Query         psy4503
Match_columns 447
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 18:51:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4503.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4503hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK14717 putative glycine/sarc   9.3 2.1E+02  0.0046   25.0   1.8   30  418-447    22-51  (107)
  2 PF06713 bPH_4:  Bacterial PH d   8.0 3.1E+02  0.0068   20.6   2.1   21  319-339    44-64  (74)
  3 PF07407 Seadorna_VP6:  Seadorn   8.0 2.7E+02  0.0059   28.7   2.2   26  309-334   267-294 (420)
  4 PRK13265 glycine/sarcosine/bet   5.9 3.7E+02  0.0081   24.7   1.8   30  418-447    71-100 (154)
  5 PF10528 PA14_2:  GLEYA domain;   5.0 2.8E+02   0.006   22.9   0.4   21  319-339    62-82  (113)
  6 PF15374 CCDC71L:  Coiled-coil    4.6 3.8E+02  0.0083   27.4   1.1   15  432-446   147-161 (376)
  7 cd06463 p23_like Proteins cont   4.6 9.5E+02   0.021   16.1   2.8   21  319-341    41-61  (84)
  8 cd00237 p23 p23 binds heat sho   4.4 1.2E+03   0.026   18.8   3.7   20  321-342    46-65  (106)
  9 PF04723 GRDA:  Glycine reducta   4.4 4.7E+02    0.01   24.0   1.4   30  418-447    70-99  (150)
 10 cd06469 p23_DYX1C1_like p23_li   4.3 1.2E+03   0.025   16.4   3.2   23  319-343    36-58  (78)

No 1  
>PRK14717 putative glycine/sarcosine/betaine reductase complex protein A; Provisional
Probab=9.30  E-value=2.1e+02  Score=25.00  Aligned_cols=30  Identities=43%  Similarity=0.593  Sum_probs=26.6

Q ss_pred             EEeeccceecccccccCccccCCCCCCCCC
Q psy4503         418 VFTLGATELTAKNIRSNTGTVGSPTHMSPL  447 (447)
Q Consensus       418 vftlgateltaknirsntgtvgspthmspl  447 (447)
                      |.-||+.|--+..|...|=|.|.||.-.||
T Consensus        22 vV~lG~aeaEaaglaAETVt~GDPTfAGPL   51 (107)
T PRK14717         22 VVILGAAEAEAAGLAAETVTNGDPTFAGPL   51 (107)
T ss_pred             EEEecCcchhhccceeeeeccCCCcccccc
Confidence            567889999999999999999999998886


No 2  
>PF06713 bPH_4:  Bacterial PH domain;  InterPro: IPR009589 This entry is represented by Bacteriophage SP-beta, YolF. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown.
Probab=8.05  E-value=3.1e+02  Score=20.64  Aligned_cols=21  Identities=24%  Similarity=0.370  Sum_probs=13.3

Q ss_pred             eeEEEEEEEeeeeeeeecCCc
Q psy4503         319 KSVILEVEYYKPIKIVPQNSA  339 (447)
Q Consensus       319 ksvileveyykpikivpqnsa  339 (447)
                      +.+.++-.-|+.|.|.|+|..
T Consensus        44 ~rl~I~y~~~~~i~IsP~~~~   64 (74)
T PF06713_consen   44 DRLEIYYGKYKSILISPKDKE   64 (74)
T ss_pred             cEEEEEECCCCEEEEECCCHH
Confidence            444444333488999999853


No 3  
>PF07407 Seadorna_VP6:  Seadornavirus VP6 protein;  InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus. Members of this family are typically of around 420 residues in length. The function of this family is unknown.
Probab=8.00  E-value=2.7e+02  Score=28.67  Aligned_cols=26  Identities=31%  Similarity=0.657  Sum_probs=16.8

Q ss_pred             EeecceeeeeeeEEEEE--EEeeeeeee
Q psy4503         309 FTLGATELTAKSVILEV--EYYKPIKIV  334 (447)
Q Consensus       309 ftlgateltaksvilev--eyykpikiv  334 (447)
                      +-.|+.=--+.|-++||  .||||+|..
T Consensus       267 YHVG~acR~~EcSVvev~gr~yKP~kc~  294 (420)
T PF07407_consen  267 YHVGNACRITECSVVEVEGRYYKPLKCS  294 (420)
T ss_pred             eeecccceeecceEEEEcCeeccceeec
Confidence            44555444455666666  599999953


No 4  
>PRK13265 glycine/sarcosine/betaine reductase complex protein A; Reviewed
Probab=5.86  E-value=3.7e+02  Score=24.72  Aligned_cols=30  Identities=43%  Similarity=0.593  Sum_probs=26.6

Q ss_pred             EEeeccceecccccccCccccCCCCCCCCC
Q psy4503         418 VFTLGATELTAKNIRSNTGTVGSPTHMSPL  447 (447)
Q Consensus       418 vftlgateltaknirsntgtvgspthmspl  447 (447)
                      |.-||+.|--+..|...|=+.|.||.--||
T Consensus        71 vVllGaaeaEaaglaAETVt~GDPTfAGPL  100 (154)
T PRK13265         71 VVILGAAEAEAAGLAAETVTNGDPTFAGPL  100 (154)
T ss_pred             EEEecccchhhccceeeeeccCCCcccccc
Confidence            567889998899999999999999998886


No 5  
>PF10528 PA14_2:  GLEYA domain;  InterPro: IPR018871  This presumed domain is found in fungal adhesins and is related to the PA14 domain. ; PDB: 4A3X_A.
Probab=5.02  E-value=2.8e+02  Score=22.89  Aligned_cols=21  Identities=38%  Similarity=0.518  Sum_probs=14.4

Q ss_pred             eeEEEEEEEeeeeeeeecCCc
Q psy4503         319 KSVILEVEYYKPIKIVPQNSA  339 (447)
Q Consensus       319 ksvileveyykpikivpqnsa  339 (447)
                      -+|-|+.-.|-||+|+-.|..
T Consensus        62 ~tv~L~aG~yyPiRi~~~N~~   82 (113)
T PF10528_consen   62 VTVYLTAGTYYPIRIVYANGG   82 (113)
T ss_dssp             EEEEE-TT-BEEEEEEEEE-S
T ss_pred             EEEEEECCcEEEEEEEEEcCC
Confidence            456677778999999988764


No 6  
>PF15374 CCDC71L:  Coiled-coil domain-containing protein 71L
Probab=4.56  E-value=3.8e+02  Score=27.37  Aligned_cols=15  Identities=47%  Similarity=0.758  Sum_probs=12.9

Q ss_pred             ccCccccCCCCCCCC
Q psy4503         432 RSNTGTVGSPTHMSP  446 (447)
Q Consensus       432 rsntgtvgspthmsp  446 (447)
                      +|+.-+||-|+||-|
T Consensus       147 ~s~~~~~gfP~~~yp  161 (376)
T PF15374_consen  147 TSRGATVGFPAHLYP  161 (376)
T ss_pred             ccCCcccccccccCC
Confidence            567788999999988


No 7  
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1. Both are co-chaperones for the heat shock protein (Hsp) 90.  p23 binds Hsp90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor. p23 also has a passive chaperoning activity and in addition may participate in prostaglandin synthesis.  Both p23 and Sba1p can regulate telomerase activity. This group includes domains similar to the C-terminal CHORD-SGT1 (CS) domain of suppressor of G2 allele of Skp1 (Sgt1). Sgt1 interacts with multiple protein complexes and has the features of a co-chaperone. Human (h) Sgt1 interacts with both Hsp70 and Hsp90, and has been shown to bind Hsp90 through its CS domain.  Saccharomyces cerevisiae (Sc) Sgt1 is a subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Sgt1 is required for pathogen resistance in plants.  This group also includes the p23_like domains of
Probab=4.55  E-value=9.5e+02  Score=16.11  Aligned_cols=21  Identities=38%  Similarity=0.596  Sum_probs=13.2

Q ss_pred             eeEEEEEEEeeeeeeeecCCcce
Q psy4503         319 KSVILEVEYYKPIKIVPQNSATE  341 (447)
Q Consensus       319 ksvileveyykpikivpqnsate  341 (447)
                      +...++++.|.||+  |+.|.-.
T Consensus        41 ~~~~~~~~L~~~I~--~~~s~~~   61 (84)
T cd06463          41 KEYLLEGELFGPID--PEESKWT   61 (84)
T ss_pred             CceEEeeEccCccc--hhhcEEE
Confidence            44677888888875  5544433


No 8  
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor. p23 also has a passive chaperoning activity and in addition may participate in prostaglandin synthesis.
Probab=4.41  E-value=1.2e+03  Score=18.81  Aligned_cols=20  Identities=25%  Similarity=0.473  Sum_probs=14.8

Q ss_pred             EEEEEEEeeeeeeeecCCccee
Q psy4503         321 VILEVEYYKPIKIVPQNSATEL  342 (447)
Q Consensus       321 vileveyykpikivpqnsatel  342 (447)
                      ..+++++|+||  +|.+|-...
T Consensus        46 y~~~l~l~~~I--~pe~Sk~~v   65 (106)
T cd00237          46 IYNEIELYDRV--DPNDSKHKR   65 (106)
T ss_pred             EEEEEEeeccc--CcccCeEEe
Confidence            55788999997  577776554


No 9  
>PF04723 GRDA:  Glycine reductase complex selenoprotein A;  InterPro: IPR006812 Found in clostridia, this protein contains one active site selenocysteine and catalyses the reductive deamination of glycine, which is coupled to the esterification of orthophosphate resulting in the formation of ATP []. A member of this family may also exist in Treponema denticola [].; GO: 0030699 glycine reductase activity, 0050485 oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor, 0055114 oxidation-reduction process, 0030700 glycine reductase complex
Probab=4.40  E-value=4.7e+02  Score=24.03  Aligned_cols=30  Identities=43%  Similarity=0.599  Sum_probs=26.7

Q ss_pred             EEeeccceecccccccCccccCCCCCCCCC
Q psy4503         418 VFTLGATELTAKNIRSNTGTVGSPTHMSPL  447 (447)
Q Consensus       418 vftlgateltaknirsntgtvgspthmspl  447 (447)
                      |.-||+.|--+..|...|-+.|.||.-.||
T Consensus        70 vVvlG~aeaE~a~laAETVt~GDPTfaGPL   99 (150)
T PF04723_consen   70 VVVLGAAEAEAAGLAAETVTNGDPTFAGPL   99 (150)
T ss_pred             EEEecCCChhhhhhhhhhhccCCCcccccc
Confidence            567899999999999999999999998886


No 10 
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1. The human gene encoding this protein is a positional candidate gene for developmental dyslexia (DD), it is located on 15q21.3 by the DYX1 DD susceptibility locus (15q15-21). Independent association studies have reported conflicting results. However, association of short-term memory, which plays a role in DD, with a variant within the DYX1C1 gene has been reported. Most proteins belonging to this group contain a C-terminal tetratricopeptide repeat (TPR) protein binding region.
Probab=4.33  E-value=1.2e+03  Score=16.37  Aligned_cols=23  Identities=17%  Similarity=0.382  Sum_probs=14.9

Q ss_pred             eeEEEEEEEeeeeeeeecCCcceee
Q psy4503         319 KSVILEVEYYKPIKIVPQNSATELT  343 (447)
Q Consensus       319 ksvileveyykpikivpqnsatelt  343 (447)
                      ++..++++.|.||  .|++|...+.
T Consensus        36 ~~~~~~~~l~~~I--~~e~~~~~~~   58 (78)
T cd06469          36 PPYLFELDLAAPI--DDEKSSAKIG   58 (78)
T ss_pred             CCEEEEEeCcccc--cccccEEEEe
Confidence            4566777888876  5777654443


Done!