Diaphorina citri psyllid: psy4492


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MTISIFAQAPVAAAPVEEEEEKIVQSLFTVKLVKYDDKQKVPLIKEIKGLLEGMNLVQAKKFVESIPAVVKTDVTKEEAEALKASLAKVGGEVSVE
cccccccccccccccccHHHHHHHccEEEEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHcccEEEEc
*********************KIVQSLFTVKLVKYDDKQKVPLIKEIKGLLEGMNLVQAKKFVESIPAVVKTDVTKEEAEALKASLAKVGGEVSVE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTISIFAQAPVAAAPVEEEEEKIVQSLFTVKLVKYDDKQKVPLIKEIKGLLEGMNLVQAKKFVESIPAVVKTDVTKEEAEALKASLAKVGGEVSVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L7/L12 Seems to be the binding site for several of the factors involved in protein synthesis and appears to be essential for accurate translation.confidentC6DHR4
39S ribosomal protein L12, mitochondrial confidentP52815
39S ribosomal protein L12, mitochondrial confidentQ9DB15

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044699 [BP]single-organism processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FTC, chain E
Confidence level:very confident
Coverage over the Query: 20-96
View the alignment between query and template
View the model in PyMOL