Diaphorina citri psyllid: psy451

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------

MALNHNLRLALSNCNRILSRKSNIFETPFLFGCSEVINIRQKKVWIRPPRVKYPLWFLQKERAEYIENLTRNNKAFIEEVVHDQCGAPAVKSGIETYNTPLKIEPLQPLEITTSSKRTGLIGKIIGQYPLWMKNGEKCRTTLVQVVDNHIIKYIPPEEFKPNRKPYRGEPKRKLGCLLVGAESGDPSLYTKEYCGLFKNSGVPPKKKLCRFIITPDAMLPPGTPLTAAHFRPREFLDVRGLTVDRGFQGVMKRWGFKGMPATHGVTKSHRRGGCIASGAGKARVYPGGVLQRGLKC

cccccccHHcccccccEEccccccccccCECccEEEEEEECccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccCEEEEEEECcccccccccccEEEEEEEEEcccEEEEEEccccccccccccccccccccEEEEEEcccccccccccHHccHHHHcccccccEEEEEEccccccccccccEEEcccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccc

******LRLALSNCNRILSRKSNIFETPFLFGCSEVINIRQKKVWIRPPRVKYPLWFLQKERAEYIENLTRNNKAFIEEVVHDQCGAPAVKSGIETYNTPLKIEPLQPLEITTSSKRTGLIGKIIGQYPLWMKNGEKCRTTLVQVVDNHIIKYIPPEEFKPNRKPYRGEPKRKLGCLLVGAESGDPSLYTKEYCGLFKNSGVPPKKKLCRFIITPDAMLPPGTPLTAAHFRPREFLDVRGLTVDRGFQGVMKRWGFKGMPATHG*TKS***G*****GAGKARVYPGGVLQRGLK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
54S ribosomal protein L9, mitochondrial		confident	P31334
39S ribosomal protein L3, mitochondrial		confident	P18665
39S ribosomal protein L3, mitochondrial		confident	Q99N95

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FTC, chain C
Confidence level:very confident
Coverage over the Query: 117-159,171-296
View the alignment between query and template
View the model in PyMOL