RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy4489
         (72 letters)



>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin
          and related domains.  Amphiphysins function primarily
          in endocytosis and other membrane remodeling events.
          They exist in several isoforms and mammals possess two
          amphiphysin proteins from distinct genes. Amphiphysin I
          proteins, enriched in the brain and nervous system,
          contain domains that bind clathrin, Adaptor Protein
          complex 2 (AP2), dynamin, and synaptojanin. They
          function in synaptic vesicle endocytosis. Human
          autoantibodies to amphiphysin I hinder GABAergic
          signaling and contribute to the pathogenesis of
          paraneoplastic stiff-person syndrome. Some amphiphysin
          II isoforms, also called Bridging integrator 1 (Bin1),
          are localized in many different tissues and may
          function in intracellular vesicle trafficking. In
          skeletal muscle, Bin1 plays a role in the organization
          and maintenance of the T-tubule network. Mutations in
          Bin1 are associated with autosomal recessive
          centronuclear myopathy. Amphiphysins contain an
          N-terminal BAR domain with an additional N-terminal
          amphipathic helix (an N-BAR), a variable central
          domain, and a C-terminal SH3 domain. The SH3 domain of
          amphiphysins bind proline-rich motifs present in
          binding partners such as dynamin, synaptojanin, and
          nsP3. It also belongs to a subset of SH3 domains that
          bind ubiquitin in a site that overlaps with the peptide
          binding site. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 64

 Score = 53.1 bits (128), Expect = 2e-11
 Identities = 18/31 (58%), Positives = 25/31 (80%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDPEEQ 48
          T+ YT ED DEL+F+ G++I V+ +DDPEEQ
Sbjct: 8  THDYTAEDTDELTFEKGDVILVIPFDDPEEQ 38


>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains.  Src homology 3 (SH3)
          domains bind to target proteins through sequences
          containing proline and hydrophobic amino acids.
          Pro-containing polypeptides may bind to SH3 domains in
          2 different binding orientations.
          Length = 56

 Score = 33.7 bits (78), Expect = 7e-04
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y YT +D DELSF  G+II V+E  D  
Sbjct: 9  YDYTAQDPDELSFKKGDIITVLEKSDDG 36


>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
          of Intersectin.  Intersectins (ITSNs) are adaptor
          proteins that function in exo- and endocytosis, actin
          cytoskeletal reorganization, and signal transduction.
          They are essential for initiating clathrin-coated pit
          formation. They bind to many proteins through their
          multidomain structure and facilitate the assembly of
          multimeric complexes. Vertebrates contain two ITSN
          proteins, ITSN1 and ITSN2, which exist in alternatively
          spliced short and long isoforms. The short isoforms
          contain two Eps15 homology domains (EH1 and EH2), a
          coiled-coil region and five SH3 domains (SH3A-E), while
          the long isoforms, in addition, contain RhoGEF (also
          called Dbl-homologous or DH), Pleckstrin homology (PH)
          and C2 domains. ITSN1 and ITSN2 are both widely
          expressed, with variations depending on tissue type and
          stage of development. The fifth SH3 domain (or SH3E) of
          ITSN1 has been shown to bind many protein partners
          including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
          N-WASP, and synaptojanin-1, among others. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 32.8 bits (75), Expect = 0.001
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          + YT ++ DELSF  G+II V+  DDP+
Sbjct: 6  FPYTAQNEDELSFQKGDIINVLSKDDPD 33


>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie,
          If, and similar proteins.  Myosins Ie (MyoIe) and If
          (MyoIf) are nonmuscle, unconventional, long tailed,
          class I myosins containing an N-terminal motor domain
          and a myosin tail with TH1, TH2, and SH3 domains. MyoIe
          interacts with the endocytic proteins, dynamin and
          synaptojanin-1, through its SH3 domain; it may play a
          role in clathrin-dependent endocytosis. In the kidney,
          MyoIe is critical for podocyte function and normal
          glomerular filtration. Mutations in MyoIe is associated
          with focal segmental glomerulosclerosis, a disease
          characterized by massive proteinuria and progression to
          end-stage kidney disease. MyoIf is predominantly
          expressed in the immune system; it plays a role in
          immune cell motility and innate immunity. Mutations in
          MyoIf may be associated with the loss of hearing. The
          MyoIf gene has also been found to be fused to the MLL
          (Mixed lineage leukemia) gene in infant acute myeloid
          leukemias (AML). SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 32.0 bits (73), Expect = 0.003
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYD 43
          Y Y  +D DELSF+ G+II +++ D
Sbjct: 6  YAYDAQDTDELSFNEGDIIEILKED 30


>gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho
          GTPase-activating proteins 32 and 33, and similar
          proteins.  Members of this family contain N-terminal PX
          and Src Homology 3 (SH3) domains, a central Rho GAP
          domain, and C-terminal extensions. RhoGAPs (or ARHGAPs)
          bind to Rho proteins and enhance the hydrolysis rates
          of bound GTP. ARHGAP32 is also called RICS, PX-RICS,
          p250GAP, or p200RhoGAP. It is a Rho GTPase-activating
          protein for Cdc42 and Rac1, and is implicated in the
          regulation of postsynaptic signaling and neurite
          outgrowth. PX-RICS, a variant of RICS that contain PX
          and SH3 domains, is the main isoform expressed during
          neural development. It is involved in neural functions
          including axon and dendrite extension, postnatal
          remodeling, and fine-tuning of neural circuits during
          early brain development. ARHGAP33, also called sorting
          nexin 26 or TCGAP (Tc10/CDC42 GTPase-activating
          protein), is widely expressed in the brain where it is
          involved in regulating the outgrowth of axons and
          dendrites and is regulated by the protein tyrosine
          kinase Fyn. It is translocated to the plasma membrane
          in adipocytes in response to insulin and may be
          involved in the regulation of insulin-stimulated
          glucose transport. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 32.0 bits (73), Expect = 0.003
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 16 YFTYKYTREDVDELSFDVGEIIRVVEYDDPEE 47
          +   +YT +  DELS +VG+I+ V++   PEE
Sbjct: 3  HVIKRYTAQAPDELSLEVGDIVSVIDMPPPEE 34


>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily.  Src Homology 3
          (SH3) domains are protein interaction domains that bind
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. Thus, they
          are referred to as proline-recognition domains (PRDs).
          SH3 domains are less selective and show more diverse
          specificity compared to other PRDs. They have been
          shown to bind peptide sequences that lack the PxxP
          motif; examples include the PxxDY motif of Eps8 and the
          RKxxYxxY sequence in SKAP55. SH3 domain containing
          proteins play versatile and diverse roles in the cell,
          including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies, among others. Many members of this
          superfamily are adaptor proteins that associate with a
          number of protein partners, facilitating complex
          formation and signal transduction.
          Length = 51

 Score = 31.7 bits (73), Expect = 0.003
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y Y  +D DELSF  G+II V+E DD  
Sbjct: 6  YDYEAQDDDELSFKKGDIITVLEKDDDG 33


>gnl|CDD|213015 cd12139, SH3_Bin1, Src Homology 3 domain of Bridging integrator 1
          (Bin1), also called Amphiphysin-2.  Bin1 isoforms are
          localized in many different tissues and may function in
          intracellular vesicle trafficking. It plays a role in
          the organization and maintenance of the T-tubule
          network in skeletal muscle. Mutations in Bin1 are
          associated with autosomal recessive centronuclear
          myopathy. Bin1 contains an N-terminal BAR domain with
          an additional N-terminal amphipathic helix (an N-BAR)
          and a C-terminal SH3 domain. The SH3 domain of Bin1
          forms transient complexes with actin, myosin filaments,
          and CDK5, to facilitate sarcomere organization and
          myofiber maturation. It also binds dynamin and prevents
          its self-assembly. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 72

 Score = 31.8 bits (72), Expect = 0.005
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPEEQVD 50
          + YT  D DEL    G+++ V+ + +PEEQ +
Sbjct: 9  HDYTATDTDELQLKAGDVVLVIPFQNPEEQDE 40


>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain.  SH3 (Src homology 3) domains are
          often indicative of a protein involved in signal
          transduction related to cytoskeletal organisation.
          First described in the Src cytoplasmic tyrosine kinase.
          The structure is a partly opened beta barrel.
          Length = 47

 Score = 31.0 bits (71), Expect = 0.006
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y YT  + DELSF  G+II V+E  D  
Sbjct: 4  YDYTAREPDELSFKKGDIIIVLEKSDDG 31


>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or
          SH3E) of Intersectin-1.  Intersectin-1 (ITSN1) is an
          adaptor protein that functions in exo- and endocytosis,
          actin cytoskeletal reorganization, and signal
          transduction. It plays a role in clathrin-coated pit
          (CCP) formation. It binds to many proteins through its
          multidomain structure and facilitate the assembly of
          multimeric complexes. ITSN1 localizes in membranous
          organelles, CCPs, the Golgi complex, and may be
          involved in the cell membrane trafficking system. It
          exists in alternatively spliced short and long
          isoforms. The short isoform contains two Eps15 homology
          domains (EH1 and EH2), a coiled-coil region and five
          SH3 domains (SH3A-E), while the long isoform, in
          addition, contains RhoGEF (also called Dbl-homologous
          or DH), Pleckstrin homology (PH) and C2 domains. The
          fifth SH3 domain (or SH3E) of ITSN1 has been shown to
          bind many protein partners including SGIP1, Sos1,
          dynamin1/2, CIN85, c-Cbl, SHIP2, N-WASP, and
          synaptojanin-1, among others. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 30.7 bits (69), Expect = 0.011
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y YT ++ DEL+F  G+II V+  +DP+
Sbjct: 7  YDYTAQNDDELAFSKGQIINVLNKEDPD 34


>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
          GRB2-related adaptor protein.  GRAP is a GRB-2 like
          adaptor protein that is highly expressed in lymphoid
          tissues. It acts as a negative regulator of T cell
          receptor (TCR)-induced lymphocyte proliferation by
          downregulating the signaling to the Ras/ERK pathway. It
          has been identified as a regulator of TGFbeta signaling
          in diabetic kidney tubules and may have a role in the
          pathogenesis of the disease. GRAP contains an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. The C-terminal SH3 domains
          (SH3c) of the related proteins, GRB2 and GRAP2, have
          been shown to bind to classical PxxP motif ligands, as
          well as to non-classical motifs. GRB2 SH3c binds Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, while the SH3c of GRAP2 binds to the
          phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 30.2 bits (68), Expect = 0.016
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y ++ ED  +LSF  G+II V++  DP
Sbjct: 6  YDFSAEDPSQLSFRRGDIIEVLDCPDP 32


>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or
          SH3E) of Intersectin-2.  Intersectin-2 (ITSN2) is an
          adaptor protein that functions in exo- and endocytosis,
          actin cytoskeletal reorganization, and signal
          transduction. It plays a role in clathrin-coated pit
          (CCP) formation. It binds to many proteins through its
          multidomain structure and facilitate the assembly of
          multimeric complexes. ITSN2 also functions as a
          specific GEF for Cdc42 activation in epithelial
          morphogenesis, and is required in mitotic spindle
          orientation. It exists in alternatively spliced short
          and long isoforms. The short isoform contains two Eps15
          homology domains (EH1 and EH2), a coiled-coil region
          and five SH3 domains (SH3A-E), while the long isoform,
          in addition, contains RhoGEF (also called
          Dbl-homologous or DH), Pleckstrin homology (PH) and C2
          domains. The fifth SH3 domain (or SH3E) of ITSN2 is
          expected to bind protein partners, similar to ITSN1
          which has been shown to bind many protein partners
          including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
          N-WASP, and synaptojanin-1, among others. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 29.9 bits (67), Expect = 0.020
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y YT  + DELSF  G++I V+  DDP+
Sbjct: 7  YDYTANNEDELSFSKGQLINVLNKDDPD 34


>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive
          eXchange factors.  PIX proteins are Rho guanine
          nucleotide exchange factors (GEFs), which activate
          small GTPases by exchanging bound GDP for free GTP.
          They act as GEFs for both Cdc42 and Rac 1, and have
          been implicated in cell motility, adhesion, neurite
          outgrowth, and cell polarity. Vertebrates contain two
          proteins from the PIX subfamily, alpha-PIX and
          beta-PIX. Alpha-PIX, also called ARHGEF6, is localized
          in dendritic spines where it regulates spine
          morphogenesis. Mutations in the ARHGEF6 gene cause
          X-linked intellectual disability in humans. Beta-PIX
          play roles in regulating neuroendocrine exocytosis,
          focal adhesion maturation, cell migration, synaptic
          vesicle localization, and insulin secretion. PIX
          proteins contain an N-terminal SH3 domain followed by
          RhoGEF (also called Dbl-homologous or DH) and
          Pleckstrin Homology (PH) domains, and a C-terminal
          leucine-zipper domain for dimerization. The SH3 domain
          of PIX binds to an atypical PxxxPR motif in
          p21-activated kinases (PAKs) with high affinity. The
          binding of PAKs to PIX facilitate the localization of
          PAKs to focal complexes and also localizes PAKs to PIX
          targets Cdc43 and Rac, leading to the activation of
          PAKs. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 29.6 bits (67), Expect = 0.022
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 18 TYKYTREDVDELSFDVGEIIRVV 40
           + +   + DELSFD G+II V 
Sbjct: 5  KFNFEGTNEDELSFDKGDIITVT 27


>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or
          SH3B) of Intersectin.  Intersectins (ITSNs) are adaptor
          proteins that function in exo- and endocytosis, actin
          cytoskeletal reorganization, and signal transduction.
          They are essential for initiating clathrin-coated pit
          formation. They bind to many proteins through their
          multidomain structure and facilitate the assembly of
          multimeric complexes. Vertebrates contain two ITSN
          proteins, ITSN1 and ITSN2, which exist in alternatively
          spliced short and long isoforms. The short isoforms
          contain two Eps15 homology domains (EH1 and EH2), a
          coiled-coil region and five SH3 domains (SH3A-E), while
          the long isoforms, in addition, contain RhoGEF (also
          called Dbl-homologous or DH), Pleckstrin homology (PH)
          and C2 domains. ITSN1 and ITSN2 are both widely
          expressed, with variations depending on tissue type and
          stage of development. The second SH3 domain (or SH3B)
          of ITSN1 has been shown to bind WNK and CdGAP. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 29.3 bits (66), Expect = 0.031
 Identities = 9/27 (33%), Positives = 15/27 (55%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDD 44
           Y +  +  + LSF  G+II V+E  +
Sbjct: 5  LYPWRAKKENHLSFAKGDIITVLEQQE 31


>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast
          stimulating factor 1.  OSTF1, also named OSF or SH3P2,
          is a signaling protein containing SH3 and
          ankyrin-repeat domains. It acts through a Src-related
          pathway to enhance the formation of osteoclasts and
          bone resorption. It also acts as a negative regulator
          of cell motility. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 28.8 bits (65), Expect = 0.044
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y Y  +  DELSF+ G+++ + +  DP
Sbjct: 6  YDYEAQHPDELSFEEGDLLYISDKSDP 32


>gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and
          double SH3 domains proteins.  This group is composed of
          FCH and double SH3 domains protein 1 (FCHSD1) and
          FCHSD2. These proteins have a common domain structure
          consisting of an N-terminal F-BAR (FES-CIP4 Homology
          and Bin/Amphiphysin/Rvs), two SH3, and C-terminal
          proline-rich domains. They have only been characterized
          in silico and their functions remain unknown. This
          group also includes the insect protein, nervous wreck,
          which acts as a regulator of synaptic growth signaling.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 28.9 bits (65), Expect = 0.044
 Identities = 11/32 (34%), Positives = 16/32 (50%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDPEEQV 49
           Y Y  +  DEL+   GE + V+E  D +  V
Sbjct: 7  LYSYEAQRPDELTITEGEELEVIEDGDGDGWV 38


>gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated
          Substrate) scaffolding protein family member, Embryonal
          Fyn-associated Substrate.  EFS is also called HEFS,
          CASS3 (Cas scaffolding protein family member 3) or SIN
          (Src-interacting protein). It was identified based on
          interactions with the Src kinases, Fyn and Yes. It
          plays a role in thymocyte development and acts as a
          negative regulator of T cell proliferation. CAS
          proteins function as molecular scaffolds to regulate
          protein complexes that are involved in many cellular
          processes. They share a common domain structure that
          includes an N-terminal SH3 domain, an unstructured
          substrate domain that contains many YxxP motifs, a
          serine-rich four-helix bundle, and a FAT-like
          C-terminal domain. The SH3 domain of CAS proteins binds
          to diverse partners including FAK, FRNK, Pyk2,
          PTP-PEST, DOCK180, among others. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 62

 Score = 28.7 bits (64), Expect = 0.068
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y    E  +ELSF  G+++ V++ +  
Sbjct: 7  YDNAAESPEELSFRRGDVLMVLKREHG 33


>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and
          similar domains.  Bzz1 (or Bzz1p) is a
          WASP/Las17-interacting protein involved in endocytosis
          and trafficking to the vacuole. It physically interacts
          with type I myosins and functions in the early steps of
          endocytosis. Together with other proteins, it induces
          membrane scission in yeast. Bzz1 contains an N-terminal
          F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
          central coiled-coil, and two C-terminal SH3 domains.
          This model represents the first C-terminal SH3 domain.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 28.3 bits (64), Expect = 0.081
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y YT    DE+S   GE + V+E DD
Sbjct: 6  YDYTASGDDEVSISEGEEVTVLEPDD 31


>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
          Growth factor receptor-bound protein 2 (GRB2) and
          related proteins.  This family includes the adaptor
          protein GRB2 and related proteins including Drosophila
          melanogaster Downstream of receptor kinase (DRK),
          Caenorhabditis elegans Sex muscle abnormal protein 5
          (Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
          and similar proteins. Family members contain an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
          signaling molecule that regulates the Ras pathway by
          linking tyrosine kinases to the Ras guanine nucleotide
          releasing protein Sos (son of sevenless), which
          converts Ras to the active GTP-bound state. GRAP2 plays
          an important role in T cell receptor (TCR) signaling by
          promoting the formation of the SLP-76:LAT complex,
          which couples the TCR to the Ras pathway. GRAP acts as
          a negative regulator of T cell receptor (TCR)-induced
          lymphocyte proliferation by downregulating the
          signaling to the Ras/ERK pathway. The C-terminal SH3
          domains (SH3c) of GRB2 and GRAP2 have been shown to
          bind to classical PxxP motif ligands, as well as to
          non-classical motifs. GRB2 SH3c binds Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, while the SH3c of GRAP2 binds to the
          phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 28.0 bits (63), Expect = 0.10
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y +  ++  EL F  G+II V++  DP
Sbjct: 6  YDFNPQEPGELEFRRGDIITVLDSSDP 32


>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity
          signaling protein Sho1p.  Sho1p (or Sho1), also called
          SSU81 (Suppressor of SUA8-1 mutation), is a yeast
          membrane protein that regulates adaptation to high salt
          conditions by activating the HOG (high-osmolarity
          glycerol) pathway. High salt concentrations lead to the
          localization to the membrane of the MAPKK Pbs2, which
          is then activated by the MAPKK Ste11 and in turn,
          activates the MAPK Hog1. Pbs2 is localized to the
          membrane though the interaction of its PxxP motif with
          the SH3 domain of Sho1p. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 28.2 bits (63), Expect = 0.11
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 17 FTYKYTREDVDELSFDVGEIIRVVE 41
          + Y  + +D +ELSF+ GEI+ V +
Sbjct: 6  YPYDASPDDPNELSFEKGEILEVSD 30


>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown
          subfamily of proteins with similarity to Protein kinase
          C and Casein kinase Substrate in Neurons (PACSIN)
          proteins.  PACSINs, also called Synaptic
          dynamin-associated proteins (Syndapins), act as
          regulators of cytoskeletal and membrane dynamics. They
          bind both dynamin and Wiskott-Aldrich syndrome protein
          (WASP), and may provide direct links between the actin
          cytoskeletal machinery through WASP and
          dynamin-dependent endocytosis. Vetebrates harbor three
          isoforms with distinct expression patterns and specific
          functions. PACSINs contain an N-terminal F-BAR domain
          and a C-terminal SH3 domain. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 56

 Score = 27.6 bits (61), Expect = 0.15
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y YT ++ DELSF  GE +  VE +D +
Sbjct: 8  YDYTGQEPDELSFKAGEELLKVEDEDEQ 35


>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of
          CD2-associated protein and similar proteins.  This
          subfamily is composed of the second SH3 domain (SH3B)
          of CD2AP, CIN85 (Cbl-interacting protein of 85 kDa),
          and similar domains. CD2AP and CIN85 are adaptor
          proteins that bind to protein partners and assemble
          complexes that have been implicated in T cell
          activation, kidney function, and apoptosis of neuronal
          cells. They also associate with endocytic proteins,
          actin cytoskeleton components, and other adaptor
          proteins involved in receptor tyrosine kinase (RTK)
          signaling. CD2AP and the main isoform of CIN85 contain
          three SH3 domains, a proline-rich region, and a
          C-terminal coiled-coil domain. All of these domains
          enable CD2AP and CIN85 to bind various protein partners
          and assemble complexes that have been implicated in
          many different functions. SH3B of both proteins have
          been shown to bind to Cbl. In the case of CD2AP, its
          SH3B binds to Cbl at a site distinct from the
          c-Cbl/SH3A binding site. The CIN85 SH3B also binds
          ubiquitin. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 27.3 bits (61), Expect = 0.17
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDPEE 47
           + YT ++ DEL   VG+ I V+   + EE
Sbjct: 5  LFSYTPQNEDELELKVGDTIEVL--GEVEE 32


>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating
          of p53 proteins (ASPP).  The ASPP family of proteins
          bind to important regulators of apoptosis (p53, Bcl-2,
          and RelA) and cell growth (APCL, PP1). They share
          similarity at their C-termini, where they harbor a
          proline-rich region, four ankyrin (ANK) repeats, and an
          SH3 domain. Vertebrates contain three members of the
          family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2
          activate the apoptotic function of the p53 family of
          tumor suppressors (p53, p63, and p73), while iASPP is
          an oncoprotein that specifically inhibits p53-induced
          apoptosis. The expression of ASPP proteins is altered
          in tumors; ASPP1 and ASPP2 are downregulated whereas
          iASPP is upregulated is some cancer types. ASPP
          proteins also bind and regulate protein phosphatase 1
          (PP1), and this binding is competitive with p53
          binding. The SH3 domain and the ANK repeats of ASPP
          contribute to the p53 binding site; they bind to the
          DNA binding domain of p53. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 27.3 bits (61), Expect = 0.18
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 16 YFTYKYTREDVDELSFDVGEIIRVVEYDDPEE 47
          Y  + Y  E+ DELSF  G+ + V+   D +E
Sbjct: 4  YALFDYEAENGDELSFREGDELTVLRKGDDDE 35


>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C
          and Casein kinase Substrate in Neurons (PACSIN)
          proteins.  PACSINs, also called Synaptic
          dynamin-associated proteins (Syndapins), act as
          regulators of cytoskeletal and membrane dynamics. They
          bind both dynamin and Wiskott-Aldrich syndrome protein
          (WASP), and may provide direct links between the actin
          cytoskeletal machinery through WASP and
          dynamin-dependent endocytosis. Vetebrates harbor three
          isoforms with distinct expression patterns and specific
          functions. PACSINs contain an N-terminal F-BAR domain
          and a C-terminal SH3 domain. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 27.4 bits (61), Expect = 0.18
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y  ++ DELSF  G+I+  +E +D
Sbjct: 6  YDYEGQESDELSFKAGDILTKLEEED 31


>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor
          proteins.  Abl interactor (Abi) proteins are adaptor
          proteins serving as binding partners and substrates of
          Abl tyrosine kinases. They are involved in regulating
          actin cytoskeletal reorganization and play important
          roles in membrane-ruffling, endocytosis, cell motility,
          and cell migration. They localize to sites of actin
          polymerization in epithelial adherens junction and
          immune synapses, as well as to the leading edge of
          lamellipodia. Vertebrates contain two Abi proteins,
          Abi1 and Abi2. Abi1 displays a wide expression pattern
          while Abi2 is highly expressed in the eye and brain.
          Abi proteins contain a homeobox homology domain, a
          proline-rich region, and a SH3 domain. The SH3 domain
          of Abi binds to a PxxP motif in Abl. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 52

 Score = 27.3 bits (61), Expect = 0.19
 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 19 YKYTREDVDELSFDVGEIIRVV-EYDD 44
          Y YT +  DELSF  G+II V  + DD
Sbjct: 6  YDYTADKDDELSFQEGDIIYVTKKNDD 32


>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of
          Proline-Serine-Threonine Phosphatase-Interacting
          Protein 1.  PSTPIP1, also called CD2 Binding Protein 1
          (CD2BP1), is mainly expressed in hematopoietic cells.
          It is a binding partner of the cell surface receptor
          CD2 and PTP-PEST, a tyrosine phosphatase which
          functions in cell motility and Rac1 regulation. It also
          plays a role in the activation of the Wiskott-Aldrich
          syndrome protein (WASP), which couples actin
          rearrangement and T cell activation. Mutations in the
          gene encoding PSTPIP1 cause the autoinflammatory
          disorder known as PAPA (pyogenic sterile arthritis,
          pyoderma gangrenosum, and acne) syndrome. PSTPIP1
          contains an N-terminal F-BAR domain, PEST motifs, and a
          C-terminal SH3 domain. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 27.0 bits (60), Expect = 0.22
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y YT ++ DELS   G+++ V+E  +
Sbjct: 6  YDYTAQEDDELSISKGDVVAVIEKGE 31


>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding
          protein Eve-1.  Eve-1, also called SH3
          domain-containing protein 19 (SH3D19) or EEN-binding
          protein (EBP), exists in multiple alternatively spliced
          isoforms. The longest isoform contains five SH3 domain
          in the C-terminal region and seven proline-rich motifs
          in the N-terminal region. It is abundantly expressed in
          skeletal muscle and heart, and may be involved in
          regulating the activity of ADAMs (A disintegrin and
          metalloproteases). Eve-1 interacts with EEN, an
          endophilin involved in endocytosis and may be the
          target of the MLL-EEN fusion protein that is implicated
          in leukemogenesis. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 50

 Score = 27.1 bits (60), Expect = 0.22
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y +T E+ DELSF  G+II  +E  D E
Sbjct: 6  YDFTGENEDELSFKAGDIITELESIDEE 33


>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin
          and related proteins.  This subfamily includes
          cortactin, Abp1 (actin-binding protein 1),
          hematopoietic lineage cell-specific protein 1 (HS1),
          and similar proteins. These proteins are involved in
          regulating actin dynamics through direct or indirect
          interaction with the Arp2/3 complex, which is required
          to initiate actin polymerization. They all contain at
          least one C-terminal SH3 domain. Cortactin and HS1 bind
          Arp2/3 and actin through an N-terminal region that
          contains an acidic domain and several copies of a
          repeat domain found in cortactin and HS1. Abp1 binds
          actin via an N-terminal actin-depolymerizing factor
          (ADF) homology domain. Yeast Abp1 binds Arp2/3 directly
          through two acidic domains. Mammalian Abp1 does not
          directly interact with Arp2/3; instead, it regulates
          actin dynamics indirectly by interacting with dynamin
          and WASP family proteins. The C-terminal region of
          these proteins acts as an adaptor or scaffold that can
          connect membrane trafficking and signaling proteins
          that bind the SH3 domain within the actin network. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 27.3 bits (61), Expect = 0.22
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y   + +E+SF  G+II  +E  D
Sbjct: 6  YDYQAAEDNEISFVEGDIITQIEQID 31


>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and
          similar domains.  Bzz1 (or Bzz1p) is a
          WASP/Las17-interacting protein involved in endocytosis
          and trafficking to the vacuole. It physically interacts
          with type I myosins and functions in the early steps of
          endocytosis. Together with other proteins, it induces
          membrane scission in yeast. Bzz1 contains an N-terminal
          F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
          central coiled-coil, and two C-terminal SH3 domains.
          This model represents the second C-terminal SH3 domain.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 51

 Score = 27.1 bits (60), Expect = 0.24
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y  +  DE+S  VG+ I V+  DD
Sbjct: 6  YDYEAQGDDEISIRVGDRIAVIRGDD 31


>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2.
          Abi2 is highly expressed in the brain and eye. It
          regulates actin cytoskeletal reorganization at adherens
          junctions and dendritic spines, which is important in
          cell morphogenesis, migration, and cognitive function.
          Mice deficient with Abi2 show defects in orientation
          and migration of lens fibers, neuronal migration,
          dendritic spine morphology, as well as deficits in
          learning and memory. Abi proteins are adaptor proteins
          serving as binding partners and substrates of Abl
          tyrosine kinases. They are involved in regulating actin
          cytoskeletal reorganization and play important roles in
          membrane-ruffling, endocytosis, cell motility, and cell
          migration. Abi proteins contain a homeobox homology
          domain, a proline-rich region, and a SH3 domain. The
          SH3 domain of Abi binds to a PxxP motif in Abl. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 61

 Score = 27.3 bits (60), Expect = 0.25
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y YT++  DELSF  G II V++ +D
Sbjct: 9  YDYTKDKEDELSFQEGAIIYVIKKND 34


>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar
          domains.  This subfamily is composed of Saccharomyces
          cerevisiae Bbc1p, also called Mti1p (Myosin tail
          region-interacting protein), and similar proteins.
          Bbc1p interacts with and regulates type I myosins in
          yeast, Myo3p and Myo5p, which are involved in actin
          cytoskeletal reorganization. It also binds and inhibits
          Las17, a WASp family protein that functions as an
          activator of the Arp2/3 complex. Bbc1p contains an
          N-terminal SH3 domain. SH3 domains bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs; they play a role in the
          regulation of enzymes by intramolecular interactions,
          changing the subcellular localization of signal pathway
          components and mediate multiprotein complex assemblies.
          Length = 60

 Score = 26.9 bits (60), Expect = 0.25
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y Y  +  D+L+FDVG++I V E +D +
Sbjct: 8  YPYESDHEDDLNFDVGQLITVTEEEDAD 35


>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding
          protein Eve-1.  Eve-1, also called SH3
          domain-containing protein 19 (SH3D19) or EEN-binding
          protein (EBP), exists in multiple alternatively spliced
          isoforms. The longest isoform contains five SH3 domain
          in the C-terminal region and seven proline-rich motifs
          in the N-terminal region. It is abundantly expressed in
          skeletal muscle and heart, and may be involved in
          regulating the activity of ADAMs (A disintegrin and
          metalloproteases). Eve-1 interacts with EEN, an
          endophilin involved in endocytosis and may be the
          target of the MLL-EEN fusion protein that is implicated
          in leukemogenesis. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 51

 Score = 27.0 bits (60), Expect = 0.26
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          + +  E  DELSF  G++I + EY   E
Sbjct: 6  FDFEGEQEDELSFSEGDVITLKEYVGEE 33


>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan
          Actin-binding protein 1.  Abp1, also called
          drebrin-like protein, is an adaptor protein that
          functions in receptor-mediated endocytosis and vesicle
          trafficking. It contains an N-terminal actin-binding
          module, the actin-depolymerizing factor (ADF) homology
          domain, a helical domain, and a C-terminal SH3 domain.
          Mammalian Abp1, unlike yeast Abp1, does not contain an
          acidic domain that interacts with the Arp2/3 complex.
          It regulates actin dynamics indirectly by interacting
          with dynamin and WASP family proteins. Abp1 deficiency
          causes abnormal organ structure and function of the
          spleen, heart, and lung of mice. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 54

 Score = 27.0 bits (60), Expect = 0.28
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y   D  E+SFD G+II  +E  D
Sbjct: 6  YDYQAADDTEISFDPGDIITDIEQID 31


>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor
          proteins.  This group contains the third SH3 domain of
          Nck, the first SH3 domain of Caenorhabditis elegans
          Ced-2 (Cell death abnormality protein 2), and similar
          domains. Nck adaptor proteins regulate actin
          cytoskeleton dynamics by linking proline-rich effector
          molecules to protein tyrosine kinases and
          phosphorylated signaling intermediates. They contain
          three SH3 domains and a C-terminal SH2 domain. They
          function downstream of the PDGFbeta receptor and are
          involved in Rho GTPase signaling and actin dynamics.
          Vertebrates contain two Nck adaptor proteins: Nck1
          (also called Nckalpha) and Nck2 (also called Nckbeta or
          Growth factor receptor-bound protein 4, Grb4), which
          show partly overlapping functions but also bind
          distinct targets. Their SH3 domains are involved in
          recruiting downstream effector molecules, such as the
          N-WASP/Arp2/3 complex, which when activated induces
          actin polymerization that results in the production of
          pedestals, or protrusions of the plasma membrane. The
          third SH3 domain of Nck appears to prefer ligands with
          a PxAPxR motif. SH3 domains are protein interaction
          domains that usually bind to proline-rich ligands with
          moderate affinity and selectivity, preferentially a
          PxxP motif. Ced-2 is a cell corpse engulfment protein
          that interacts with Ced-5 in a pathway that regulates
          the activation of Ced-10, a Rac small GTPase.
          Length = 56

 Score = 26.9 bits (60), Expect = 0.29
 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVE--YDDPE 46
           Y +T E+ +ELSF+ GE + ++E   DDP+
Sbjct: 5  LYPFTGENDEELSFEKGERLEIIEKPEDDPD 35


>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like
          Rho guanine nucleotide exchange factors.  Members of
          this family contain a SH3 domain followed by RhoGEF
          (also called Dbl-homologous or DH) and Pleckstrin
          Homology (PH) domains. They include the Rho guanine
          nucleotide exchange factors ARHGEF9, ASEF (also called
          ARHGEF4), ASEF2, and similar proteins. GEFs activate
          small GTPases by exchanging bound GDP for free GTP.
          ARHGEF9 specifically activates Cdc42, while both ASEF
          and ASEF2 can activate Rac1 and Cdc42. ARHGEF9 is
          highly expressed in the brain and it interacts with
          gephyrin, a postsynaptic protein associated with GABA
          and glycine receptors. ASEF plays a role in
          angiogenesis and cell migration. ASEF2 is important in
          cell migration and adhesion dynamics. ASEF exists in an
          autoinhibited form and is activated upon binding of the
          tumor suppressor APC (adenomatous polyposis coli),
          leading to the activation of Rac1 or Cdc42. In its
          autoinhibited form, the SH3 domain of ASEF forms an
          extensive interface with the DH and PH domains,
          blocking the Rac binding site. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 26.6 bits (59), Expect = 0.33
 Identities = 8/22 (36%), Positives = 14/22 (63%)

Query: 25 DVDELSFDVGEIIRVVEYDDPE 46
          D +EL F  G++I V++  D +
Sbjct: 12 DPEELGFKAGDVIEVLDMSDKD 33


>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1.
          Abi1, also called e3B1, is a central regulator of actin
          cytoskeletal reorganization through interactions with
          many protein complexes. It is part of WAVE, a
          nucleation-promoting factor complex, that links Rac 1
          activation to actin polymerization causing lamellipodia
          protrusion at the plasma membrane. Abi1 interact with
          formins to promote protrusions at the leading edge of
          motile cells. It also is a target of alpha4 integrin,
          regulating membrane protrusions at sites of integrin
          engagement. Abi proteins are adaptor proteins serving
          as binding partners and substrates of Abl tyrosine
          kinases. They are involved in regulating actin
          cytoskeletal reorganization and play important roles in
          membrane-ruffling, endocytosis, cell motility, and cell
          migration. Abi proteins contain a homeobox homology
          domain, a proline-rich region, and a SH3 domain. The
          SH3 domain of Abi binds to a PxxP motif in Abl. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 59

 Score = 26.9 bits (59), Expect = 0.36
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y+++  DELSF  G II V++ +D
Sbjct: 6  YDYSKDKDDELSFMEGAIIYVIKKND 31


>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and
          double SH3 domains proteins.  This group is composed of
          FCH and double SH3 domains protein 1 (FCHSD1) and
          FCHSD2. These proteins have a common domain structure
          consisting of an N-terminal F-BAR (FES-CIP4 Homology
          and Bin/Amphiphysin/Rvs), two SH3, and C-terminal
          proline-rich domains. They have only been characterized
          in silico and their functions remain unknown. This
          group also includes the insect protein, nervous wreck,
          which acts as a regulator of synaptic growth signaling.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 26.6 bits (59), Expect = 0.42
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y  +  +ELSF  G IIR++  DD
Sbjct: 6  YDYEAQSDEELSFPEGAIIRILRKDD 31


>gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated
          Substrate) scaffolding protein family member 4.  CASS4,
          also called HEPL (HEF1-EFS-p130Cas-like), localizes to
          focal adhesions and plays a role in regulating FAK
          activity, focal adhesion integrity, and cell spreading.
          It is most abundant in blood cells and lung tissue, and
          is also found in high levels in leukemia and ovarian
          cell lines. CAS proteins function as molecular
          scaffolds to regulate protein complexes that are
          involved in many cellular processes. They share a
          common domain structure that includes an N-terminal SH3
          domain, an unstructured substrate domain that contains
          many YxxP motifs, a serine-rich four-helix bundle, and
          a FAT-like C-terminal domain. The SH3 domain of CAS
          proteins binds to diverse partners including FAK, FRNK,
          Pyk2, PTP-PEST, DOCK180, among others. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 57

 Score = 26.4 bits (58), Expect = 0.44
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPEEQ 48
          Y    +  DEL+F  G+I+ V+E + P  +
Sbjct: 7  YDNKADCSDELAFRRGDILTVLEQNVPGSE 36


>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain
          of NADPH oxidase (Nox) Organizing protein 1.  Nox
          Organizing protein 1 (NoxO1) is a critical regulator of
          enzyme kinetics of the nonphagocytic NADPH oxidase
          Nox1, which catalyzes the transfer of electrons from
          NADPH to molecular oxygen to form superoxide. Nox1 is
          expressed in colon, stomach, uterus, prostate, and
          vascular smooth muscle cells. NoxO1 is involved in
          targeting activator subunits (such as NoxA1) to Nox1.
          It is co-localized with Nox1 in the membranes of
          resting cells and directs the subcellular localization
          of Nox1. NoxO1 contains an N-terminal Phox homology
          (PX) domain, tandem SH3 domains (N-SH3 and C-SH3), and
          a C-terminal proline-rich region (PRR). This model
          characterizes the second SH3 domain (or C-SH3) of
          NoxO1. The tandem SH3 domains of NoxO1 interact with
          the PRR of p22phox, which also complexes with Nox1. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 26.1 bits (58), Expect = 0.54
 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 15 LYFTYK-YTREDVDELSFDVGEIIRVVEYDD 44
          LY+  + Y  +  DELS   G ++ V++  D
Sbjct: 1  LYYATRAYEAQKEDELSVPAGVVVEVLQKSD 31


>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of
          GRB2-related adaptor protein 2.  GRAP2 is also called
          GADS (GRB2-related adapter downstream of Shc), GrpL,
          GRB2L, Mona, or GRID (Grb2-related protein with insert
          domain). It is expressed specifically in the
          hematopoietic system. It plays an important role in T
          cell receptor (TCR) signaling by promoting the
          formation of the SLP-76:LAT complex, which couples the
          TCR to the Ras pathway. It also has roles in
          antigen-receptor and tyrosine kinase mediated
          signaling. GRAP2 is unique from other GRB2-like adaptor
          proteins in that it can be regulated by caspase
          cleavage. It contains an N-terminal SH3 domain, a
          central SH2 domain, and a C-terminal SH3 domain. The
          C-terminal SH3 domain of GRAP2 binds to different
          motifs found in substrate peptides including the
          typical PxxP motif in hematopoietic progenitor kinase 1
          (HPK1), the RxxK motif in SLP-76 and HPK1, and the
          RxxxxK motif in phosphatase-like protein HD-PTP. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 26.3 bits (58), Expect = 0.54
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y +   + DEL F+ G++I V++  +P
Sbjct: 6  YDFEALEDDELGFNSGDVIEVLDSSNP 32


>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C
          and Casein kinase Substrate in Neurons 3 (PACSIN3).
          PACSIN 3 or Syndapin III (Synaptic dynamin-associated
          protein III) is expressed ubiquitously and regulates
          glucose uptake in adipocytes through its role in GLUT1
          trafficking. It also modulates the subcellular
          localization and stimulus-specific function of the
          cation channel TRPV4. PACSINs act as regulators of
          cytoskeletal and membrane dynamics. Vetebrates harbor
          three isoforms with distinct expression patterns and
          specific functions. PACSINs contain an N-terminal F-BAR
          domain and a C-terminal SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 56

 Score = 26.1 bits (57), Expect = 0.65
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 19 YKYTREDVDELSFDVG-EIIRVVEYDD 44
          Y YT ++ DELSF  G E++++ E D+
Sbjct: 8  YDYTGQEADELSFKAGEELLKIGEEDE 34


>gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine
          kinase substrate (Tks) proteins.  Tks proteins are Src
          substrates and scaffolding proteins that play important
          roles in the formation of podosomes and invadopodia,
          the dynamic actin-rich structures that are related to
          cell migration and cancer cell invasion. Vertebrates
          contain two Tks proteins, Tks4 (Tyr kinase substrate
          with four SH3 domains) and Tks5 (Tyr kinase substrate
          with five SH3 domains), which display partially
          overlapping but non-redundant functions. Both associate
          with the ADAMs family of transmembrane
          metalloproteases, which function as sheddases and
          mediators of cell and matrix interactions. Tks5
          interacts with N-WASP and Nck, while Tks4 is essential
          for the localization of MT1-MMP (membrane-type 1 matrix
          metalloproteinase) to invadopodia. Tks proteins contain
          an N-terminal Phox homology (PX) domain and four or
          five SH3 domains. This model characterizes the second
          SH3 domain of Tks proteins. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 25.9 bits (57), Expect = 0.71
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVE 41
          T  Y  E+ DE+ F+ G ++ V++
Sbjct: 6  TQAYKAENEDEIGFETGVVVEVIQ 29


>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin.
          Cortactin was originally identified as a substrate of
          Src kinase. It is an actin regulatory protein that
          binds to the Arp2/3 complex and stabilizes branched
          actin filaments. It is involved in cellular processes
          that affect cell motility, adhesion, migration,
          endocytosis, and invasion. It is expressed ubiquitously
          except in hematopoietic cells, where the homolog
          hematopoietic lineage cell-specific 1 (HS1) is
          expressed instead. Cortactin contains an N-terminal
          acidic domain, several copies of a repeat domain found
          in cortactin and HS1, a proline-rich region, and a
          C-terminal SH3 domain. The N-terminal region interacts
          with the Arp2/3 complex and F-actin, and is crucial in
          regulating branched actin assembly. Cortactin also
          serves as a scaffold and provides a bridge to the actin
          cytoskeleton for membrane trafficking and signaling
          proteins that bind to its SH3 domain. Binding partners
          for the SH3 domain of cortactin include dynamin2,
          N-WASp, MIM, FGD1, among others. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 25.5 bits (56), Expect = 0.94
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y   D DE+SFD  +II  +E  D
Sbjct: 6  YDYQAADDDEISFDPDDIITNIEMID 31


>gnl|CDD|216988 pfam02353, CMAS, Mycolic acid cyclopropane synthetase.  This family
           consist of Cyclopropane-fatty-acyl-phospholipid synthase
           or CFA synthase EC:2.1.1.79 this enzyme catalyze the
           reaction: S-adenosyl-L-methionine + phospholipid
           olefinic fatty acid <=> S-adenosyl-L-homocysteine +
           phospholipid cyclopropane fatty acid.
          Length = 273

 Score = 26.5 bits (59), Expect = 0.98
 Identities = 10/37 (27%), Positives = 18/37 (48%)

Query: 19  YKYTREDVDELSFDVGEIIRVVEYDDPEEQVDKIFSL 55
           YK+ R+ V          + + +Y D +E  D+I S+
Sbjct: 98  YKHARQRVAAEGLQRKVEVLLQDYRDFDEPFDRIVSV 134


>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain.  SH3 (Src homology 3)
          domains are often indicative of a protein involved in
          signal transduction related to cytoskeletal
          organisation. First described in the Src cytoplasmic
          tyrosine kinase. The structure is a partly opened beta
          barrel.
          Length = 53

 Score = 25.1 bits (56), Expect = 1.2
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 20 KYTREDVDELSFDVGEIIRVVEYDDPE 46
           Y   D +ELS   G++++V++ DD  
Sbjct: 7  DYVATDPNELSLKKGDVVKVLDKDDNG 33


>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator
          Associated with Focal adhesion kinase and similar
          proteins.  This subfamily is composed of Rho GTPase
          activating proteins (GAPs) with similarity to GRAF.
          Members contain an N-terminal BAR domain, followed by a
          Pleckstrin homology (PH) domain, a Rho GAP domain, and
          a C-terminal SH3 domain. Although vertebrates harbor
          four Rho GAPs in the GRAF subfamily including GRAF,
          GRAF2, GRAF3, and Oligophrenin-1 (OPHN1), only three
          are included in this model. OPHN1 contains the BAR, PH
          and GAP domains, but not the C-terminal SH3 domain.
          GRAF and GRAF2 show GAP activity towards RhoA and
          Cdc42. GRAF influences Rho-mediated cytoskeletal
          rearrangements and binds focal adhesion kinase. GRAF2
          regulates caspase-activated p21-activated protein
          kinase-2. The SH3 domain of GRAF and GRAF2 binds
          PKNbeta, a target of the small GTPase Rho. SH3 domains
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs; they play a
          role in the regulation of enzymes by intramolecular
          interactions, changing the subcellular localization of
          signal pathway components and mediate multiprotein
          complex assemblies.
          Length = 54

 Score = 24.9 bits (55), Expect = 1.3
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 19 YKYTREDVDELSFDVGEII-RVVEYDDP 45
          Y    ED  ELSF+ G+II  V   D+P
Sbjct: 6  YACKAEDESELSFEPGQIITNVQPSDEP 33


>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3
          domain, ankyrin repeat and PH domain containing
          proteins.  ASAPs are Arf GTPase activating proteins
          (GAPs) and they function in regulating cell growth,
          migration, and invasion. They contain an N-terminal BAR
          domain, followed by a Pleckstrin homology (PH) domain,
          an Arf GAP domain, ankyrin (ANK) repeats, and a
          C-terminal SH3 domain. Vertebrates contain at least
          three members, ASAP1, ASAP2, and ASAP3, but some ASAP3
          proteins do not seem to harbor a C-terminal SH3 domain.
          ASAP1 and ASAP2 show GTPase activating protein (GAP)
          activity towards Arf1 and Arf5. They do not show GAP
          activity towards Arf6, but are able to mediate Arf6
          signaling by binding stably to GTP-Arf6. ASAP3 is an
          Arf6-specific GAP. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 25.0 bits (55), Expect = 1.4
 Identities = 11/20 (55%), Positives = 13/20 (65%)

Query: 27 DELSFDVGEIIRVVEYDDPE 46
          DEL+F  GEII V   +D E
Sbjct: 14 DELTFSEGEIIVVTGEEDDE 33


>gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3
          domain-containing proteins 1 and 2.  RUSC1 and RUSC2,
          that were originally characterized in silico. They are
          adaptor proteins consisting of RUN, leucine zipper, and
          SH3 domains. RUSC1, also called NESCA (New molecule
          containing SH3 at the carboxy-terminus), is highly
          expressed in the brain and is translocated to the
          nuclear membrane from the cytoplasm upon stimulation
          with neurotrophin. It plays a role in facilitating
          neurotrophin-dependent neurite outgrowth. It also
          interacts with NEMO (or IKKgamma) and may function in
          NEMO-mediated activation of NF-kB. RUSC2, also called
          Iporin, is expressed ubiquitously with highest amounts
          in the brain and testis. It interacts with the small
          GTPase Rab1 and the Golgi matrix protein GM130, and may
          function in linking GTPases to certain intracellular
          signaling pathways. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 50

 Score = 25.1 bits (55), Expect = 1.4
 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 1/22 (4%)

Query: 24 EDVDELSFDVGEIIRVV-EYDD 44
           D  +LSF  G+I+RV+   DD
Sbjct: 11 TDSGQLSFRKGDILRVIARVDD 32


>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding
          protein Eve-1.  Eve-1, also called SH3
          domain-containing protein 19 (SH3D19) or EEN-binding
          protein (EBP), exists in multiple alternatively spliced
          isoforms. The longest isoform contains five SH3 domain
          in the C-terminal region and seven proline-rich motifs
          in the N-terminal region. It is abundantly expressed in
          skeletal muscle and heart, and may be involved in
          regulating the activity of ADAMs (A disintegrin and
          metalloproteases). Eve-1 interacts with EEN, an
          endophilin involved in endocytosis and may be the
          target of the MLL-EEN fusion protein that is implicated
          in leukemogenesis. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 50

 Score = 25.1 bits (55), Expect = 1.5
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y +T E  ++LSF  G+ I V E+ D E
Sbjct: 6  YDFTGETEEDLSFQRGDRILVTEHLDAE 33


>gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and
          double SH3 domains protein 1.  FCHSD1 has a domain
          structure consisting of an N-terminal F-BAR (FES-CIP4
          Homology and Bin/Amphiphysin/Rvs), two SH3, and
          C-terminal proline-rich domains. It has only been
          characterized in silico and its function is unknown.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 58

 Score = 24.9 bits (54), Expect = 1.5
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPEEQVDKIF 53
          Y YT +  +ELSF  G +IR++     ++ VD  F
Sbjct: 6  YSYTGQSPEELSFPEGALIRLLP--RAQDGVDDGF 38


>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or
          SH3A) of Intersectin-2.  Intersectin-2 (ITSN2) is an
          adaptor protein that functions in exo- and endocytosis,
          actin cytoskeletal reorganization, and signal
          transduction. It plays a role in clathrin-coated pit
          (CCP) formation. It binds to many proteins through its
          multidomain structure and facilitate the assembly of
          multimeric complexes. ITSN2 also functions as a
          specific GEF for Cdc42 activation in epithelial
          morphogenesis, and is required in mitotic spindle
          orientation. It exists in alternatively spliced short
          and long isoforms. The short isoform contains two Eps15
          homology domains (EH1 and EH2), a coiled-coil region
          and five SH3 domains (SH3A-E), while the long isoform,
          in addition, contains RhoGEF (also called
          Dbl-homologous or DH), Pleckstrin homology (PH) and C2
          domains. The first SH3 domain (or SH3A) of ITSN2 is
          expected to bind many protein partners, similar to
          ITSN1 which has been shown to bind Sos1, dynamin1/2,
          CIN85, c-Cbl, PI3K-C2, SHIP2, N-WASP, and CdGAP, among
          others. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 57

 Score = 25.2 bits (55), Expect = 1.5
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 19 YKYTREDVDELSFDVGEIIRVVE 41
          Y +   + DE+SF+ G+II+V E
Sbjct: 8  YPFEARNHDEMSFNAGDIIQVDE 30


>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein,
          Palmitoylated (or MAGUK p55 subfamily member) proteins.
           The MPP/p55 subfamily of MAGUK (membrane-associated
          guanylate kinase) proteins includes at least eight
          vertebrate members (MPP1-7 and CASK), four Drosophila
          proteins (Stardust, Varicose, CASK and Skiff), and
          other similar proteins; they all contain one each of
          the core of three domains characteristic of MAGUK
          proteins: PDZ, SH3, and guanylate kinase (GuK). In
          addition, most members except for MPP1 contain
          N-terminal L27 domains and some also contain a Hook
          (Protein 4.1 Binding) motif in between the SH3 and GuK
          domains. CASK has an additional calmodulin-dependent
          kinase (CaMK)-like domain at the N-terminus. Members of
          this subfamily are scaffolding proteins that play
          important roles in regulating and establishing cell
          polarity, cell adhesion, and synaptic targeting and
          transmission, among others. The GuK domain in MAGUK
          proteins is enzymatically inactive; instead, the domain
          mediates protein-protein interactions and associates
          intramolecularly with the SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 61

 Score = 24.8 bits (55), Expect = 1.6
 Identities = 9/17 (52%), Positives = 13/17 (76%)

Query: 29 LSFDVGEIIRVVEYDDP 45
          LSF  G+I+++V  DDP
Sbjct: 23 LSFKKGDILQIVNQDDP 39


>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox
          subunit of NADPH oxidase and similar domains.  This
          family is composed of the tandem SH3 domains of p47phox
          subunit of NADPH oxidase and Nox Organizing protein 1
          (NoxO1), the four SH3 domains of Tks4 (Tyr kinase
          substrate with four SH3 domains), the five SH3 domains
          of Tks5, the SH3 domain of obscurin, Myosin-I,  and
          similar domains. Most members of this group also
          contain Phox homology (PX) domains, except for obscurin
          and Myosin-I. p47phox and NoxO1 are regulators of the
          phagocytic NADPH oxidase complex (also called Nox2 or
          gp91phox) and nonphagocytic NADPH oxidase Nox1,
          respectively. They play roles in the activation of
          their respective NADPH oxidase, which catalyzes the
          transfer of electrons from NADPH to molecular oxygen to
          form superoxide. Tks proteins are Src substrates and
          scaffolding proteins that play important roles in the
          formation of podosomes and invadopodia, the dynamic
          actin-rich structures that are related to cell
          migration and cancer cell invasion. Obscurin is a giant
          muscle protein that plays important roles in the
          organization and assembly of the myofibril and the
          sarcoplasmic reticulum. Type I myosins (Myosin-I) are
          actin-dependent motors in endocytic actin structures
          and actin patches. They play roles in membrane traffic
          in endocytic and secretory pathways, cell motility, and
          mechanosensing. Myosin-I contains an N-terminal
          actin-activated ATPase, a phospholipid-binding TH1
          (tail homology 1) domain, and a C-terminal extension
          which includes an F-actin-binding TH2 domain, an SH3
          domain, and an acidic peptide that participates in
          activating the Arp2/3complex. The SH3 domain of
          myosin-I is required for myosin-I-induced actin
          polymerization. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 24.9 bits (55), Expect = 1.6
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDP 45
             Y  +  DE+S   GE++ V+E +D 
Sbjct: 5  IADYEAQGDDEISLQEGEVVEVLEKNDS 32


>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of
          GRB2-related adaptor protein 2.  GRAP2 is also called
          GADS (GRB2-related adapter downstream of Shc), GrpL,
          GRB2L, Mona, or GRID (Grb2-related protein with insert
          domain). It is expressed specifically in the
          hematopoietic system. It plays an important role in T
          cell receptor (TCR) signaling by promoting the
          formation of the SLP-76:LAT complex, which couples the
          TCR to the Ras pathway. It also have roles in
          antigen-receptor and tyrosine kinase mediated
          signaling. GRAP2 is unique from other GRB2-like adaptor
          proteins in that it can be regulated by caspase
          cleavage. It contains an N-terminal SH3 domain, a
          central SH2 domain, and a C-terminal SH3 domain. The
          N-terminal SH3 domain of the related protein GRB2 binds
          to Sos and Sos-derived proline-rich peptides. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 52

 Score = 24.8 bits (54), Expect = 1.7
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          + +T    DELSF  G++++++  DD
Sbjct: 6  FDFTASGEDELSFKKGDVLKILSSDD 31


>gnl|CDD|236291 PRK08565, PRK08565, DNA-directed RNA polymerase subunit B;
           Provisional.
          Length = 1103

 Score = 26.1 bits (58), Expect = 1.7
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 9/36 (25%)

Query: 20  KYTREDVD-----ELSFDVGEIIR--VVEYDDPEEQ 48
           K TRE V+     EL+FD  ++++  V+EY D EE+
Sbjct: 571 KLTREHVEKLKKGELTFD--DLVKMGVIEYLDAEEE 604


>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of
          ASPP protein (iASPP).  iASPP, also called
          RelA-associated inhibitor (RAI), is an oncoprotein that
          inhibits the apoptotic transactivation potential of
          p53. It is upregulated in human breast cancers
          expressing wild-type p53, in acute leukemias regardless
          of the p53 mutation status, as well as in ovarian
          cancer where it is associated with poor patient outcome
          and chemoresistance. iASPP is also a binding partner
          and negative regulator of p65RelA, which promotes cell
          proliferation and inhibits apoptosis; p65RelA has the
          opposite effect on cell growth compared to the p53
          family. It contains a proline-rich region, four ankyrin
          (ANK) repeats, and an SH3 domain at its C-terminal
          half. The SH3 domain and the ANK repeats of iASPP
          contribute to the p53 binding site; they bind to the
          DNA binding domain of p53. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 56

 Score = 24.9 bits (54), Expect = 1.9
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 15 LYFTYKYTREDVDELSFDVGEIIRVVEYDDPEE 47
          +Y  + Y+ E  DELSF  G+++ V+  D    
Sbjct: 3  VYALWDYSAEFPDELSFKEGDMVTVLRKDGEGT 35


>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A)
          of Intersectin.  Intersectins (ITSNs) are adaptor
          proteins that function in exo- and endocytosis, actin
          cytoskeletal reorganization, and signal transduction.
          They are essential for initiating clathrin-coated pit
          formation. They bind to many proteins through their
          multidomain structure and facilitate the assembly of
          multimeric complexes. Vertebrates contain two ITSN
          proteins, ITSN1 and ITSN2, which exist in alternatively
          spliced short and long isoforms. The short isoforms
          contain two Eps15 homology domains (EH1 and EH2), a
          coiled-coil region and five SH3 domains (SH3A-E), while
          the long isoforms, in addition, contain RhoGEF (also
          called Dbl-homologous or DH), Pleckstrin homology (PH)
          and C2 domains. ITSN1 and ITSN2 are both widely
          expressed, with variations depending on tissue type and
          stage of development. The first SH3 domain (or SH3A) of
          ITSN1 has been shown to bind many proteins including
          Sos1, dynamin1/2, CIN85, c-Cbl, PI3K-C2, SHIP2, N-WASP,
          and CdGAP, among others. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 24.6 bits (54), Expect = 2.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y +   + DE+SF  G+II+V E    E
Sbjct: 6  YAFEARNPDEISFQPGDIIQVDESQVAE 33


>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage
          cell-specific protein 1.  HS1, also called HCLS1
          (hematopoietic cell-specific Lyn substrate 1), is a
          cortactin homolog expressed specifically in
          hematopoietic cells. It is an actin regulatory protein
          that binds the Arp2/3 complex and stabilizes branched
          actin filaments. It is required for cell spreading and
          signaling in lymphocytes. It regulates cytoskeletal
          remodeling that controls lymphocyte trafficking, and it
          also affects tissue invasion and infiltration of
          leukemic B cells. Like cortactin, HS1 contains an
          N-terminal acidic domain, several copies of a repeat
          domain found in cortactin and HS1, a proline-rich
          region, and a C-terminal SH3 domain. The N-terminal
          region binds the Arp2/3 complex and F-actin, while the
          C-terminal region acts as an adaptor or scaffold that
          can connect varied proteins that bind the SH3 domain
          within the actin network. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 24.8 bits (54), Expect = 2.1
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y Y  E  DE+SFD  E I  +E  D
Sbjct: 7  YDYQGEGDDEISFDPQETITDIEMVD 32


>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal
          endocytic adaptor protein Sla1p.  Sla1p facilitates
          endocytosis by playing a role as an adaptor protein in
          coupling components of the actin cytoskeleton to the
          endocytic machinery. It interacts with Abp1p, Las17p
          and Pan1p, which are activator proteins of
          actin-related protein 2/3 (Arp2/3). Sla1p contains
          multiple domains including three SH3 domains, a SAM
          (sterile alpha motif) domain, and a Sla1 homology
          domain 1 (SHD1), which binds to the NPFXD motif that is
          found in many integral membrane proteins such as the
          Golgi-localized Arf-binding protein Lsb5p and the
          P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 52

 Score = 24.3 bits (53), Expect = 2.2
 Identities = 9/28 (32%), Positives = 17/28 (60%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y Y ++  +ELSF+ G+ + V +  D +
Sbjct: 6  YDYDKQTEEELSFNEGDTLDVYDDSDSD 33


>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of
          CD2-associated protein.  CD2AP, also called CMS (Cas
          ligand with Multiple SH3 domains) or METS1
          (Mesenchyme-to-Epithelium Transition protein with SH3
          domains), is a cytosolic adaptor protein that plays a
          role in regulating the cytoskeleton. It is critical in
          cell-to-cell union necessary for kidney function. It
          also stabilizes the contact between a T cell and
          antigen-presenting cells. It is primarily expressed in
          podocytes at the cytoplasmic face of the slit diaphragm
          and serves as a linker anchoring podocin and nephrin to
          the actin cytoskeleton. CD2AP contains three SH3
          domains, a proline-rich region, and a C-terminal
          coiled-coil domain. All of these domains enable CD2AP
          to bind various protein partners and assemble complexes
          that have been implicated in many different functions.
          This alignment model represents the second SH3 domain
          (SH3B) of CD2AP. SH3B binds to c-Cbl in a site
          (TPSSRPLR is the core binding motif) distinct from the
          c-Cbl/SH3A binding site. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 24.5 bits (53), Expect = 2.2
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 19 YKYTREDVDELSFDVGEIIRVVE 41
          ++Y  ++ DEL   VG+II + E
Sbjct: 7  FEYVPQNEDELELKVGDIIDINE 29


>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor
          protein.  Nck1 (also called Nckalpha) plays a crucial
          role in connecting signaling pathways of tyrosine
          kinase receptors and important effectors in actin
          dynamics and cytoskeletal remodeling. It binds and
          activates RasGAP, resulting in the downregulation of
          Ras. It is also involved in the signaling of
          endothilin-mediated inhibition of cell migration. Nck
          adaptor proteins regulate actin cytoskeleton dynamics
          by linking proline-rich effector molecules to protein
          tyrosine kinases and phosphorylated signaling
          intermediates. They contain three SH3 domains and a
          C-terminal SH2 domain. They function downstream of the
          PDGFbeta receptor and are involved in Rho GTPase
          signaling and actin dynamics. Vertebrates contain two
          Nck adaptor proteins: Nck1 (also called Nckalpha) and
          Nck2, which show partly overlapping functions but also
          bind distinct targets. The third SH3 domain of Nck
          appears to prefer ligands with a PxAPxR motif. SH3
          domains are protein interaction domains that usually
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially a PxxP motif. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 24.6 bits (53), Expect = 2.3
 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 2/30 (6%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEY--DDPE 46
          Y ++  + +EL+F+ GE++ V+E   +DPE
Sbjct: 7  YPFSSSNDEELNFEKGEVMDVIEKPENDPE 36


>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak
          Interactive eXchange factor.  Beta-PIX, also called Rho
          guanine nucleotide exchange factor 7 (ARHGEF7) or Cool
          (Cloned out of Library)-1, activates small GTPases by
          exchanging bound GDP for free GTP. It acts as a GEF for
          both Cdc42 and Rac 1, and plays important roles in
          regulating neuroendocrine exocytosis, focal adhesion
          maturation, cell migration, synaptic vesicle
          localization, and insulin secretion. PIX proteins
          contain an N-terminal SH3 domain followed by RhoGEF
          (also called Dbl-homologous or DH) and Pleckstrin
          Homology (PH) domains, and a C-terminal leucine-zipper
          domain for dimerization. The SH3 domain of PIX binds to
          an atypical PxxxPR motif in p21-activated kinases
          (PAKs) with high affinity. The binding of PAKs to PIX
          facilitate the localization of PAKs to focal complexes
          and also localizes PAKs to PIX targets Cdc43 and Rac,
          leading to the activation of PAKs. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 54

 Score = 24.6 bits (53), Expect = 2.4
 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 17 FTYKYTREDVDELSFDVGEIIRVVEYDD 44
          F ++ T ED  ELSF  G++I V   ++
Sbjct: 6  FNFQQTNED--ELSFSKGDVIHVTRVEE 31


>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated
          Substrate) scaffolding proteins.  CAS proteins function
          as molecular scaffolds to regulate protein complexes
          that are involved in many cellular processes including
          migration, chemotaxis, apoptosis, differentiation, and
          progenitor cell function. They mediate the signaling of
          integrins at focal adhesions where they localize, and
          thus, regulate cell invasion and survival.
          Over-expression of these proteins is implicated in poor
          prognosis, increased metastasis, and resistance to
          chemotherapeutics in many cancers such as breast, lung,
          melanoma, and glioblastoma. CAS proteins have also been
          linked to the pathogenesis of inflammatory disorders,
          Alzheimer's, Parkinson's, and developmental defects.
          They share a common domain structure that includes an
          N-terminal SH3 domain, an unstructured substrate domain
          that contains many YxxP motifs, a serine-rich
          four-helix bundle, and a FAT-like C-terminal domain.
          Vertebrates contain four CAS proteins: BCAR1 (or
          p130Cas), NEDD9 (or HEF1), EFS (or SIN), and CASS4 (or
          HEPL). The SH3 domain of CAS proteins binds to diverse
          partners including FAK, FRNK, Pyk2, PTP-PEST, DOCK180,
          among others. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 24.6 bits (54), Expect = 2.5
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPE 46
          Y    E  DEL+F  G+I+ V+E +   
Sbjct: 6  YDNVAESPDELAFRRGDILTVLEQNTAG 33


>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor
          proteins.  Nck adaptor proteins regulate actin
          cytoskeleton dynamics by linking proline-rich effector
          molecules to protein tyrosine kinases and
          phosphorylated signaling intermediates. They contain
          three SH3 domains and a C-terminal SH2 domain. They
          function downstream of the PDGFbeta receptor and are
          involved in Rho GTPase signaling and actin dynamics.
          Vertebrates contain two Nck adaptor proteins: Nck1
          (also called Nckalpha) and Nck2 (also called Nckbeta or
          Growth factor receptor-bound protein 4, Grb4), which
          show partly overlapping functions but also bind
          distinct targets. Their SH3 domains are involved in
          recruiting downstream effector molecules, such as the
          N-WASP/Arp2/3 complex, which when activated induces
          actin polymerization that results in the production of
          pedestals, or protrusions of the plasma membrane. The
          second SH3 domain of Nck appears to prefer ligands
          containing the APxxPxR motif. SH3 domains are protein
          interaction domains that usually bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially a PxxP motif. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 24.5 bits (54), Expect = 2.6
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 17 FTYKYTREDVDELSFDVGEIIRVVEYDD 44
          F Y+  RED  ELS   G+ + V+E   
Sbjct: 6  FNYEAQRED--ELSLRKGDRVLVLEKSS 31


>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis
          Stimulating of p53 protein 1.  ASPP1, like ASPP2,
          activates the apoptotic function of the p53 family of
          tumor suppressors (p53, p63, and p73). In addition, it
          functions in the cytoplasm to regulate the nuclear
          localization of the transcriptional cofactors YAP and
          TAZ by inihibiting their phosphorylation; YAP and TAZ
          are important regulators of cell expansion,
          differentiation, migration, and invasion. ASPP1 is
          downregulated in breast tumors expressing wild-type
          p53. It contains a proline-rich region, four ankyrin
          (ANK) repeats, and an SH3 domain at its C-terminal
          half. The SH3 domain and the ANK repeats of ASPP1
          contribute to the p53 binding site; they bind to the
          DNA binding domain of p53. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 24.6 bits (53), Expect = 2.6
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 14 LLYFTYKYTREDVDELSFDVGEIIRVVEYDDPEE 47
          ++Y  + Y  ++ DELSF  G+ I ++   D  E
Sbjct: 2  MVYALWDYEAQNADELSFQEGDAITILRRKDDSE 35


>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of
          CD2-associated protein and similar proteins.  This
          subfamily is composed of the third SH3 domain (SH3C) of
          CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
          similar domains. CD2AP and CIN85 are adaptor proteins
          that bind to protein partners and assemble complexes
          that have been implicated in T cell activation, kidney
          function, and apoptosis of neuronal cells. They also
          associate with endocytic proteins, actin cytoskeleton
          components, and other adaptor proteins involved in
          receptor tyrosine kinase (RTK) signaling. CD2AP and the
          main isoform of CIN85 contain three SH3 domains, a
          proline-rich region, and a C-terminal coiled-coil
          domain. All of these domains enable CD2AP and CIN85 to
          bind various protein partners and assemble complexes
          that have been implicated in many different functions.
          SH3C of both proteins have been shown to bind to
          ubiquitin. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 24.2 bits (53), Expect = 2.6
 Identities = 8/29 (27%), Positives = 16/29 (55%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDPE 46
           + Y  E+ DEL+   G+I+ ++  D  +
Sbjct: 5  LFDYEAENEDELTLREGDIVTILSKDCED 33


>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of
          CD2-associated protein.  CD2AP, also called CMS (Cas
          ligand with Multiple SH3 domains) or METS1
          (Mesenchyme-to-Epithelium Transition protein with SH3
          domains), is a cytosolic adaptor protein that plays a
          role in regulating the cytoskeleton. It is critical in
          cell-to-cell union necessary for kidney function. It
          also stabilizes the contact between a T cell and
          antigen-presenting cells. It is primarily expressed in
          podocytes at the cytoplasmic face of the slit diaphragm
          and serves as a linker anchoring podocin and nephrin to
          the actin cytoskeleton. CD2AP contains three SH3
          domains, a proline-rich region, and a C-terminal
          coiled-coil domain. All of these domains enable CD2AP
          to bind various protein partners and assemble complexes
          that have been implicated in many different functions.
          This alignment model represents the third SH3 domain
          (SH3C) of CD2AP. SH3C has been shown to bind ubiquitin.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 24.4 bits (53), Expect = 2.6
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDPE 46
           + Y   + DEL F  GEII ++  D  E
Sbjct: 7  LFHYEGTNEDELDFKEGEIILIISKDTGE 35


>gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3
          domain of the p47phox subunit of NADPH oxidase, also
          called Neutrophil Cytosolic Factor 1.  p47phox, or
          NCF1, is a cytosolic subunit of the phagocytic NADPH
          oxidase complex (also called Nox2 or gp91phox), which
          plays a key role in the ability of phagocytes to defend
          against bacterial infections. NADPH oxidase catalyzes
          the transfer of electrons from NADPH to oxygen during
          phagocytosis forming superoxide and reactive oxygen
          species. p47phox is required for activation of NADH
          oxidase and plays a role in translocation. It contains
          an N-terminal Phox homology (PX) domain, tandem SH3
          domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
          region, and a C-terminal proline-rich region (PRR).
          This model characterizes the second SH3 domain (or
          C-SH3) of p47phox. In its inactive state, the tandem
          SH3 domains interact intramolecularly with the
          autoinhibitory region; upon activation, the tandem SH3
          domains are exposed through a conformational change,
          resulting in their binding to the PRR of p22phox and
          the activation of NADPH oxidase. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 24.4 bits (53), Expect = 2.7
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 15 LYFTYK-YTREDVDELSFDVGEIIRVV 40
          LY T K YT  + DEL+   GE I V+
Sbjct: 1  LYITIKAYTAVEEDELTLLEGEAIEVI 27


>gnl|CDD|212788 cd11854, SH3_Fus1p, Src homology 3 domain of yeast cell fusion
          protein Fus1p.  Fus1p is required at the cell surface
          for cell fusion during the mating response in yeast. It
          requires Bch1p and Bud7p, which are Chs5p-Arf1p binding
          proteins, for localization to the plasma membrane. It
          acts as a scaffold protein to assemble a cell surface
          complex which is involved in septum degradation and
          inhibition of the NOG pathway to promote cell fusion.
          The SH3 domain of Fus1p interacts with Bin1p, a formin
          that controls the assembly of actin cables in response
          to Cdc42 signaling. It has been shown to bind the
          motif, R(S/T)(S/T)SL, instead of PxxP motifs. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity. They play versatile and diverse roles in
          the cell including the regulation of enzymes, changing
          the subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 24.2 bits (53), Expect = 3.2
 Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 1/19 (5%)

Query: 27 DELSFDVGEIIRVV-EYDD 44
          DEL   VGE +RV+ EYDD
Sbjct: 14 DELLIKVGETVRVLAEYDD 32


>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper
          integration site-1 (AHI-1).  AHI-1, also called
          Jouberin, is expressed in high levels in the brain,
          gonad tissues, and skeletal muscle. It is an adaptor
          protein that interacts with the small GTPase Rab8a and
          regulates it distribution and function, affecting
          cilium formation and vesicle transport. Mutations in
          the AHI-1 gene can cause Joubert syndrome, a disorder
          characterized by brainstem malformations, cerebellar
          aplasia/hypoplasia, and retinal dystrophy. AHI-1
          variation is also associated with susceptibility to
          schizophrenia and type 2 diabetes mellitus progression.
          AHI-1 contains WD40 and SH3 domains. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 52

 Score = 24.0 bits (52), Expect = 3.3
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y YT    DEL+   G+IIRV+  D+ 
Sbjct: 6  YDYTANRSDELTIHRGDIIRVLYKDND 32


>gnl|CDD|212793 cd11859, SH3_ZO, Src homology 3 domain of the Tight junction
          proteins, Zonula occludens (ZO) proteins.  ZO proteins
          are scaffolding proteins that associate with each other
          and with other proteins of the tight junction, zonula
          adherens, and gap junctions. They play roles in
          regulating cytoskeletal dynamics at these cell
          junctions. They are considered members of the MAGUK
          (membrane-associated guanylate kinase) protein family,
          which is characterized by the presence of a core of
          three domains: PDZ, SH3, and guanylate kinase (GuK).
          The GuK domain in MAGUK proteins is enzymatically
          inactive; instead, the domain mediates protein-protein
          interactions and associates intramolecularly with the
          SH3 domain. Vertebrates contain three ZO proteins
          (ZO-1, ZO-2, and ZO-3) with redundant and non-redundant
          roles. They contain three PDZ domains, followed by SH3
          and GuK domains; in addition, ZO-1 and ZO-2 contains a
          proline-rich (PR) actin binding domain at the
          C-terminus while ZO-3 contains this PR domain between
          the second and third PDZ domains. The C-terminal
          regions of the three ZO proteins are unique. The SH3
          domain of ZO-1 has been shown to bind ZONAB, ZAK,
          afadin, and Galpha12. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 62

 Score = 24.2 bits (53), Expect = 3.3
 Identities = 9/22 (40%), Positives = 12/22 (54%)

Query: 19 YKYTREDVDELSFDVGEIIRVV 40
          + Y +    ELSF  GE+  VV
Sbjct: 6  FDYEKPAKGELSFKKGEVFHVV 27


>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS
          (Crk-Associated Substrate) scaffolding protein family
          member, Breast Cancer Anti-estrogen Resistance 1.
          BCAR1, also called p130cas or CASS1, is the founding
          member of the CAS family of scaffolding proteins and
          was originally identified through its ability to
          associate with Crk. The name BCAR1 was designated
          because the human gene was identified in a screen for
          genes that promote resistance to tamoxifen. It is
          widely expressed and its deletion is lethal in mice. It
          plays a role in regulating cell motility, survival,
          proliferation, transformation, cancer progression, and
          bacterial pathogenesis. CAS proteins function as
          molecular scaffolds to regulate protein complexes that
          are involved in many cellular processes. They share a
          common domain structure that includes an N-terminal SH3
          domain, an unstructured substrate domain that contains
          many YxxP motifs, a serine-rich four-helix bundle, and
          a FAT-like C-terminal domain. The SH3 domain of CAS
          proteins binds to diverse partners including FAK, FRNK,
          Pyk2, PTP-PEST, DOCK180, among others. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 68

 Score = 24.2 bits (52), Expect = 3.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYD 43
          Y    E  DELSF  G+I+ V+E D
Sbjct: 9  YDNVAESPDELSFRKGDIMTVLERD 33


>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of
          GRB2-related adaptor protein.  GRAP is a GRB-2 like
          adaptor protein that is highly expressed in lymphoid
          tissues. It acts as a negative regulator of T cell
          receptor (TCR)-induced lymphocyte proliferation by
          downregulating the signaling to the Ras/ERK pathway. It
          has been identified as a regulator of TGFbeta signaling
          in diabetic kidney tubules and may have a role in the
          pathogenesis of the disease. GRAP contains an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. The N-terminal SH3 domain of the
          related protein GRB2 binds to Sos and Sos-derived
          proline-rich peptides. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 24.0 bits (52), Expect = 4.3
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y +   + DEL F  G+I++++  +D
Sbjct: 6  YSFQATESDELPFQKGDILKILNMED 31


>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10
          Regulator of Kinase adaptor proteins.  CRK adaptor
          proteins consists of SH2 and SH3 domains, which bind
          tyrosine-phosphorylated peptides and proline-rich
          motifs, respectively. They function downstream of
          protein tyrosine kinases in many signaling pathways
          started by various extracellular signals, including
          growth and differentiation factors. Cellular CRK
          (c-CRK) contains a single SH2 domain, followed by
          N-terminal and C-terminal SH3 domains. It is involved
          in the regulation of many cellular processes including
          cell growth, motility, adhesion, and apoptosis. CRK has
          been implicated in the malignancy of various human
          cancers. The N-terminal SH3 domain of CRK binds a
          number of target proteins including DOCK180, C3G, SOS,
          and cABL. The CRK family includes two alternatively
          spliced protein forms, CRKI and CRKII, that are
          expressed by the CRK gene, and the CRK-like (CRKL)
          protein, which is expressed by a distinct gene (CRKL).
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 23.9 bits (52), Expect = 4.6
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 2/31 (6%)

Query: 18 TYKYTREDVDELSFDVGEIIRVVEYDDPEEQ 48
           + +   D ++L F  GEI+ V+    PEEQ
Sbjct: 6  LFDFPGNDDEDLPFKKGEILTVIR--KPEEQ 34


>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain
          of the Nebulin family of proteins.  Nebulin family
          proteins contain multiple nebulin repeats, and may
          contain an N-terminal LIM domain and/or a C-terminal
          SH3 domain. They have molecular weights ranging from 34
          to 900 kD, depending on the number of nebulin repeats,
          and they all bind actin. They are involved in the
          regulation of actin filament architecture and function
          as stabilizers and scaffolds for cytoskeletal
          structures with which they associate, such as long
          actin filaments or focal adhesions. Nebulin family
          proteins that contain a C-terminal SH3 domain include
          the giant filamentous protein nebulin, nebulette,
          Lasp1, and Lasp2. Lasp2, also called LIM-nebulette, is
          an alternatively spliced variant of nebulette. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 23.8 bits (52), Expect = 4.7
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 19 YKYTREDVDELSFDVGEIIRVVE 41
          Y Y   D DE+SF  G++I  VE
Sbjct: 6  YDYAAADDDEVSFQEGDVIINVE 28


>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing
          Adaptor Molecules.  STAMs were discovered as proteins
          that are highly phosphorylated following cytokine and
          growth factor stimulation. They function in cytokine
          signaling and surface receptor degradation, as well as
          regulate Golgi morphology. They associate with many
          proteins including Jak2 and Jak3 tyrosine kinases, Hrs,
          AMSH, and UBPY. STAM adaptor proteins contain VHS
          (Vps27, Hrs, STAM homology), ubiquitin interacting
          (UIM), and SH3 domains. There are two vertebrate STAMs,
          STAM1 and STAM2, which may be functionally redundant;
          vertebrate STAMs contain ITAM motifs. They are part of
          the endosomal sorting complex required for transport
          (ESCRT-0). STAM2 deficiency in mice did not cause any
          obvious abnormality, while STAM1 deficiency resulted in
          growth retardation. Loss of both STAM1 and STAM2 in
          mice proved lethal, indicating that STAMs are important
          for embryonic development. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 23.6 bits (51), Expect = 4.7
 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 1/22 (4%)

Query: 24 EDVDELSFDVGEIIRVVEYDDP 45
          ED +EL+F  GEII V++  DP
Sbjct: 13 ED-NELTFKAGEIITVLDDSDP 33


>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal
          peroxisomal membrane protein Pex13p.  Pex13p, located
          in the peroxisomal membrane, contains two transmembrane
          regions and a C-terminal SH3 domain. It binds to the
          peroxisomal targeting type I (PTS1) receptor Pex5p and
          the docking factor Pex14p through its SH3 domain. It is
          essential for both PTS1 and PTS2 protein import
          pathways into the peroxisomal matrix. Pex13p binds
          Pex14p, which contains a PxxP motif, in a classical
          fashion to the proline-rich ligand binding site of its
          SH3 domain. It binds the WxxxF/Y motif of Pex5p in a
          novel site that does not compete with Pex14p binding.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 60

 Score = 23.8 bits (52), Expect = 4.8
 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 1/32 (3%)

Query: 18 TYKYT-REDVDELSFDVGEIIRVVEYDDPEEQ 48
           Y +T      ELS   G+I+ V+   DP  +
Sbjct: 5  LYDFTPENPEMELSLKKGDIVAVLSKTDPLGR 36


>gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain
          of Sorbin and SH3 domain containing (Sorbs) proteins
          and similar domains.  This family, also called the
          vinexin family, is composed predominantly of adaptor
          proteins containing one sorbin homology (SoHo) and
          three SH3 domains. Members include the third SH3
          domains of Sorbs1 (or ponsin), Sorbs2 (or ArgBP2),
          Vinexin (or Sorbs3), and similar domains. They are
          involved in the regulation of cytoskeletal
          organization, cell adhesion, and growth factor
          signaling. Members of this family bind multiple
          partners including signaling molecules like c-Abl,
          c-Arg, Sos, and c-Cbl, as well as cytoskeletal
          molecules such as vinculin and afadin. They may have
          overlapping functions. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 23.8 bits (52), Expect = 4.8
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 19 YKYTREDVDELSFDVGEIIRVVE 41
          Y YT ++ DEL    G+I+ V+E
Sbjct: 6  YSYTPQNEDELELREGDIVYVME 28


>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide
          Synthase TRaffic INducer.  Nostrin is expressed in
          endothelial and epithelial cells and is involved in the
          regulation, trafficking and targeting of endothelial
          NOS (eNOS). It facilitates the endocytosis of eNOS by
          coordinating the functions of dynamin and the
          Wiskott-Aldrich syndrome protein (WASP). Increased
          expression of Nostrin may be correlated to
          preeclampsia. Nostrin contains an N-terminal F-BAR
          domain and a C-terminal SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 23.5 bits (51), Expect = 5.0
 Identities = 13/26 (50%), Positives = 14/26 (53%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDD 44
          Y YT    DELS   G+II V E  D
Sbjct: 6  YSYTANREDELSLQPGDIIEVHEKQD 31


>gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B.
           Endophilins play roles in synaptic vesicle formation,
          virus budding, mitochondrial morphology maintenance,
          receptor-mediated endocytosis inhibition, and endosomal
          sorting. They are classified into two types, A and B.
          Vertebrates contain two endophilin-B isoforms.
          Endophilin-B proteins are cytoplasmic proteins
          expressed mainly in the heart, placenta, and skeletal
          muscle. Endophilins contain an N-terminal N-BAR domain
          (BAR domain with an additional N-terminal amphipathic
          helix), followed by a variable region containing
          proline clusters, and a C-terminal SH3 domain. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 52

 Score = 23.4 bits (51), Expect = 5.2
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPEE 47
          Y Y  ED  ELS    E+I V E    +E
Sbjct: 6  YDYDAEDSTELSLLADEVITVYELPGMDE 34


>gnl|CDD|237493 PRK13762, PRK13762, tRNA-modifying enzyme; Provisional.
          Length = 322

 Score = 24.5 bits (54), Expect = 5.3
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 29  LSFDVGEIIRVVEYDDPEEQVDKI 52
           L  DVG  ++  E+DDPEE V++ 
Sbjct: 79  LEEDVGLELKEPEWDDPEEIVEES 102


>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C
          (PLC) gamma.  PLC catalyzes the hydrolysis of
          phosphatidylinositol (4,5)-bisphosphate [PtdIns(4,5)P2]
          to produce Ins(1,4,5)P3 and diacylglycerol (DAG) in
          response to various receptors. Ins(1,4,5)P3 initiates
          the calcium signaling cascade while DAG functions as an
          activator of PKC. PLCgamma catalyzes this reaction in
          tyrosine kinase-dependent signaling pathways. It is
          activated and recruited to its substrate at the
          membrane. Vertebrates contain two forms of PLCgamma,
          PLCgamma1, which is widely expressed, and PLCgamma2,
          which is primarily found in haematopoietic cells.
          PLCgamma contains a Pleckstrin homology (PH) domain
          followed by an elongation factor (EF) domain, two
          catalytic regions of PLC domains that flank two tandem
          SH2 domains, followed by a SH3 domain and C2 domain.
          The SH3 domain of PLCgamma1 directly interacts with
          dynamin-1 and can serve as a guanine nucleotide
          exchange factor (GEF). It also interacts with Cbl,
          inhibiting its phosphorylation and activity. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 23.4 bits (51), Expect = 5.4
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 17 FTYKYTREDVDELSFDVGEIIRVVEYDD 44
          + Y+  R D  ELSF    II  VE +D
Sbjct: 6  YDYRAQRPD--ELSFCKHAIITNVEKED 31


>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing
          Adaptor Molecule 1.  STAM1 is part of the endosomal
          sorting complex required for transport (ESCRT-0) and is
          involved in sorting ubiquitinated cargo proteins from
          the endosome. It may also be involved in the regulation
          of IL2 and GM-CSF mediated signaling, and has been
          implicated in neural cell survival. STAMs were
          discovered as proteins that are highly phosphorylated
          following cytokine and growth factor stimulation. They
          function in cytokine signaling and surface receptor
          degradation, as well as regulate Golgi morphology. They
          associate with many proteins including Jak2 and Jak3
          tyrosine kinases, Hrs, AMSH, and UBPY. STAM adaptor
          proteins contain VHS (Vps27, Hrs, STAM homology),
          ubiquitin interacting (UIM), and SH3 domains. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 23.8 bits (51), Expect = 5.7
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDP 45
          Y +   + +EL+F  G+II +++  DP
Sbjct: 7  YDFEAAEDNELTFKAGDIITILDDSDP 33


>gnl|CDD|223273 COG0195, NusA, Transcription elongation factor [Transcription].
          Length = 190

 Score = 24.1 bits (53), Expect = 6.4
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 26  VDELSFDVGEIIRVVEY-DDPEEQVDKIFS 54
           V  +S ++GE I VVE+ +DP E +    +
Sbjct: 98  VKAVSEELGEKIDVVEWSEDPAEFIKNALA 127


>gnl|CDD|235154 PRK03739, PRK03739, 2-isopropylmalate synthase; Validated.
          Length = 552

 Score = 24.4 bits (54), Expect = 6.7
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 12/42 (28%)

Query: 3   DVILSALNLIRLLYFTYKYTREDVD-ELSF-DVGEIIRVVEY 42
           D++  ALNL         YT+  VD  L F D+ EI R VEY
Sbjct: 282 DLVTLALNL---------YTQ-GVDPGLDFSDIDEIRRTVEY 313


>gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of
          Dynamin Binding Protein, also called Tuba.  DNMBP or
          Tuba is a cdc42-specific guanine nucleotide exchange
          factor (GEF) that contains four N-terminal SH3 domains,
          a central RhoGEF [or Dbl homology (DH)] domain followed
          by a Bin/Amphiphysin/Rvs (BAR) domain, and two
          C-terminal SH3 domains. It provides a functional link
          between dynamin and key regulatory proteins of the
          actin cytoskeleton. It plays an important role in
          regulating cell junction configuration. The four
          N-terminal SH3 domains of DNMBP bind the GTPase
          dynamin, which plays an important role in the fission
          of endocytic vesicles. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 50

 Score = 23.2 bits (50), Expect = 6.9
 Identities = 8/22 (36%), Positives = 16/22 (72%)

Query: 19 YKYTREDVDELSFDVGEIIRVV 40
          Y++   + +EL F+VG+ IR++
Sbjct: 6  YRFQALEPNELDFEVGDRIRII 27


>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein
          Signaling Modulator 3.  SGSM3 is also called
          Merlin-associated protein (MAP), RUN and SH3
          domain-containing protein (RUSC3), RUN and TBC1
          domain-containing protein 3 (RUTBC3), Rab
          GTPase-activating protein 5 (RabGAP5), or Rab GAP-like
          protein (RabGAPLP). It is expressed ubiquitously and
          functions as a regulator of small G protein RAP- and
          RAB-mediated neuronal signaling. It is involved in
          modulating NGF-mediated neurite outgrowth and
          differentiation. It also interacts with the tumor
          suppressor merlin and may play a role in the
          merlin-associated suppression of cell growth. SGSM3
          contains TBC, SH3, and RUN domains. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 23.2 bits (50), Expect = 7.2
 Identities = 12/36 (33%), Positives = 18/36 (50%)

Query: 21 YTREDVDELSFDVGEIIRVVEYDDPEEQVDKIFSLR 56
          + R D DEL F   +II ++   D    V ++  LR
Sbjct: 8  FERHDDDELGFRKNDIITIISQKDEHCWVGELNGLR 43


>gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and
          double SH3 domains protein 2.  FCHSD2 has a domain
          structure consisting of an N-terminal F-BAR (FES-CIP4
          Homology and Bin/Amphiphysin/Rvs), two SH3, and
          C-terminal proline-rich domains. It has only been
          characterized in silico and its function is unknown.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 56

 Score = 23.0 bits (49), Expect = 9.2
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 19 YKYTREDVDELSFDVGEIIRVVEYDDPEE 47
          Y Y  +  DELSF  G IIR++  ++ ++
Sbjct: 6  YDYEGQTDDELSFPEGAIIRILNKENQDD 34


>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of
          Nebulette and LIM-nebulette (or Lasp2).  Nebulette is a
          cardiac-specific protein that localizes to the Z-disc.
          It interacts with tropomyosin and is important in
          stabilizing actin thin filaments in cardiac muscles.
          Polymorphisms in the nebulette gene are associated with
          dilated cardiomyopathy, with some mutations resulting
          in severe heart failure. Nebulette is a 107kD protein
          that contains an N-terminal acidic region, multiple
          nebulin repeats, and a C-terminal SH3 domain.
          LIM-nebulette, also called Lasp2 (LIM and SH3 domain
          protein 2), is an alternatively spliced variant of
          nebulette. Although it shares a gene with nebulette,
          Lasp2 is not transcribed from a muscle-specific
          promoter, giving rise to its multiple tissue expression
          pattern with highest amounts in the brain. It can
          crosslink actin filaments and it affects cell
          spreading. Lasp2 is a 34kD protein containing an
          N-terminal LIM domain, three nebulin repeats, and a
          C-terminal SH3 domain. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 58

 Score = 23.0 bits (49), Expect = 9.8
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 19 YKYTREDVDELSFDVGEIIRVVE 41
          Y Y+ +D DE+SF  G+ I  V+
Sbjct: 7  YDYSAQDEDEVSFRDGDYIVNVQ 29


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.143    0.420 

Gapped
Lambda     K      H
   0.267   0.0813    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,912,070
Number of extensions: 319129
Number of successful extensions: 625
Number of sequences better than 10.0: 1
Number of HSP's gapped: 625
Number of HSP's successfully gapped: 111
Length of query: 72
Length of database: 10,937,602
Length adjustment: 42
Effective length of query: 30
Effective length of database: 9,074,734
Effective search space: 272242020
Effective search space used: 272242020
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.0 bits)