Diaphorina citri psyllid: psy4479


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSIFRRHLSLASSLFRKYDLDYSKVPKIDEKDIQERFVRGSGPGGQAVAKTNNCVVLTHIPTGIVIKCHQSRSLSENRKTARELLVAQWDVQVNGEDSLNAQIRRIDEKRRATQEQKKRKLDALKKAWKEREGIE
cccccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
***FRRHLSLASSLFRKYDLDYSKVPKIDEKDIQERFVRGSGPGGQAVAKTNNCVVLTHIPTGIVIKCHQS*********ARELLVAQWDVQVN*****************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFRRHLSLASSLFRKYDLDYSKVPKIDEKDIQERFVRGSGPGGQAVAKTNNCVVLTHIPTGIVIKCHQSRSLSENRKTARELLVAQWDVQVNGxxxxxxxxxxxxxxxxxxxxxKKRKLDALKKAWKEREGIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable peptide chain release factor C12orf65 homolog, mitochondrial May act as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion.confidentA5WUX7
Probable peptide chain release factor C12orf65, mitochondrial May act as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion.confidentQ9H3J6
Probable peptide chain release factor C12orf65 homolog, mitochondrial May act as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion.confidentQ80VP5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003747 [MF]translation release factor activityprobableGO:0008079, GO:0097159, GO:0008135, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RSM, chain A
Confidence level:very confident
Coverage over the Query: 7-98
View the alignment between query and template
View the model in PyMOL
Template: 4DH9, chain Y
Confidence level:very confident
Coverage over the Query: 20-119
View the alignment between query and template
View the model in PyMOL