Diaphorina citri psyllid: psy4489


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MWDVILSALNLIRLLYFTYKYTREDVDELSFDVGEIIRVVEYDDPEEQVDKIFSLRTDTVEMWDVIVIGLNT
ccEEEEccHHEEEEEHHHccccccccccCECccccEEEEEEccccHHHHHcEEEEEcccccccEEEEEEEcc
*WDVILSALNLIRLLYFTYKYTREDVDELSFDVGEIIRVVEYDDPEEQVDKIFSLRTDTVEMWDVIVIGLN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWDVILSALNLIRLLYFTYKYTREDVDELSFDVGEIIRVVEYDDPEEQVDKIFSLRTDTVEMWDVIVIGLNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045202 [CC]synapseprobableGO:0005575
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0006937 [BP]regulation of muscle contractionprobableGO:0044057, GO:0008150, GO:0090257, GO:0051239, GO:0065007, GO:0050789
GO:0045313 [BP]rhabdomere membrane biogenesisprobableGO:0048666, GO:0044707, GO:0042052, GO:0042051, GO:0030154, GO:0048468, GO:0001745, GO:0007275, GO:0044699, GO:0042462, GO:0042461, GO:0009653, GO:0048869, GO:0016043, GO:0048513, GO:0044091, GO:0071840, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0006996, GO:0048699, GO:0007399, GO:0007423, GO:0001654, GO:0048856, GO:0046530, GO:0044085, GO:0044763, GO:0032502
GO:0006887 [BP]exocytosisprobableGO:0046903, GO:0009987, GO:0016192, GO:0006810, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QWY, chain A
Confidence level:very confident
Coverage over the Query: 11-63
View the alignment between query and template
View the model in PyMOL