCCCCCCCCCCCccccCCCCccccccCC
Q psy4437           4 SCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDKCFSREGKLFCRNDFFRSPVRFPSGCGVGLSSSMLISCAGCE   83 (131)
Q Consensus         4 ~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f~~~~~~~C~~c~~~~~~~~C~~c~~~i~~~~~~~C~~C~   83 (131)
                      +|..|-+.|.+.     .++.|+-.=..|+.|+-..+-    ....||     .+.        ...+  .+..+|..|.
T Consensus        70 ~C~~Cl~E~~dp-----~~Rry~YpF~nCt~CGPr~~i----~~~lpy-----dr~--------~t~m--~~f~~C~~C~  125 (711)
T TIGR00143        70 TCSDCLEEMLDK-----NDRRYLYPFISCTHCGPRFTI----IEALPY-----DRE--------NTSM--ADFPLCPDCA  125 (711)
T ss_pred             hHHHHHHHhcCC-----CcccccCCcccccCCCCCeEE----eecCCC-----CCC--------CcCC--CCCcCCHHHH
Confidence            456666655443     356666666677777654332    111111     000        0011  2234566665


Q ss_pred             cccccceeeeecCCcccccCcccccccccc
Q psy4437          84 KPILDKFLLNVLERTWHADCVRCYDCHHTL  113 (131)
Q Consensus        84 ~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l  113 (131)
                      +...     ...++.||-.=-.|..|+-.|
T Consensus       126 ~ey~-----~p~~rr~h~~~~~C~~Cgp~l  150 (711)
T TIGR00143       126 KEYK-----DPLDRRFHAQPIACPRCGPQL  150 (711)
T ss_pred             HHhc-----CCccccCCCCCccCCCCCcEE
Confidence            5432     224567777767777776655


No 146
>PRK04023 DNA polymerase II large subunit; Validated
Probab=26.63  E-value=98  Score=27.12  Aligned_cols=21  Identities=19%  Similarity=0.028  Sum_probs=10.1

Q ss_pred             eecccCcCCCCCCCCCCCccc
Q psy4437          50 LFCRNDFFRSPVRFPSGCGVG   70 (131)
Q Consensus        50 ~~C~~c~~~~~~~~C~~c~~~   70 (131)
                      .+|..|-...+..+|..|+..
T Consensus       627 RfCpsCG~~t~~frCP~CG~~  647 (1121)
T PRK04023        627 RKCPSCGKETFYRRCPFCGTH  647 (1121)
T ss_pred             ccCCCCCCcCCcccCCCCCCC
Confidence            345555444444455555543


No 147
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=25.54  E-value=45  Score=17.58  Aligned_cols=12  Identities=17%  Similarity=0.711  Sum_probs=4.4

Q ss_pred             CcCCeeecccCc
Q psy4437          45 SREGKLFCRNDF   56 (131)
Q Consensus        45 ~~~~~~~C~~c~   56 (131)
                      +..|.+-|.++|
T Consensus        11 ~~k~Li~C~dHY   22 (50)
T PF03854_consen   11 ANKGLIKCSDHY   22 (50)
T ss_dssp             --SSEEE-SS-E
T ss_pred             cCCCeeeecchh
Confidence            445555555555


No 148
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=24.69  E-value=58  Score=21.95  Aligned_cols=23  Identities=22%  Similarity=0.398  Sum_probs=14.5

Q ss_pred             CCCCCccccCCCCccccccCCcc
Q psy4437          63 FPSGCGVGLSSSMLISCAGCEKP   85 (131)
Q Consensus        63 ~C~~c~~~i~~~~~~~C~~C~~~   85 (131)
                      +|..|+-...+.....|+.|+.|
T Consensus       136 vC~vCGy~~~ge~P~~CPiCga~  158 (166)
T COG1592         136 VCPVCGYTHEGEAPEVCPICGAP  158 (166)
T ss_pred             EcCCCCCcccCCCCCcCCCCCCh
Confidence            56666666655555677777654


No 149
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.45  E-value=98  Score=24.61  Aligned_cols=54  Identities=22%  Similarity=0.349  Sum_probs=29.2

Q ss_pred             eEeecCCccccCCcccCCCcCcCCC------Ccc-CcCCeeecccCcCC-CCCCCCCCCccc
Q psy4437          17 LLNVLERTWHADCVRCYDCHHTLSD------KCF-SREGKLFCRNDFFR-SPVRFPSGCGVG   70 (131)
Q Consensus        17 ~~~~~~~~~H~~Cf~C~~C~~~l~~------~~f-~~~~~~~C~~c~~~-~~~~~C~~c~~~   70 (131)
                      ++.+.++.-...-..|..|+..+.=      -.| ..++.+.|..|-.. .....|..|+..
T Consensus       201 vLvflnrrGya~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       201 SILFLNRRGYSKNLLCRSCGYILCCPNCDVSLTYHKKEGKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             EEEEEeCCcCCCeeEhhhCcCccCCCCCCCceEEecCCCeEEcCCCcCcCCCCCCCCCCCCC
Confidence            4434443322233555555555431      122 45678889888554 345678888764


No 150
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=24.31  E-value=72  Score=17.44  Aligned_cols=28  Identities=21%  Similarity=0.338  Sum_probs=13.4

Q ss_pred             CCCCCCCccccCCCCc--cccccCCccccc
Q psy4437          61 VRFPSGCGVGLSSSML--ISCAGCEKPILD   88 (131)
Q Consensus        61 ~~~C~~c~~~i~~~~~--~~C~~C~~~I~~   88 (131)
                      .+.|..|++-|=..+.  ..|..|+.++..
T Consensus        18 ~~NCl~CGkIiC~~Eg~~~pC~fCg~~l~~   47 (57)
T PF06221_consen   18 APNCLNCGKIICEQEGPLGPCPFCGTPLLS   47 (57)
T ss_pred             cccccccChhhcccccCcCcCCCCCCcccC
Confidence            4455555554432222  356666655543


No 151
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=24.06  E-value=41  Score=17.28  Aligned_cols=7  Identities=29%  Similarity=0.548  Sum_probs=3.4

Q ss_pred             ecccCcC
Q psy4437          51 FCRNDFF   57 (131)
Q Consensus        51 ~C~~c~~   57 (131)
                      +|+.||.
T Consensus        26 LC~~C~~   32 (43)
T cd02342          26 LCTICFS   32 (43)
T ss_pred             cHHHHhh
Confidence            4555543


No 152
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=23.93  E-value=26  Score=17.95  Aligned_cols=19  Identities=26%  Similarity=0.927  Sum_probs=9.1

Q ss_pred             ccccccccccceeccCCeeecC
Q psy4437         106 CYDCHHTLSDKCFSREGKLFCR  127 (131)
Q Consensus       106 C~~C~~~l~~~~~~~~g~~~C~  127 (131)
                      |..|.+.+..   ..++.+||.
T Consensus         9 C~~Cdk~~~~---~~~~~lYCS   27 (43)
T PF12855_consen    9 CIVCDKQIDP---PDDGSLYCS   27 (43)
T ss_pred             HHHhhccccC---CCCCccccC
Confidence            3445555532   334556663


No 153
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=23.92  E-value=53  Score=15.05  Aligned_cols=12  Identities=17%  Similarity=0.570  Sum_probs=6.5

Q ss_pred             cccCCCcCcCCC
Q psy4437          30 VRCYDCHHTLSD   41 (131)
Q Consensus        30 f~C~~C~~~l~~   41 (131)
                      |.|..|++.+.+
T Consensus         1 ~~C~~C~~~~~~   12 (30)
T PF03107_consen    1 FWCDVCRRKIDG   12 (30)
T ss_pred             CCCCCCCCCcCC
Confidence            345566555544


No 154
>smart00214 VWC von Willebrand factor (vWF) type C domain.
Probab=23.61  E-value=50  Score=17.69  Aligned_cols=14  Identities=36%  Similarity=0.795  Sum_probs=10.8

Q ss_pred             eecCCccccc-Cccc
Q psy4437          93 NVLERTWHAD-CVRC  106 (131)
Q Consensus        93 ~~~~~~~H~~-Cf~C  106 (131)
                      ...|..|+++ |..|
T Consensus         8 y~~G~~W~~~~C~~C   22 (59)
T smart00214        8 YNDGETWKPDPCQIC   22 (59)
T ss_pred             eCCCCEECCCCCeEC
Confidence            5678899998 6665


No 155
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=23.31  E-value=60  Score=18.02  Aligned_cols=13  Identities=31%  Similarity=0.437  Sum_probs=9.2

Q ss_pred             eeccCCeeecCCC
Q psy4437         117 CFSREGKLFCRND  129 (131)
Q Consensus       117 ~~~~~g~~~C~~c  129 (131)
                      +...+|.++|.+|
T Consensus        47 ~~i~eg~L~Cp~c   59 (68)
T PF03966_consen   47 VEIVEGELICPEC   59 (68)
T ss_dssp             EETTTTEEEETTT
T ss_pred             ccccCCEEEcCCC
Confidence            3456788888776


No 156
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=22.95  E-value=25  Score=23.87  Aligned_cols=11  Identities=36%  Similarity=0.854  Sum_probs=6.9

Q ss_pred             cccCCCcCcCC
Q psy4437          30 VRCYDCHHTLS   40 (131)
Q Consensus        30 f~C~~C~~~l~   40 (131)
                      |.|..|+.+|.
T Consensus       137 F~Cp~Cg~~L~  147 (178)
T PRK06266        137 FRCPQCGEMLE  147 (178)
T ss_pred             CcCCCCCCCCe
Confidence            66666666664


No 157
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=22.89  E-value=52  Score=22.36  Aligned_cols=31  Identities=29%  Similarity=0.562  Sum_probs=19.3

Q ss_pred             ccCccccccccccccc-eeccCCeeecCCCCC
Q psy4437         101 ADCVRCYDCHHTLSDK-CFSREGKLFCRNDFF  131 (131)
Q Consensus       101 ~~Cf~C~~C~~~l~~~-~~~~~g~~~C~~cy~  131 (131)
                      ..|+.|..=....+.. ++-.|-+++|..|+|
T Consensus       137 ~kC~QC~~~~~~~~~~~~~~F~~~lFC~~ClF  168 (173)
T PF11077_consen  137 DKCVQCSQKCENVGAKIFTYFNFNLFCKNCLF  168 (173)
T ss_pred             cccCcCCCCcccccceeEEecChhhcccccCc
Confidence            3455554432333333 566899999999986


No 158
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=22.41  E-value=88  Score=14.90  Aligned_cols=11  Identities=9%  Similarity=0.042  Sum_probs=5.5

Q ss_pred             ccCCeeecCCC
Q psy4437         119 SREGKLFCRND  129 (131)
Q Consensus       119 ~~~g~~~C~~c  129 (131)
                      ..++..+|..|
T Consensus        17 ~~~~~~~C~~C   27 (33)
T PF08792_consen   17 KEDDYEVCIFC   27 (33)
T ss_pred             ecCCeEEcccC
Confidence            44555555544


No 159
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=22.32  E-value=31  Score=18.45  Aligned_cols=11  Identities=36%  Similarity=0.993  Sum_probs=5.2

Q ss_pred             cccCCCcCcCC
Q psy4437          30 VRCYDCHHTLS   40 (131)
Q Consensus        30 f~C~~C~~~l~   40 (131)
                      ++|..|++.|.
T Consensus         5 iRC~~CnklLa   15 (51)
T PF10122_consen    5 IRCGHCNKLLA   15 (51)
T ss_pred             eeccchhHHHh
Confidence            34455554443


No 160
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=22.32  E-value=60  Score=17.49  Aligned_cols=10  Identities=30%  Similarity=0.650  Sum_probs=4.7

Q ss_pred             ccccCCcccc
Q psy4437          78 SCAGCEKPIL   87 (131)
Q Consensus        78 ~C~~C~~~I~   87 (131)
                      .|.-|+..|.
T Consensus         5 ~C~f~g~~I~   14 (54)
T cd00472           5 KCSFCGYKIY   14 (54)
T ss_pred             EecCcCCeec
Confidence            3444444444


No 161
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=22.16  E-value=39  Score=21.24  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=5.0

Q ss_pred             ccccCCccccc
Q psy4437          78 SCAGCEKPILD   88 (131)
Q Consensus        78 ~C~~C~~~I~~   88 (131)
                      .|+.|+..|.+
T Consensus        14 ~C~~C~t~i~G   24 (113)
T PF09862_consen   14 KCPSCGTEIEG   24 (113)
T ss_pred             EcCCCCCEEEe
Confidence            34444444443


No 162
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=22.12  E-value=40  Score=18.42  Aligned_cols=13  Identities=38%  Similarity=0.905  Sum_probs=6.5

Q ss_pred             CCCccccCCcccc
Q psy4437           1 MLISCAGCEKPIL   13 (131)
Q Consensus         1 ~~~~C~~C~~~I~   13 (131)
                      |...|..|++++.
T Consensus         1 m~v~CP~C~k~~~   13 (57)
T PF03884_consen    1 MTVKCPICGKPVE   13 (57)
T ss_dssp             -EEE-TTT--EEE
T ss_pred             CcccCCCCCCeec
Confidence            6677888887763


No 163
>KOG2932|consensus
Probab=21.99  E-value=45  Score=24.96  Aligned_cols=41  Identities=12%  Similarity=0.185  Sum_probs=24.2

Q ss_pred             ccCCCcCcCCCC-ccCcCCeeecccCcCCCCCCCCCCCcccc
Q psy4437          31 RCYDCHHTLSDK-CFSREGKLFCRNDFFRSPVRFPSGCGVGL   71 (131)
Q Consensus        31 ~C~~C~~~l~~~-~f~~~~~~~C~~c~~~~~~~~C~~c~~~i   71 (131)
                      -|..|+.++.-- ...-=+.+||.+|........|..|...+
T Consensus        92 fCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~V  133 (389)
T KOG2932|consen   92 FCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRV  133 (389)
T ss_pred             eecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHH
Confidence            467777776531 11223456788887665555666666544


No 164
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=21.80  E-value=58  Score=19.62  Aligned_cols=12  Identities=17%  Similarity=0.661  Sum_probs=7.6

Q ss_pred             cccCCCcCcCCC
Q psy4437          30 VRCYDCHHTLSD   41 (131)
Q Consensus        30 f~C~~C~~~l~~   41 (131)
                      |+|+.|+...++
T Consensus         6 F~C~~C~~~W~S   17 (98)
T PF13695_consen    6 FQCSKCSRGWTS   17 (98)
T ss_pred             EECCCCCCCCcc
Confidence            666667666655


No 165
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=21.52  E-value=1.1e+02  Score=15.54  Aligned_cols=7  Identities=29%  Similarity=0.942  Sum_probs=3.0

Q ss_pred             cccCCcc
Q psy4437           5 CAGCEKP   11 (131)
Q Consensus         5 C~~C~~~   11 (131)
                      |..|+..
T Consensus         3 Cp~Cg~~    9 (52)
T smart00661        3 CPKCGNM    9 (52)
T ss_pred             CCCCCCc
Confidence            4444443


No 166
>KOG2114|consensus
Probab=21.15  E-value=42  Score=28.54  Aligned_cols=36  Identities=25%  Similarity=0.698  Sum_probs=19.1

Q ss_pred             CccccCCccccCceeEeec-CCccccCCcc-----cCCCcCcC
Q psy4437           3 ISCAGCEKPILDKFLLNVL-ERTWHADCVR-----CYDCHHTL   39 (131)
Q Consensus         3 ~~C~~C~~~I~~~~~~~~~-~~~~H~~Cf~-----C~~C~~~l   39 (131)
                      .+|..|..++.-. .|..+ +-.||..||.     |..|...+
T Consensus       841 skCs~C~~~LdlP-~VhF~CgHsyHqhC~e~~~~~CP~C~~e~  882 (933)
T KOG2114|consen  841 SKCSACEGTLDLP-FVHFLCGHSYHQHCLEDKEDKCPKCLPEL  882 (933)
T ss_pred             eeecccCCccccc-eeeeecccHHHHHhhccCcccCCccchhh
Confidence            4566666665333 23333 5666666665     55554433


No 167
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=21.11  E-value=75  Score=19.56  Aligned_cols=13  Identities=23%  Similarity=0.639  Sum_probs=8.9

Q ss_pred             eeccCCeeecCCC
Q psy4437         117 CFSREGKLFCRND  129 (131)
Q Consensus       117 ~~~~~g~~~C~~c  129 (131)
                      |+..++++.|..|
T Consensus        46 Y~q~g~~lvC~~C   58 (102)
T PF10080_consen   46 YYQEGDQLVCKNC   58 (102)
T ss_pred             eEEECCEEEEecC
Confidence            6666777777665


No 168
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.95  E-value=1.1e+02  Score=19.67  Aligned_cols=11  Identities=27%  Similarity=0.649  Sum_probs=5.0

Q ss_pred             cccCCccccCc
Q psy4437           5 CAGCEKPILDK   15 (131)
Q Consensus         5 C~~C~~~I~~~   15 (131)
                      |..|+-+|.+.
T Consensus        42 cp~csasirgd   52 (160)
T COG4306          42 CPICSASIRGD   52 (160)
T ss_pred             CCccCCccccc
Confidence            44444444443


No 169
>PF02085 Cytochrom_CIII:  Class III cytochrome C family;  InterPro: IPR020942 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes []. Ambler [] recognised four classes of cytC. Class III comprises the low redox potential multiple haem cytochromes: cyt C7 (trihaem), C3 (tetrahaem), and high-molecular-weight cytC, HMC (hexadecahaem), with only 30-40 residues per haem group. The haem c groups, all bis-histidinyl coordinated, are structurally and functionally nonequivalent and present different redox potentials in the range 0 to -400 mV []. The 3D structures of a number of cyt C3 proteins have been determined. The proteins consist of 4-5 alpha-helices and 2 beta-strands wrapped around a compact core of four non-parallel haems, which present a relatively high degree of exposure to the solvent. The overall protein architecture, haem plane orientations and iron-iron distances are highly conserved [].; GO: 0009055 electron carrier activity, 0020037 heme binding; PDB: 1AQE_A 1CZJ_A 1H29_B 1GWS_A 2CVC_A 2KMY_A 1DUW_A 1UPD_A 1I77_A 1GMB_A ....
Probab=20.33  E-value=19  Score=21.73  Aligned_cols=8  Identities=13%  Similarity=0.621  Sum_probs=4.5

Q ss_pred             ecCCcccc
Q psy4437          94 VLERTWHA  101 (131)
Q Consensus        94 ~~~~~~H~  101 (131)
                      .....||.
T Consensus        65 ~~~~a~H~   72 (102)
T PF02085_consen   65 SFKKAFHQ   72 (102)
T ss_dssp             BHHHHHHH
T ss_pred             hHHHHhcC
Confidence            33556666


No 170
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=20.31  E-value=70  Score=20.62  Aligned_cols=24  Identities=13%  Similarity=0.133  Sum_probs=15.6

Q ss_pred             CccccCCccccCc---eeEeecCCccc
Q psy4437           3 ISCAGCEKPILDK---FLLNVLERTWH   26 (131)
Q Consensus         3 ~~C~~C~~~I~~~---~~~~~~~~~~H   26 (131)
                      .+|..|+..|..+   ..|...|+.|+
T Consensus         5 e~CsFcG~kIyPG~G~~fVR~DGkvf~   31 (131)
T PRK14891          5 RTCDYTGEEIEPGTGTMFVRKDGTVLH   31 (131)
T ss_pred             eeecCcCCcccCCCCcEEEecCCCEEE
Confidence            3588999999643   33555666664


No 171
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=20.26  E-value=62  Score=25.66  Aligned_cols=36  Identities=19%  Similarity=0.391  Sum_probs=21.2

Q ss_pred             cccCCccccCceeEeecCCccccCCcccCCCcCcCCC
Q psy4437           5 CAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSD   41 (131)
Q Consensus         5 C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~   41 (131)
                      |..|-..+...+ +...+..=..+||.|-.|...|..
T Consensus        29 Cp~CL~~~p~~e-~~~~~nrC~r~Cf~CP~C~~~L~~   64 (483)
T PF05502_consen   29 CPNCLFEVPSSE-ARSEKNRCSRNCFDCPICFSPLSV   64 (483)
T ss_pred             CccccccCChhh-heeccceeccccccCCCCCCccee
Confidence            455555554443 223334445588888888888865


No 172
>KOG2893|consensus
Probab=20.24  E-value=31  Score=24.80  Aligned_cols=36  Identities=25%  Similarity=0.450  Sum_probs=19.8

Q ss_pred             ccccCCcccccceeeeecCCcccccCccccccccccccc
Q psy4437          78 SCAGCEKPILDKFLLNVLERTWHADCVRCYDCHHTLSDK  116 (131)
Q Consensus        78 ~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~  116 (131)
                      -|.-|++...+..++....+   ..+|+|..|.+.|-++
T Consensus        12 wcwycnrefddekiliqhqk---akhfkchichkkl~sg   47 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK---AKHFKCHICHKKLFSG   47 (341)
T ss_pred             eeeecccccchhhhhhhhhh---hccceeeeehhhhccC
Confidence            34555555555444333222   3468888888777544


No 173
>PHA00626 hypothetical protein
Probab=20.09  E-value=1e+02  Score=16.82  Aligned_cols=36  Identities=28%  Similarity=0.476  Sum_probs=21.6

Q ss_pred             ccccCCcc-ccCceeEeecCCccccCCcccCCCcCcCCCCcc
Q psy4437           4 SCAGCEKP-ILDKFLLNVLERTWHADCVRCYDCHHTLSDKCF   44 (131)
Q Consensus         4 ~C~~C~~~-I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f   44 (131)
                      .|..|+.. |.-...+.-     +..=++|..|+-..+...|
T Consensus         2 ~CP~CGS~~Ivrcg~cr~-----~snrYkCkdCGY~ft~~~~   38 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRG-----WSDDYVCCDCGYNDSKDAF   38 (59)
T ss_pred             CCCCCCCceeeeeceecc-----cCcceEcCCCCCeechhhh
Confidence            57888873 532222222     2334789999888876666


No 174
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=20.05  E-value=43  Score=15.70  Aligned_cols=6  Identities=33%  Similarity=1.149  Sum_probs=2.4

Q ss_pred             ccccCC
Q psy4437          78 SCAGCE   83 (131)
Q Consensus        78 ~C~~C~   83 (131)
                      +|+.|+
T Consensus        21 vCp~C~   26 (30)
T PF08274_consen   21 VCPECG   26 (30)
T ss_dssp             EETTTT
T ss_pred             eCCccc
Confidence            344443


Done!