Query         psy455
Match_columns 58
No_of_seqs    36 out of 38
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:55:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy455.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/455hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02312 CBF_beta:  Core bindin 100.0 5.1E-31 1.1E-35  181.6   2.0   56    1-56     98-153 (169)
  2 KOG4785|consensus               99.9 2.4E-26 5.1E-31  159.4   4.2   56    1-56     98-153 (177)
  3 PRK04570 cell division protein  82.7    0.69 1.5E-05   34.1   1.3   31   23-57    204-234 (243)
  4 PRK13711 conjugal transfer pro  58.5     3.9 8.4E-05   27.0   0.4   12    5-16      3-14  (113)
  5 KOG3850|consensus               56.5      16 0.00035   29.2   3.5   25   28-52     94-118 (455)
  6 cd04684 Nudix_Hydrolase_25 Con  52.0      12 0.00026   21.7   1.7   28   16-47     28-55  (128)
  7 KOG4747|consensus               47.0     3.6 7.9E-05   28.4  -1.2   41    2-46     95-136 (150)
  8 COG3115 ZipA Cell division pro  46.3      19 0.00042   27.6   2.5   29   23-55    295-323 (324)
  9 cd05838 WHSC1_related The PWWP  44.9      71  0.0015   19.4   4.5   48    2-49     39-93  (95)
 10 PF10023 DUF2265:  Predicted am  44.3      14 0.00031   28.1   1.5   23    5-40    109-131 (337)
 11 PF13298 LigD_N:  DNA polymeras  42.6      13 0.00027   24.0   0.9    9    1-9      16-24  (105)
 12 PF04508 Pox_A_type_inc:  Viral  41.4      22 0.00047   17.7   1.4   15   40-54      2-16  (23)
 13 PF10267 Tmemb_cc2:  Predicted   39.2      47   0.001   25.7   3.6   27   28-54     58-84  (395)
 14 PF06526 DUF1107:  Protein of u  38.1      48   0.001   19.9   2.8   35   17-51     26-63  (64)
 15 PF00855 PWWP:  PWWP domain;  I  36.4      81  0.0017   17.6   4.6   44    2-45     35-84  (86)
 16 cd04691 Nudix_Hydrolase_32 Mem  34.7      36 0.00078   20.2   1.9   28   16-47     30-57  (117)
 17 cd04671 Nudix_Hydrolase_13 Mem  33.5      37 0.00079   20.7   1.9   31   14-48     27-57  (123)
 18 PRK15472 nucleoside triphospha  33.3      34 0.00073   20.8   1.7   27   17-47     35-61  (141)
 19 cd03427 MTH1 MutT homolog-1 (M  33.3      37  0.0008   20.2   1.8   27   16-46     29-55  (137)
 20 PRK00269 zipA cell division pr  32.8      37  0.0008   25.6   2.1   28   25-56    262-289 (293)
 21 TIGR01702 CO_DH_cata carbon-mo  30.8      38 0.00082   27.8   2.0   34   13-47    352-387 (621)
 22 cd03430 GDPMH GDP-mannose glyc  30.8      46   0.001   20.8   2.0   28   17-48     42-69  (144)
 23 cd04680 Nudix_Hydrolase_21 Mem  30.5      45 0.00097   19.1   1.8   29   17-49     27-55  (120)
 24 COG0494 MutT NTP pyrophosphohy  29.8      38 0.00083   18.6   1.4   27   21-49     43-69  (161)
 25 cd04690 Nudix_Hydrolase_31 Mem  28.5      51  0.0011   19.0   1.8   29   17-49     27-55  (118)
 26 cd00024 CHROMO Chromatin organ  28.2      34 0.00073   17.6   0.9   10    4-13     22-31  (55)
 27 cd04681 Nudix_Hydrolase_22 Mem  27.7      58  0.0013   19.1   2.0   29   16-48     30-58  (130)
 28 cd04700 DR1025_like DR1025 fro  27.5      48   0.001   20.5   1.7   30   16-49     42-71  (142)
 29 cd04677 Nudix_Hydrolase_18 Mem  27.4 1.2E+02  0.0025   17.7   3.3   29   16-48     33-61  (132)
 30 PF04380 BMFP:  Membrane fusoge  27.3      83  0.0018   18.7   2.7   36   17-54     44-79  (79)
 31 cd01916 ACS_1 Acetyl-CoA synth  27.3      62  0.0013   27.0   2.7   28   16-47    321-348 (731)
 32 KOG3039|consensus               26.4      59  0.0013   24.9   2.3   29   25-53     88-116 (303)
 33 cd04689 Nudix_Hydrolase_30 Mem  26.2      54  0.0012   19.3   1.7   28   17-48     27-54  (125)
 34 cd03674 Nudix_Hydrolase_1 Memb  25.8      58  0.0013   19.9   1.8   30   15-48     28-57  (138)
 35 cd01915 CODH Carbon monoxide d  25.7      64  0.0014   26.4   2.5   35   13-47    347-382 (613)
 36 PF01899 MNHE:  Na+/H+ ion anti  25.4 1.2E+02  0.0025   19.5   3.2   14   16-29    111-124 (156)
 37 COG1422 Predicted membrane pro  25.4      61  0.0013   23.3   2.1   18   38-55     71-88  (201)
 38 PF07889 DUF1664:  Protein of u  24.9      35 0.00075   22.6   0.7    7    5-11     22-28  (126)
 39 PF13206 VSG_B:  Trypanosomal V  24.7   1E+02  0.0022   21.3   3.1   22    2-23    300-321 (351)
 40 PF04802 SMK-1:  Component of I  24.2      26 0.00057   24.3   0.1   13   19-31     57-69  (193)
 41 PF02009 Rifin_STEVOR:  Rifin/s  23.7      82  0.0018   23.4   2.6   11   38-48     49-59  (299)
 42 COG2980 RlpB Rare lipoprotein   23.5 1.2E+02  0.0026   21.5   3.2   29   24-52    133-161 (178)
 43 cd04673 Nudix_Hydrolase_15 Mem  23.4      64  0.0014   18.4   1.6   27   17-47     29-55  (122)
 44 PF12344 UvrB:  Ultra-violet re  22.8      89  0.0019   17.5   2.1   12   36-47      9-20  (44)
 45 smart00298 CHROMO Chromatin or  22.6      50  0.0011   16.8   0.9   11    4-14     20-30  (55)
 46 cd04682 Nudix_Hydrolase_23 Mem  22.3      79  0.0017   18.6   1.9   29   16-48     32-60  (122)
 47 PF05644 Miff:  Mitochondrial a  22.2 1.2E+02  0.0026   22.0   3.1   29   26-54    189-217 (246)
 48 cd04664 Nudix_Hydrolase_7 Memb  21.4      79  0.0017   18.7   1.8   28   17-48     32-59  (129)
 49 cd04678 Nudix_Hydrolase_19 Mem  21.4      75  0.0016   18.7   1.7   28   17-48     32-59  (129)
 50 KOG1602|consensus               21.0      51  0.0011   24.8   1.0   16    1-18    124-139 (271)
 51 PRK14839 undecaprenyl pyrophos  20.7      54  0.0012   23.8   1.1   15    2-18     95-109 (239)
 52 PRK12651 putative monovalent c  20.7 1.6E+02  0.0035   19.3   3.3   14   16-29    112-125 (158)
 53 TIGR00055 uppS undecaprenyl di  20.7      54  0.0012   23.4   1.1   15    2-18     85-99  (226)
 54 cd07469 CRD_TK_ROR_related Cys  20.5      44 0.00094   22.8   0.6   33    2-34      2-34  (147)

No 1  
>PF02312 CBF_beta:  Core binding factor beta subunit;  InterPro: IPR003417 Core binding factor (CBF) is a heterodimeric transcription factor essential for genetic regulation of hematopoiesis and osteogenesis. The beta subunit binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including Murine leukemia virus, Polyomavirus enhancer, T-cell receptor enhancers etc. The beta subunit enhances DNA-binding ability of the alpha subunit in vitro, and has been show to have a structure related to the OB fold []. Also included in this family are the Drosophila melanogaster brother and big brother proteins, which regulate the DNA-binding properties of Runt.; GO: 0003713 transcription coactivator activity, 0005634 nucleus; PDB: 2JHB_A 1IO4_D 1ILF_A 1CL3_A 1H9D_B 1E50_H.
Probab=99.96  E-value=5.1e-31  Score=181.61  Aligned_cols=56  Identities=71%  Similarity=1.316  Sum_probs=36.7

Q ss_pred             CceeEEeeeeeeeceecCCceeeeechhHhhhHHHHHHHHHHHHHHHHHhhhhhcc
Q psy455            1 MNGVCVRWRGWLDLERLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRLRDAYLGFR   56 (58)
Q Consensus         1 lNgVcV~wrG~~dl~rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~refEdr~~   56 (58)
                      ||||||+|||||||++|||+|||+||+++|++||++++++|++|++|++|||++.|
T Consensus        98 lNGVCV~~rGwidlerLdG~g~LefDeerA~~Ed~~~~~~~e~~~~r~refee~~r  153 (169)
T PF02312_consen   98 LNGVCVRWRGWIDLERLDGVGCLEFDEERAQIEDALLREQFEQYNQRIREFEERQR  153 (169)
T ss_dssp             ETTEEEEEEEEEETTTTEEEEEEEE-HHHHHHHHHHCT------------------
T ss_pred             EeeEEEEEEEEeehhhccCcceeeeCHHHHHHHHHHHHHHHHHHHhhccchhhccc
Confidence            79999999999999999999999999999999999999999999999999999986


No 2  
>KOG4785|consensus
Probab=99.92  E-value=2.4e-26  Score=159.40  Aligned_cols=56  Identities=54%  Similarity=1.002  Sum_probs=55.0

Q ss_pred             CceeEEeeeeeeeceecCCceeeeechhHhhhHHHHHHHHHHHHHHHHHhhhhhcc
Q psy455            1 MNGVCVRWRGWLDLERLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRLRDAYLGFR   56 (58)
Q Consensus         1 lNgVcV~wrG~~dl~rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~refEdr~~   56 (58)
                      ||||||+|+||||+++|||+|||+||+.+|++||++++++|+.+++|+++|||+.|
T Consensus        98 ~NGvcV~~~GwidlErLdG~gclefde~ra~~eDai~~~~f~~~~~r~refed~~r  153 (177)
T KOG4785|consen   98 LNGVCVIWKGWIDLERLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDR  153 (177)
T ss_pred             eeeeEEEEEeeechhhccCccceehhHHHHHhHHHHHHHHHHHHHhhcccccccch
Confidence            79999999999999999999999999999999999999999999999999999876


No 3  
>PRK04570 cell division protein ZipA; Provisional
Probab=82.73  E-value=0.69  Score=34.08  Aligned_cols=31  Identities=16%  Similarity=0.213  Sum_probs=24.8

Q ss_pred             eeechhHhhhHHHHHHHHHHHHHHHHHhhhhhccC
Q psy455           23 LEYDEEKAMIEDAMLRDQIERYNQRLRDAYLGFRY   57 (58)
Q Consensus        23 Lefdee~A~~ED~~~re~~e~~~~R~refEdr~~~   57 (58)
                      ..+|+++..    +..|.++.|++|+|+||.|.+.
T Consensus       204 ~VLDe~R~~----lT~Q~iehyRqrIreyeRr~~~  234 (243)
T PRK04570        204 VVLDDSRNA----LGRQRIAHIRDELRAYDRQHQA  234 (243)
T ss_pred             EEecCCccc----CCHHHHHHHHHHHHHHHHhhcC
Confidence            346776654    5789999999999999988763


No 4  
>PRK13711 conjugal transfer protein TrbJ; Provisional
Probab=58.54  E-value=3.9  Score=27.03  Aligned_cols=12  Identities=50%  Similarity=1.209  Sum_probs=9.8

Q ss_pred             EEeeeeeeecee
Q psy455            5 CVRWRGWLDLER   16 (58)
Q Consensus         5 cV~wrG~~dl~r   16 (58)
                      +|.|||||-.-|
T Consensus         3 pvlwrgwipfcr   14 (113)
T PRK13711          3 PVLWRGWIPFCR   14 (113)
T ss_pred             ceeeccccceeE
Confidence            689999997654


No 5  
>KOG3850|consensus
Probab=56.50  E-value=16  Score=29.21  Aligned_cols=25  Identities=28%  Similarity=0.496  Sum_probs=23.0

Q ss_pred             hHhhhHHHHHHHHHHHHHHHHHhhh
Q psy455           28 EKAMIEDAMLRDQIERYNQRLRDAY   52 (58)
Q Consensus        28 e~A~~ED~~~re~~e~~~~R~refE   52 (58)
                      +++.++=++++..+++|.+|++++|
T Consensus        94 qksahtiaqlqkkL~~y~~rLkeie  118 (455)
T KOG3850|consen   94 QKSAHTIAQLQKKLEQYHRRLKEIE  118 (455)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHh
Confidence            5677888999999999999999999


No 6  
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability
Probab=52.04  E-value=12  Score=21.66  Aligned_cols=28  Identities=32%  Similarity=0.432  Sum_probs=21.7

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQR   47 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R   47 (58)
                      -+|| |.++.+|   ..+++..||..|++.=.
T Consensus        28 ~lPg-G~ve~gE---~~~~aa~RE~~EEtGl~   55 (128)
T cd04684          28 DLPG-GGIEPGE---SPEEALHREVLEETGLT   55 (128)
T ss_pred             ECCC-cccCCCC---CHHHHHHHHHHHHhCcE
Confidence            4566 7787776   57899999999998743


No 7  
>KOG4747|consensus
Probab=47.02  E-value=3.6  Score=28.44  Aligned_cols=41  Identities=29%  Similarity=0.637  Sum_probs=35.2

Q ss_pred             ceeEEeeeeeeeceecCC-ceeeeechhHhhhHHHHHHHHHHHHHH
Q psy455            2 NGVCVRWRGWLDLERLDG-VGCLEYDEEKAMIEDAMLRDQIERYNQ   46 (58)
Q Consensus         2 NgVcV~wrG~~dl~rldG-~~~Lefdee~A~~ED~~~re~~e~~~~   46 (58)
                      ..+||.++-+-+..-.+| ++||    +.-++|--.++..++.+++
T Consensus        95 k~~c~~~~~~~~~~n~egcvr~l----~~v~ie~~~lkkkL~~~f~  136 (150)
T KOG4747|consen   95 KKVCVGFNEFCEAGNIEGCVRCL----QQVKIEYSLLKKKLETLFQ  136 (150)
T ss_pred             HHHHHHHHHHHhhccchhHhhch----HHHHHHHHHHHHHHHHHHH
Confidence            468999999999999999 8888    6677888889999998887


No 8  
>COG3115 ZipA Cell division protein [Cell division and chromosome partitioning]
Probab=46.27  E-value=19  Score=27.65  Aligned_cols=29  Identities=24%  Similarity=0.493  Sum_probs=23.3

Q ss_pred             eeechhHhhhHHHHHHHHHHHHHHHHHhhhhhc
Q psy455           23 LEYDEEKAMIEDAMLRDQIERYNQRLRDAYLGF   55 (58)
Q Consensus        23 Lefdee~A~~ED~~~re~~e~~~~R~refEdr~   55 (58)
                      +..|++++.    ...++++.|++|+||++++.
T Consensus       295 vVLddqr~~----mt~q~l~aY~drIre~~~~~  323 (324)
T COG3115         295 VVLDDQRRM----MTPQKLEAYRDRIREVKRAN  323 (324)
T ss_pred             eeehhhhhh----cCHHHHHHHHHHHHHHHhcc
Confidence            347777765    57789999999999999863


No 9  
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS).  When translocated, WHSC1 plays a role in lymphoid multiple myeloma (MM) disease, also known as plasmacytoma. WHCS1 proteins typically contain two copies of the PWWP domain.  The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=44.86  E-value=71  Score=19.44  Aligned_cols=48  Identities=17%  Similarity=0.214  Sum_probs=29.4

Q ss_pred             ceeEEeeeeeeeceecCCceeeeechhHhh-------hHHHHHHHHHHHHHHHHH
Q psy455            2 NGVCVRWRGWLDLERLDGVGCLEYDEEKAM-------IEDAMLRDQIERYNQRLR   49 (58)
Q Consensus         2 NgVcV~wrG~~dl~rldG~~~Lefdee~A~-------~ED~~~re~~e~~~~R~r   49 (58)
                      +.|||.|=|.-|--=++-.....|.+..+.       .-....+++++++.....
T Consensus        39 ~~~~V~Ffgs~~y~Wv~~~~l~pf~e~~~~~~~~~~~~~~~~f~~AleEA~~~~~   93 (95)
T cd05838          39 GEFCVMFFGTHDYYWVHRGRVFPYQEGDKGFKEQTKSYLAKRFRKALEEASLAFK   93 (95)
T ss_pred             CeEEEEEeCCCCEEEeccccccchhhhhhhhhhhhhhhhHHHHHHHHHHHHHHhh
Confidence            468999866544444445555566543332       234577888888877654


No 10 
>PF10023 DUF2265:  Predicted aminopeptidase (DUF2265);  InterPro: IPR014553 This group represents a predicted aminopeptidase.
Probab=44.29  E-value=14  Score=28.08  Aligned_cols=23  Identities=52%  Similarity=0.900  Sum_probs=19.0

Q ss_pred             EEeeeeeeeceecCCceeeeechhHhhhHHHHHHHH
Q psy455            5 CVRWRGWLDLERLDGVGCLEYDEEKAMIEDAMLRDQ   40 (58)
Q Consensus         5 cV~wrG~~dl~rldG~~~Lefdee~A~~ED~~~re~   40 (58)
                      ||..|||             ||+..|+.|.+.++++
T Consensus       109 cv~YrGy-------------F~~~~A~~~a~~L~~~  131 (337)
T PF10023_consen  109 CVPYRGY-------------FDEADARAEAAELRAQ  131 (337)
T ss_pred             cccccCc-------------CCHHHHHHHHHHHHHc
Confidence            7788885             8999999999888764


No 11 
>PF13298 LigD_N:  DNA polymerase Ligase (LigD); PDB: 3TA5_A 3P4H_A 3TA7_A 3N9B_A 3N9D_A 2LJ6_A 3P43_A.
Probab=42.65  E-value=13  Score=23.97  Aligned_cols=9  Identities=33%  Similarity=0.719  Sum_probs=7.3

Q ss_pred             CceeEEeee
Q psy455            1 MNGVCVRWR    9 (58)
Q Consensus         1 lNgVcV~wr    9 (58)
                      ++|||++|.
T Consensus        16 ~~gvl~SWa   24 (105)
T PF13298_consen   16 DDGVLKSWA   24 (105)
T ss_dssp             ETTEEEEEE
T ss_pred             cCCeEEeeE
Confidence            478999996


No 12 
>PF04508 Pox_A_type_inc:  Viral A-type inclusion protein repeat ;  InterPro: IPR007596 The repeat is found in the A-type inclusion protein of the Poxvirus family [].; GO: 0016032 viral reproduction
Probab=41.38  E-value=22  Score=17.74  Aligned_cols=15  Identities=20%  Similarity=0.350  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHhhhhh
Q psy455           40 QIERYNQRLRDAYLG   54 (58)
Q Consensus        40 ~~e~~~~R~refEdr   54 (58)
                      .|++.+.||+++|.+
T Consensus         2 E~~rlr~rI~dLer~   16 (23)
T PF04508_consen    2 EMNRLRNRISDLERQ   16 (23)
T ss_pred             hHHHHHHHHHHHHHH
Confidence            477888999988864


No 13 
>PF10267 Tmemb_cc2:  Predicted transmembrane and coiled-coil 2 protein;  InterPro: IPR019394  This family of transmembrane coiled-coil containing proteins is conserved from worms to humans. Its function is unknown. 
Probab=39.18  E-value=47  Score=25.71  Aligned_cols=27  Identities=30%  Similarity=0.519  Sum_probs=23.1

Q ss_pred             hHhhhHHHHHHHHHHHHHHHHHhhhhh
Q psy455           28 EKAMIEDAMLRDQIERYNQRLRDAYLG   54 (58)
Q Consensus        28 e~A~~ED~~~re~~e~~~~R~refEdr   54 (58)
                      +++.++=++++..+++|.+|++|.|..
T Consensus        58 qksa~~i~~lqkkL~~y~~~l~ele~~   84 (395)
T PF10267_consen   58 QKSAQTIAQLQKKLEQYHKRLKELEQG   84 (395)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            456677888999999999999999864


No 14 
>PF06526 DUF1107:  Protein of unknown function (DUF1107);  InterPro: IPR009491 This family consists of several short, hypothetical bacterial proteins of unknown function.; PDB: 2JRO_A.
Probab=38.08  E-value=48  Score=19.90  Aligned_cols=35  Identities=26%  Similarity=0.451  Sum_probs=26.3

Q ss_pred             cCCceeeeechhHh---hhHHHHHHHHHHHHHHHHHhh
Q psy455           17 LDGVGCLEYDEEKA---MIEDAMLRDQIERYNQRLRDA   51 (58)
Q Consensus        17 ldG~~~Lefdee~A---~~ED~~~re~~e~~~~R~ref   51 (58)
                      .+|+|.+|||..+-   +..|......|.|-|+-+..+
T Consensus        26 I~g~G~feFd~Gkillp~~~~~~~~~~~~EiN~~I~~L   63 (64)
T PF06526_consen   26 IKGIGAFEFDNGKILLPKKADKRHLSVMSEINQEIRRL   63 (64)
T ss_dssp             ETTTEEEEEETTEE---SS--HHHHHHHHHHHHHHHHH
T ss_pred             EEecccEEEcCCEEeCCccccHHHHHHHHHHHHHHHhc
Confidence            57999999998765   456778888888888877643


No 15 
>PF00855 PWWP:  PWWP domain;  InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified []. The PWWP domain is named after a conserved Pro-Trp-Trp-Pro motif. It is present in proteins of nuclear origin and plays a role in cell growth and differentiation. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present it has been suggested that the domain is involved in protein-protein interactions [].; PDB: 3LYI_B 2L89_A 2NLU_A 1RI0_A 1KHC_A 3QKJ_C 2DAQ_A 1N27_A 3PFS_B 3QJ6_A ....
Probab=36.40  E-value=81  Score=17.65  Aligned_cols=44  Identities=23%  Similarity=0.235  Sum_probs=25.6

Q ss_pred             ceeEEeeeeeeeceecCCceeeeechhHhhhHH------HHHHHHHHHHH
Q psy455            2 NGVCVRWRGWLDLERLDGVGCLEYDEEKAMIED------AMLRDQIERYN   45 (58)
Q Consensus         2 NgVcV~wrG~~dl~rldG~~~Lefdee~A~~ED------~~~re~~e~~~   45 (58)
                      +.+||.|=|--+..-++...++.|++.......      ..++++|++++
T Consensus        35 ~~~~V~Ffg~~~~~wv~~~~i~~f~~~~~~~~~~~~~k~~~~~~Ai~eA~   84 (86)
T PF00855_consen   35 GHVLVRFFGDNDYAWVKPSNIKPFSEFKEKLKKKKKKKRKSFRKAIEEAE   84 (86)
T ss_dssp             TEEEEEETTTTEEEEEEGGGEEECCHHHHHHHHHHHHHSHHHHHHHHHHH
T ss_pred             CEEEEEecCCCCEEEECHHHhhChhhhHHHHHHhhccchHHHHHHHHHHH
Confidence            357888877555555666667778755544333      24445555443


No 16 
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=34.73  E-value=36  Score=20.23  Aligned_cols=28  Identities=32%  Similarity=0.508  Sum_probs=21.2

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQR   47 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R   47 (58)
                      -+|| |.++.+|.   .+++..||..|+++=+
T Consensus        30 ~lPg-G~ve~gE~---~~~aa~REl~EEtGl~   57 (117)
T cd04691          30 NIPG-GHIEAGES---QEEALLREVQEELGVD   57 (117)
T ss_pred             ECcc-eeecCCCC---HHHHHHHHHHHHHCCC
Confidence            3566 77877663   5889999999998744


No 17 
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=33.46  E-value=37  Score=20.70  Aligned_cols=31  Identities=29%  Similarity=0.238  Sum_probs=23.6

Q ss_pred             ceecCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           14 LERLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        14 l~rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      .=-+|| |.++.+|-   .+++..|+..|+++=.+
T Consensus        27 ~w~lPg-G~ve~gEt---~~~aa~REl~EEtG~~~   57 (123)
T cd04671          27 KWYLPA-GRMEPGET---IEEAVKREVKEETGLDC   57 (123)
T ss_pred             eEECce-eecCCCCC---HHHHHHHHHHHHHCCee
Confidence            345787 88887663   58899999999987544


No 18 
>PRK15472 nucleoside triphosphatase NudI; Provisional
Probab=33.27  E-value=34  Score=20.81  Aligned_cols=27  Identities=37%  Similarity=0.570  Sum_probs=21.5

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQR   47 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R   47 (58)
                      +|| |.++-+|.   .+++..||..|++.=.
T Consensus        35 lPg-G~ve~gEs---~~~aa~REl~EEtGl~   61 (141)
T PRK15472         35 LSG-GGVEPGER---IEEALRREIREELGEQ   61 (141)
T ss_pred             CCc-ccCCCCCC---HHHHHHHHHHHHHCCc
Confidence            567 77888774   6789999999999844


No 19 
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily. MTH1, the mammalian counterpart of MutT, hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates, thereby preventing the incorporation of such oxygen radicals during replication. This is an important step in the repair mechanism in genomic and mitochondrial DNA.  Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity, and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. MTH1 is predominantly localized in the cytoplasm and mitochondria. Structurally, this enzyme adopts a similar fold to MutT despite low sequence similarity outside the conserved nudix motif. The most distinctive structural difference between MutT and MTH1 is the presence of a beta-hairpin, which is absent in MutT. This results in a m
Probab=33.26  E-value=37  Score=20.19  Aligned_cols=27  Identities=26%  Similarity=0.272  Sum_probs=20.9

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQ   46 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~   46 (58)
                      .+|| |.++.+|   -.+++..||..|++.=
T Consensus        29 ~~Pg-G~ve~gE---s~~~aa~RE~~EEtGl   55 (137)
T cd03427          29 NGPG-GKVEPGE---TPEECAIRELKEETGL   55 (137)
T ss_pred             eCCc-eeCCCCC---CHHHHHHHHHHHhhCe
Confidence            5676 7777776   4678999999999863


No 20 
>PRK00269 zipA cell division protein ZipA; Reviewed
Probab=32.78  E-value=37  Score=25.64  Aligned_cols=28  Identities=21%  Similarity=0.343  Sum_probs=21.4

Q ss_pred             echhHhhhHHHHHHHHHHHHHHHHHhhhhhcc
Q psy455           25 YDEEKAMIEDAMLRDQIERYNQRLRDAYLGFR   56 (58)
Q Consensus        25 fdee~A~~ED~~~re~~e~~~~R~refEdr~~   56 (58)
                      .|+++.-    +..+.++.|++|+++||.+.+
T Consensus       262 lDD~R~~----LT~q~ie~yRqrI~e~err~l  289 (293)
T PRK00269        262 KDDQRSV----LTAQTIEHYRQRIVEFERRAL  289 (293)
T ss_pred             ECCCCCc----CCHHHHHHHHHHHHHHHHHhh
Confidence            4555544    467889999999999998865


No 21 
>TIGR01702 CO_DH_cata carbon-monoxide dehydrogenase, catalytic subunit. This model represents the carbon-monoxide dehydrogenase catalytic subunit. This protein is related to prismane (also called hybrid cluster protein), a complex whose activity is not yet fully described; the two share similar sets of ligands to unusual metal-containing clusters.
Probab=30.75  E-value=38  Score=27.84  Aligned_cols=34  Identities=35%  Similarity=0.631  Sum_probs=26.2

Q ss_pred             eceecCCceeeeechhHhhhH--HHHHHHHHHHHHHH
Q psy455           13 DLERLDGVGCLEYDEEKAMIE--DAMLRDQIERYNQR   47 (58)
Q Consensus        13 dl~rldG~~~Lefdee~A~~E--D~~~re~~e~~~~R   47 (58)
                      +.-++||+..++||++.|. |  ..+.+.++|.+.+|
T Consensus       352 ~~a~~pGa~hi~~d~~~a~-e~A~~ii~~Aie~f~~r  387 (621)
T TIGR01702       352 DNAKIPGADHIPYDPEKAE-ETAKTIIRMAIEAFKER  387 (621)
T ss_pred             cccCCCCCeeeCCCcchHH-HHHHHHHHHHHhhcccc
Confidence            6778999999999999863 3  46677777766554


No 22 
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily. This class of enzymes is unique from other members of the superfamily in two aspects. First, it contains a modified Nudix signature sequence. The slight changes to the conserved sequence motif, GX5EX7REUXEEXGU, where U = I, L or V), are believed to contribute to the removal of all magnesium binding sites but one, retaining only the metal site that coordinates the pyrophosphate of the substrate. Secondly, it is not a pyrophosphatase that substitutes at a phosphorus; instead, it hydrolyzes nucleotide sugars such as GDP-mannose to GDP and mannose, cleaving the phosphoglycosyl bond by substituting at a carbon position. GDP-mannose provides mannosyl components for cell wall synthesis and is required for the synthesis of other glycosyl donors (such as GDP-fucose and colitose) for the cell wall. The importance of GDP-sugar hydrolase activities is thus close
Probab=30.75  E-value=46  Score=20.80  Aligned_cols=28  Identities=18%  Similarity=0.334  Sum_probs=21.4

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      +|| |.++.+|   -.+++..||..|+.+=.+
T Consensus        42 lPG-G~ve~gE---s~~~aa~RE~~EE~Gl~v   69 (144)
T cd03430          42 VPG-GRIRKNE---TLTEAFERIAKDELGLEF   69 (144)
T ss_pred             CCC-ceecCCC---CHHHHHHHHHHHHHCCCc
Confidence            666 7777766   678899999999987433


No 23 
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=30.53  E-value=45  Score=19.14  Aligned_cols=29  Identities=38%  Similarity=0.527  Sum_probs=22.1

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRLR   49 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~r   49 (58)
                      +|| |.++.++   -.+++..|+..|+++=...
T Consensus        27 ~Pg-G~ve~gE---t~~~aa~REl~EEtG~~~~   55 (120)
T cd04680          27 LPG-GGLERGE---TFAEAARRELLEELGIRLA   55 (120)
T ss_pred             CCC-CcCCCCC---CHHHHHHHHHHHHHCCccc
Confidence            676 7777776   3689999999999875543


No 24 
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only]
Probab=29.85  E-value=38  Score=18.60  Aligned_cols=27  Identities=33%  Similarity=0.356  Sum_probs=18.2

Q ss_pred             eeeeechhHhhhHHHHHHHHHHHHHHHHH
Q psy455           21 GCLEYDEEKAMIEDAMLRDQIERYNQRLR   49 (58)
Q Consensus        21 ~~Lefdee~A~~ED~~~re~~e~~~~R~r   49 (58)
                      |.++-++..  .+++..||..|+++=...
T Consensus        43 G~ve~~e~~--~~~aa~RE~~EEtGl~~~   69 (161)
T COG0494          43 GKVEPGEEL--PEEAAARELEEETGLRVK   69 (161)
T ss_pred             cccCCCCch--HHHHHHHHHHHHhCCeee
Confidence            445555555  344999999999875443


No 25 
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=28.47  E-value=51  Score=18.98  Aligned_cols=29  Identities=31%  Similarity=0.400  Sum_probs=21.2

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRLR   49 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~r   49 (58)
                      +|| |.++-++   ..+++.+|+..|+++=...
T Consensus        27 ~Pg-G~ve~~E---s~~~aa~REl~EEtGl~~~   55 (118)
T cd04690          27 LPG-GKIEAGE---TPLQALIRELSEELGLDLD   55 (118)
T ss_pred             CCC-CccCCCC---CHHHHHHHHHHHHHCCccC
Confidence            566 6666655   4689999999999875443


No 26 
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus. Experimental evidence implicates the chromo domain in the binding activity of these proteins to methylated histone tails and maybe RNA. May occur as single instance, in a tandem arrangement or followd by a related "chromo shadow" domain.
Probab=28.20  E-value=34  Score=17.57  Aligned_cols=10  Identities=30%  Similarity=0.873  Sum_probs=7.8

Q ss_pred             eEEeeeeeee
Q psy455            4 VCVRWRGWLD   13 (58)
Q Consensus         4 VcV~wrG~~d   13 (58)
                      +.|.|+||-.
T Consensus        22 y~VkW~g~~~   31 (55)
T cd00024          22 YLVKWKGYSY   31 (55)
T ss_pred             EEEEECCCCC
Confidence            5799999753


No 27 
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=27.74  E-value=58  Score=19.13  Aligned_cols=29  Identities=28%  Similarity=0.473  Sum_probs=21.8

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      -+|| |.++-+|   -.+++..|+..|+++=.+
T Consensus        30 ~~Pg-G~ve~gE---s~~~aa~RE~~EEtGl~~   58 (130)
T cd04681          30 DLPG-GFVDPGE---SAEEALIREIREETGLKV   58 (130)
T ss_pred             eCCc-eeecCCC---CHHHHHHHHHHHHhCCcc
Confidence            3576 7787776   378899999999987443


No 28 
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities. Like other enzymes belonging to this superfamily, it requires a divalent cation, in this case Mg2+, for its activity. It also contains a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. In general, substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is us
Probab=27.52  E-value=48  Score=20.53  Aligned_cols=30  Identities=30%  Similarity=0.485  Sum_probs=22.3

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRLR   49 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~r   49 (58)
                      -+|| |.++-+|   -.+++..||..|+++=++.
T Consensus        42 ~lPg-G~ve~gE---t~~~aa~REl~EEtGl~~~   71 (142)
T cd04700          42 HIPS-GAVEDGE---FPQDAAVREACEETGLRVR   71 (142)
T ss_pred             ECCc-eecCCCC---CHHHHHHHHHHHhhCceee
Confidence            4565 7777666   3788999999999885544


No 29 
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=27.40  E-value=1.2e+02  Score=17.73  Aligned_cols=29  Identities=28%  Similarity=0.460  Sum_probs=21.5

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      -+|| |.++.+|.   .+++..|+..|++.=.+
T Consensus        33 ~~Pg-G~v~~gEt---~~~aa~REl~EE~Gi~~   61 (132)
T cd04677          33 GLPG-GAMELGES---LEETARRELKEETGLEV   61 (132)
T ss_pred             ECCe-eecCCCCC---HHHHHHHHHHHHhCCee
Confidence            4566 67766663   78899999999987443


No 30 
>PF04380 BMFP:  Membrane fusogenic activity;  InterPro: IPR007475 BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS. BMFP interacts with phospholipid vesicles though the predicted amphipathic alpha-helix induced in the N-terminal half of the protein and promotes aggregation and fusion of vesicles in vitro.
Probab=27.35  E-value=83  Score=18.72  Aligned_cols=36  Identities=33%  Similarity=0.401  Sum_probs=21.4

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHHHhhhhh
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRLRDAYLG   54 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~refEdr   54 (58)
                      ||=+..=|||.+++..  ..+|+.++..-.|+.++|.+
T Consensus        44 ldlVtREEFd~q~~~L--~~~r~kl~~LEarl~~LE~~   79 (79)
T PF04380_consen   44 LDLVTREEFDAQKAVL--ARTREKLEALEARLAALEAQ   79 (79)
T ss_pred             CCCCcHHHHHHHHHHH--HHHHHHHHHHHHHHHHHhcC
Confidence            3334444677766653  33566677777777777653


No 31 
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA.  ACS forms a heterotetramer with carbon monoxide dehydrogenase (CODH) consisting of two ACS and two CODH subunits. CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP).  ACS has three structural domains, an N-terminal rossman fold domain with a helical region at its N-terminus which interacts with CODH, and two alpha + beta fold domains.  A Ni-Fe-S center referred to as the A-cluster is located in the C-terminal domain. A large cavity exists between the three domains which may bind CoA.
Probab=27.34  E-value=62  Score=27.01  Aligned_cols=28  Identities=25%  Similarity=0.278  Sum_probs=23.2

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQR   47 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R   47 (58)
                      .+||+  +.||++.|..  .+.+.+++.+..|
T Consensus       321 glpga--~~~~~~k~~e--~~v~~Ai~~~~~r  348 (731)
T cd01916         321 KIPGV--LILDPEKVGE--VAVEVAMAVKPKR  348 (731)
T ss_pred             CCCce--EecChhhhhH--HHHHHHHHhhhhh
Confidence            47888  9999999964  8888899888765


No 32 
>KOG3039|consensus
Probab=26.43  E-value=59  Score=24.87  Aligned_cols=29  Identities=17%  Similarity=0.276  Sum_probs=18.8

Q ss_pred             echhHhhhHHHHHHHHHHHHHHHHHhhhh
Q psy455           25 YDEEKAMIEDAMLRDQIERYNQRLRDAYL   53 (58)
Q Consensus        25 fdee~A~~ED~~~re~~e~~~~R~refEd   53 (58)
                      |..++-+.||...+.++-|...|+.+|-.
T Consensus        88 yekqrr~eed~e~qra~~q~~~~~~eF~~  116 (303)
T KOG3039|consen   88 YEKQRRAEEDKEEQRAMSQKARRLDEFDQ  116 (303)
T ss_pred             HHHHHHhhhhHHHHHHHhhhHHHHHHHHh
Confidence            34445566777777777777777776643


No 33 
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate sp
Probab=26.17  E-value=54  Score=19.27  Aligned_cols=28  Identities=32%  Similarity=0.437  Sum_probs=21.1

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      +|| |.++.+|   -.+++..||..|+++=..
T Consensus        27 lPG-G~ve~gE---t~~~aa~REl~EEtGl~~   54 (125)
T cd04689          27 LPG-GHVEPGE---TAENALRRELQEELGVAV   54 (125)
T ss_pred             CCC-CcCCCCC---CHHHHHHHHHHHHhCcee
Confidence            676 6676665   478899999999987443


No 34 
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamil
Probab=25.84  E-value=58  Score=19.89  Aligned_cols=30  Identities=30%  Similarity=0.344  Sum_probs=23.1

Q ss_pred             eecCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           15 ERLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        15 ~rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      =-+|| |.++-+|.   .+++..|+..|+++=.+
T Consensus        28 w~lPg-G~ve~gE~---~~~aa~REl~EEtGl~~   57 (138)
T cd03674          28 WLQPG-GHIDPDES---LLEAALRELREETGIEL   57 (138)
T ss_pred             EECCc-eecCCCCC---HHHHHHHHHHHHHCCCc
Confidence            35676 88887764   78899999999987543


No 35 
>cd01915 CODH Carbon monoxide dehydrogenase (CODH) is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA, respectively. CODH has two types of metal clusters, a cubane [Fe4-S4] center (B-cluster) similar to that of hybrid cluster protein (HCP) and a Ni-Fe-S center (C-cluster) where carbon monoxide oxidation occurs.  Bifunctional CODH forms a heterotetramer with acetyl-CoA synthase (ACS) consisting of two CODH and two ACS subunits while monofunctional CODH forms a homodimer. Bifunctional CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP), while monofunctional CODH oxidizes carbon monoxide to carbon dioxide. CODH and ACS each have a metal cluster referred to as the C- and A-clusters, respectively.
Probab=25.73  E-value=64  Score=26.45  Aligned_cols=35  Identities=26%  Similarity=0.567  Sum_probs=26.2

Q ss_pred             eceecCCceeeeechhHhh-hHHHHHHHHHHHHHHH
Q psy455           13 DLERLDGVGCLEYDEEKAM-IEDAMLRDQIERYNQR   47 (58)
Q Consensus        13 dl~rldG~~~Lefdee~A~-~ED~~~re~~e~~~~R   47 (58)
                      +.-++||+-.++||++.|. .=..+.+.+++.+.+|
T Consensus       347 ~~a~~pGa~hi~~~~~~a~e~A~~ii~~Aie~f~~R  382 (613)
T cd01915         347 DVAKIPGAEHIDFDPEEADESAKEIIRMAIEAFKRR  382 (613)
T ss_pred             cccCCCCceeecCCccchHHHHHHHHHHHHhhhhhc
Confidence            4568999999999988772 2245677788777665


No 36 
>PF01899 MNHE:  Na+/H+ ion antiporter subunit;  InterPro: IPR002758  This family contains both characterised and uncharacterised bacterial and archaeal proteins; some of which are possibly transmembrane proteins involved in Na+/H+ or K+/H+ transport. The characterised proteins are mnhE (Staphylococcus aureus) and phaE. (Rhizobium meliloti), which are subunits of the Na+/H+ or K+/H+ antiporters, that are required for sodium and potassium excretion, respectively [, ].; GO: 0008324 cation transmembrane transporter activity, 0006812 cation transport, 0016021 integral to membrane
Probab=25.42  E-value=1.2e+02  Score=19.46  Aligned_cols=14  Identities=14%  Similarity=0.337  Sum_probs=11.0

Q ss_pred             ecCCceeeeechhH
Q psy455           16 RLDGVGCLEYDEEK   29 (58)
Q Consensus        16 rldG~~~Lefdee~   29 (58)
                      -+||.-.+++|++.
T Consensus       111 LTPGTltv~i~~~~  124 (156)
T PF01899_consen  111 LTPGTLTVDIDDDR  124 (156)
T ss_pred             ccCCcEEEEEECCC
Confidence            46888888888877


No 37 
>COG1422 Predicted membrane protein [Function unknown]
Probab=25.36  E-value=61  Score=23.31  Aligned_cols=18  Identities=6%  Similarity=0.346  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHhhhhhc
Q psy455           38 RDQIERYNQRLRDAYLGF   55 (58)
Q Consensus        38 re~~e~~~~R~refEdr~   55 (58)
                      +|.|++++.+++||++.+
T Consensus        71 ~ekm~~~qk~m~efq~e~   88 (201)
T COG1422          71 QEKMKELQKMMKEFQKEF   88 (201)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455556666666665544


No 38 
>PF07889 DUF1664:  Protein of unknown function (DUF1664);  InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function. The region featured in this family is approximately 100 amino acids long. 
Probab=24.95  E-value=35  Score=22.57  Aligned_cols=7  Identities=43%  Similarity=1.768  Sum_probs=5.2

Q ss_pred             EEeeeee
Q psy455            5 CVRWRGW   11 (58)
Q Consensus         5 cV~wrG~   11 (58)
                      ++.||||
T Consensus        22 Y~wwKGw   28 (126)
T PF07889_consen   22 YMWWKGW   28 (126)
T ss_pred             eeeecCC
Confidence            5668887


No 39 
>PF13206 VSG_B:  Trypanosomal VSG domain
Probab=24.69  E-value=1e+02  Score=21.35  Aligned_cols=22  Identities=27%  Similarity=0.668  Sum_probs=14.9

Q ss_pred             ceeEEeeeeeeeceecCCceee
Q psy455            2 NGVCVRWRGWLDLERLDGVGCL   23 (58)
Q Consensus         2 NgVcV~wrG~~dl~rldG~~~L   23 (58)
                      ||+||.+..+..-..+.++--+
T Consensus       300 ~~~CV~Y~~~~~~~~~~~IpW~  321 (351)
T PF13206_consen  300 NGICVNYKNYSAAKGLGKIPWL  321 (351)
T ss_pred             CceEEEeCCCcCccCCCCCchH
Confidence            6899999997765544444433


No 40 
>PF04802 SMK-1:  Component of IIS longevity pathway SMK-1;  InterPro: IPR006887 This is a conserved region which characterises a number of eukaryotic proteins of unknown function.
Probab=24.21  E-value=26  Score=24.26  Aligned_cols=13  Identities=54%  Similarity=0.636  Sum_probs=10.9

Q ss_pred             CceeeeechhHhh
Q psy455           19 GVGCLEYDEEKAM   31 (58)
Q Consensus        19 G~~~Lefdee~A~   31 (58)
                      =+|+||||++...
T Consensus        57 vvG~LEYDp~~~~   69 (193)
T PF04802_consen   57 VVGILEYDPEFPQ   69 (193)
T ss_pred             HhhhhccCCcccc
Confidence            3799999999765


No 41 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=23.71  E-value=82  Score=23.41  Aligned_cols=11  Identities=27%  Similarity=0.800  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHH
Q psy455           38 RDQIERYNQRL   48 (58)
Q Consensus        38 re~~e~~~~R~   48 (58)
                      .|.|++|..|+
T Consensus        49 sQRF~EYdErm   59 (299)
T PF02009_consen   49 SQRFEEYDERM   59 (299)
T ss_pred             HHHHHHHHhhh
Confidence            44444444444


No 42 
>COG2980 RlpB Rare lipoprotein B [Cell envelope biogenesis, outer membrane]
Probab=23.47  E-value=1.2e+02  Score=21.52  Aligned_cols=29  Identities=34%  Similarity=0.438  Sum_probs=24.3

Q ss_pred             eechhHhhhHHHHHHHHHHHHHHHHHhhh
Q psy455           24 EYDEEKAMIEDAMLRDQIERYNQRLRDAY   52 (58)
Q Consensus        24 efdee~A~~ED~~~re~~e~~~~R~refE   52 (58)
                      -=|.|++.+.+...+++.+|.-+|+-...
T Consensus       133 aK~~E~e~l~~EMR~daa~QLvrrl~sl~  161 (178)
T COG2980         133 AKDEEREMLWNEMRRDAAEQLVRRLASLR  161 (178)
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            34789999999999999999999986543


No 43 
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=23.39  E-value=64  Score=18.45  Aligned_cols=27  Identities=33%  Similarity=0.533  Sum_probs=19.5

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQR   47 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R   47 (58)
                      +|| |.++.+|   -.+++..|+..|++.=.
T Consensus        29 ~Pg-G~ie~gE---~~~~aa~RE~~EEtGl~   55 (122)
T cd04673          29 FPG-GKVELGE---TLEQAALRELLEETGLE   55 (122)
T ss_pred             CCC-cccCCCC---CHHHHHHHHHHHhhCcE
Confidence            454 6666665   46889999999998643


No 44 
>PF12344 UvrB:  Ultra-violet resistance protein B;  InterPro: IPR024759 This entry represents a domain found towards the C terminus of the ultraviolet resistance protein B (UvrB). UvrB conveys mutational resistance against UV light to various different species []. This domain is approximately 40 amino acids in length and contains two conserved sequence motifs: YAD and RRR.; PDB: 2D7D_A 2NMV_A 3UWX_B 1D2M_A 1C4O_A 2FDC_A 1D9Z_A 1T5L_B 1D9X_A.
Probab=22.79  E-value=89  Score=17.51  Aligned_cols=12  Identities=25%  Similarity=0.512  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHH
Q psy455           36 MLRDQIERYNQR   47 (58)
Q Consensus        36 ~~re~~e~~~~R   47 (58)
                      .|+.+|+++++|
T Consensus         9 SM~~ai~eT~rR   20 (44)
T PF12344_consen    9 SMQKAIDETNRR   20 (44)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            478888888776


No 45 
>smart00298 CHROMO Chromatin organization modifier domain.
Probab=22.59  E-value=50  Score=16.77  Aligned_cols=11  Identities=27%  Similarity=0.730  Sum_probs=8.1

Q ss_pred             eEEeeeeeeec
Q psy455            4 VCVRWRGWLDL   14 (58)
Q Consensus         4 VcV~wrG~~dl   14 (58)
                      +.|.|+|+-..
T Consensus        20 ylVkW~g~~~~   30 (55)
T smart00298       20 YLVKWKGYSYS   30 (55)
T ss_pred             EEEEECCCCCc
Confidence            67999996543


No 46 
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=22.26  E-value=79  Score=18.59  Aligned_cols=29  Identities=31%  Similarity=0.384  Sum_probs=22.5

Q ss_pred             ecCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           16 RLDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        16 rldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      -+|| |.++-+|   -.+++..|+..|+++=.+
T Consensus        32 ~~Pg-G~ve~gE---~~~~aa~RE~~EE~Gl~~   60 (122)
T cd04682          32 DLPG-GHREGGE---TPLECVLRELLEEIGLTL   60 (122)
T ss_pred             eCCC-ccccCCC---CHHHHHHHHHHHHhCCcc
Confidence            4677 8887665   367899999999998654


No 47 
>PF05644 Miff:  Mitochondrial and peroxisomal fission factor Mff;  InterPro: IPR008518 This family consists of several eukaryotic proteins of unknown function.
Probab=22.15  E-value=1.2e+02  Score=22.03  Aligned_cols=29  Identities=31%  Similarity=0.448  Sum_probs=23.2

Q ss_pred             chhHhhhHHHHHHHHHHHHHHHHHhhhhh
Q psy455           26 DEEKAMIEDAMLRDQIERYNQRLRDAYLG   54 (58)
Q Consensus        26 dee~A~~ED~~~re~~e~~~~R~refEdr   54 (58)
                      -++..-.|-+.+|.||...|+|++.+|+.
T Consensus       189 ~~~~~~~~~~~lrrQi~klnrRl~~lE~~  217 (246)
T PF05644_consen  189 SDEEEVVDAASLRRQIIKLNRRLQALEEE  217 (246)
T ss_pred             CcchhhhHHHHHHHHHHHHhHHHHHHHHH
Confidence            34445566778999999999999999874


No 48 
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate s
Probab=21.37  E-value=79  Score=18.66  Aligned_cols=28  Identities=21%  Similarity=0.109  Sum_probs=20.9

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      +|| |.++-+|.   .+++..|+..|+++=.+
T Consensus        32 ~Pg-G~ve~~Es---~~~aa~RE~~EE~Gl~~   59 (129)
T cd04664          32 SVT-GGIEDGES---PAEAARREVAEETGLDP   59 (129)
T ss_pred             ccC-cccCCCCC---HHHHHHHHHHHHHCCCh
Confidence            466 66777764   47899999999987543


No 49 
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=21.35  E-value=75  Score=18.70  Aligned_cols=28  Identities=32%  Similarity=0.604  Sum_probs=20.1

Q ss_pred             cCCceeeeechhHhhhHHHHHHHHHHHHHHHH
Q psy455           17 LDGVGCLEYDEEKAMIEDAMLRDQIERYNQRL   48 (58)
Q Consensus        17 ldG~~~Lefdee~A~~ED~~~re~~e~~~~R~   48 (58)
                      ++| |.++-+|.   .+++..|+..|+++=.+
T Consensus        32 ~PG-G~ve~gEt---~~~Aa~REl~EE~Gl~~   59 (129)
T cd04678          32 LPG-GHLEFGES---FEECAAREVLEETGLHI   59 (129)
T ss_pred             CCc-ccccCCCC---HHHHHHHHHHHHhCCcc
Confidence            355 66666663   77899999999987443


No 50 
>KOG1602|consensus
Probab=20.99  E-value=51  Score=24.83  Aligned_cols=16  Identities=44%  Similarity=0.509  Sum_probs=13.3

Q ss_pred             CceeEEeeeeeeeceecC
Q psy455            1 MNGVCVRWRGWLDLERLD   18 (58)
Q Consensus         1 lNgVcV~wrG~~dl~rld   18 (58)
                      .+|||++.-|  |+..|+
T Consensus       124 ~~gvririiG--dlslL~  139 (271)
T KOG1602|consen  124 KYGVRIRVIG--DLSLLP  139 (271)
T ss_pred             hcCeEEEEEc--chhhCC
Confidence            4799999999  777775


No 51 
>PRK14839 undecaprenyl pyrophosphate synthase; Provisional
Probab=20.71  E-value=54  Score=23.76  Aligned_cols=15  Identities=40%  Similarity=0.512  Sum_probs=12.0

Q ss_pred             ceeEEeeeeeeeceecC
Q psy455            2 NGVCVRWRGWLDLERLD   18 (58)
Q Consensus         2 NgVcV~wrG~~dl~rld   18 (58)
                      |||||++-|  |++.||
T Consensus        95 ~~irvr~iG--d~~~Lp  109 (239)
T PRK14839         95 NGVRLTVIG--RRDRLP  109 (239)
T ss_pred             CCCEEEEEe--ChhhCC
Confidence            689999999  666665


No 52 
>PRK12651 putative monovalent cation/H+ antiporter subunit E; Reviewed
Probab=20.69  E-value=1.6e+02  Score=19.25  Aligned_cols=14  Identities=14%  Similarity=0.280  Sum_probs=11.3

Q ss_pred             ecCCceeeeechhH
Q psy455           16 RLDGVGCLEYDEEK   29 (58)
Q Consensus        16 rldG~~~Lefdee~   29 (58)
                      -+||.-.+++|+++
T Consensus       112 LtPGTl~vdv~~~~  125 (158)
T PRK12651        112 LTPGTLTLDVSDDR  125 (158)
T ss_pred             CCCCeEEEEEeCCC
Confidence            47888899888876


No 53 
>TIGR00055 uppS undecaprenyl diphosphate synthase. Alternate name: undecaprenyl pyrophosphate synthetase. Activity has been demonstrated experimentally for members of this family from Micrococcus luteus, E. coli, Haemophilus influenzae, and Streptococcus pneumoniae.
Probab=20.67  E-value=54  Score=23.37  Aligned_cols=15  Identities=40%  Similarity=0.481  Sum_probs=12.3

Q ss_pred             ceeEEeeeeeeeceecC
Q psy455            2 NGVCVRWRGWLDLERLD   18 (58)
Q Consensus         2 NgVcV~wrG~~dl~rld   18 (58)
                      |||+|++-|  |++.||
T Consensus        85 ~~irvr~iG--d~~~Lp   99 (226)
T TIGR00055        85 YNVRIRIIG--DLSLLS   99 (226)
T ss_pred             CCCEEEEEe--ChhhCC
Confidence            689999999  777666


No 54 
>cd07469 CRD_TK_ROR_related Cysteine-rich domain of proteins similar to tyrosine kinase-like orphan receptors. The cysteine-rich domain (CRD) is an essential part of the tyrosine kinase-like orphan receptor (Ror) proteins, a conserved family of tyrosine kinases that function in various processes, including neuronal and skeletal development, cell polarity, and cell movement. Ror proteins are receptors of Wnt proteins, which are key players in a number of fundamental cellular processes in embryogenesis and postnatal development. In different cellular contexts, Ror proteins can either activate or repress transcription of Wnt target genes, and can modulate Wnt signaling by sequestering Wnt ligands.
Probab=20.49  E-value=44  Score=22.84  Aligned_cols=33  Identities=21%  Similarity=0.273  Sum_probs=26.6

Q ss_pred             ceeEEeeeeeeeceecCCceeeeechhHhhhHH
Q psy455            2 NGVCVRWRGWLDLERLDGVGCLEYDEEKAMIED   34 (58)
Q Consensus         2 NgVcV~wrG~~dl~rldG~~~Lefdee~A~~ED   34 (58)
                      .|.|+..+|-+=-+-|.|.+.+=|....+..++
T Consensus         2 ~GyC~~Y~G~iC~~yL~~~~~V~~~~s~~~~~~   34 (147)
T cd07469           2 AGYCATYRGEVCRAYLSNDALVWFNSSYADPEG   34 (147)
T ss_pred             CCccccccchHHHHHhCCCcEEEEecCCCCHHH
Confidence            599999999998899998888877776655553


Done!