Query         psy4573
Match_columns 306
No_of_seqs    177 out of 1560
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 20:28:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4573.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4573hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074|consensus               99.9 8.5E-29 1.8E-33  221.6   5.9  191  100-290   606-936 (958)
  2 KOG2462|consensus               99.9 1.4E-28   3E-33  195.4   6.4  137  126-283   129-265 (279)
  3 KOG2462|consensus               99.9 2.9E-27 6.4E-32  187.9   5.8  124  177-302   130-256 (279)
  4 KOG3608|consensus               99.9 4.4E-26 9.6E-31  185.8  11.4  223   40-287   131-378 (467)
  5 KOG3608|consensus               99.9 1.4E-25   3E-30  182.9   9.7  236   43-301    69-364 (467)
  6 KOG1074|consensus               99.9 1.6E-24 3.5E-29  194.4   3.6   81  177-257   605-692 (958)
  7 KOG3623|consensus               99.9 9.2E-24   2E-28  186.6   6.6  109   43-151   210-333 (1007)
  8 KOG3623|consensus               99.8 6.4E-21 1.4E-25  168.9   6.5  119  100-227   211-331 (1007)
  9 KOG3576|consensus               99.7 3.9E-19 8.5E-24  134.7   2.2  115  175-289   115-240 (267)
 10 KOG3576|consensus               99.7   9E-18   2E-22  127.4   3.0  119   38-156   112-241 (267)
 11 PLN03086 PRLI-interacting fact  99.3 1.3E-11 2.8E-16  110.8   9.5  147  128-287   408-566 (567)
 12 PLN03086 PRLI-interacting fact  99.2 1.6E-11 3.4E-16  110.3   5.0   93  204-302   452-554 (567)
 13 PHA00733 hypothetical protein   99.2 2.7E-11 5.9E-16   89.0   4.5   95  191-287    26-125 (128)
 14 PHA00733 hypothetical protein   99.1 2.9E-10 6.3E-15   83.6   5.5   80  177-259    40-125 (128)
 15 KOG3993|consensus               99.0 6.2E-11 1.3E-15  100.1   1.1  199   71-289   267-486 (500)
 16 PHA02768 hypothetical protein;  98.8 1.4E-09 2.9E-14   65.8   1.4   41  234-276     6-46  (55)
 17 PHA02768 hypothetical protein;  98.8   3E-09 6.5E-14   64.3   1.3   42  206-249     6-47  (55)
 18 KOG3993|consensus               98.5 2.8E-08 6.1E-13   84.4   1.8  188   42-229   266-482 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.5 9.1E-08   2E-12   49.4   1.9   20  223-242     4-23  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.5 5.9E-08 1.3E-12   50.1   1.0   25  248-272     1-25  (26)
 21 PHA00616 hypothetical protein   98.4 6.8E-08 1.5E-12   55.5   1.2   32  234-265     2-33  (44)
 22 PHA00732 hypothetical protein   98.3 4.7E-07   1E-11   60.3   2.3   46  205-256     1-47  (79)
 23 PHA00616 hypothetical protein   98.3   6E-07 1.3E-11   51.7   2.3   33  261-293     1-33  (44)
 24 PF05605 zf-Di19:  Drought indu  98.2 2.5E-06 5.3E-11   52.8   4.2   51  233-286     2-54  (54)
 25 PHA00732 hypothetical protein   98.1 2.1E-06 4.6E-11   57.2   3.1   46  177-228     1-47  (79)
 26 PF05605 zf-Di19:  Drought indu  97.9 1.7E-05 3.7E-10   49.0   4.3   49  206-257     3-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  97.8 1.2E-05 2.6E-10   40.1   1.2   20  235-254     2-21  (23)
 28 PF00096 zf-C2H2:  Zinc finger,  97.7 3.6E-05 7.8E-10   38.4   2.1   22  178-199     1-22  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.6 2.7E-05 5.8E-10   39.2   1.4   24  262-285     1-24  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.9E-05 8.5E-10   39.9   1.5   24  234-257     2-25  (27)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.5 5.1E-05 1.1E-09   38.1   1.6   24  234-257     1-24  (24)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.5   5E-05 1.1E-09   53.6   1.8   20  180-199     2-21  (100)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.4 8.1E-05 1.8E-09   52.5   2.0   73   45-122     1-73  (100)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.4 7.7E-05 1.7E-09   38.8   1.0   26  261-286     1-26  (27)
 35 COG5189 SFP1 Putative transcri  97.2 0.00014   3E-09   60.1   0.9   53  230-282   346-419 (423)
 36 PF13909 zf-H2C2_5:  C2H2-type   96.9  0.0003 6.6E-09   35.3   0.7   24  262-286     1-24  (24)
 37 PF09237 GAGA:  GAGA factor;  I  96.7  0.0013 2.7E-08   38.9   1.9   24  234-257    25-48  (54)
 38 smart00355 ZnF_C2H2 zinc finge  96.7  0.0017 3.6E-08   32.9   2.2   19  236-254     3-21  (26)
 39 smart00355 ZnF_C2H2 zinc finge  96.5  0.0021 4.6E-08   32.5   2.1   24  262-285     1-24  (26)
 40 PF09237 GAGA:  GAGA factor;  I  96.5  0.0021 4.6E-08   37.9   2.1   34  256-289    19-52  (54)
 41 COG5236 Uncharacterized conser  96.4  0.0072 1.6E-07   50.8   5.6  128   43-200   151-304 (493)
 42 PF13909 zf-H2C2_5:  C2H2-type   96.4  0.0018 3.9E-08   32.4   1.3   23  234-257     1-23  (24)
 43 COG5189 SFP1 Putative transcri  96.2  0.0014   3E-08   54.4   0.4   51   97-147   347-418 (423)
 44 KOG1146|consensus               96.1   0.003 6.5E-08   62.1   1.9  111   41-154   463-616 (1406)
 45 PF12874 zf-met:  Zinc-finger o  96.0  0.0042 9.1E-08   31.4   1.6   22   44-65      1-22  (25)
 46 PF12874 zf-met:  Zinc-finger o  96.0  0.0054 1.2E-07   31.0   1.9   22  178-199     1-22  (25)
 47 PRK04860 hypothetical protein;  95.9  0.0042 9.1E-08   47.5   1.7   34  206-243   120-153 (160)
 48 PRK04860 hypothetical protein;  95.9  0.0042 9.1E-08   47.5   1.6   37  177-217   119-155 (160)
 49 KOG2785|consensus               95.6   0.036 7.7E-07   47.6   6.1   51  233-283   166-242 (390)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0035 7.7E-08   32.4   0.1   21  262-282     2-22  (27)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  95.5   0.005 1.1E-07   31.8   0.6   22  234-255     2-23  (27)
 52 KOG2231|consensus               95.3    0.04 8.6E-07   51.4   6.0  107  179-289   117-240 (669)
 53 KOG2482|consensus               94.6   0.098 2.1E-06   44.2   6.0  153  126-284   143-357 (423)
 54 KOG2231|consensus               94.6   0.092   2E-06   49.1   6.4   22  101-122   184-205 (669)
 55 TIGR00622 ssl1 transcription f  94.3   0.079 1.7E-06   37.6   4.0   76  177-256    15-104 (112)
 56 KOG2785|consensus               94.1   0.094   2E-06   45.1   4.9   51  205-255   166-242 (390)
 57 PF13913 zf-C2HC_2:  zinc-finge  94.0   0.038 8.2E-07   27.9   1.5   20  262-282     3-22  (25)
 58 KOG2482|consensus               93.9   0.087 1.9E-06   44.5   4.3   50   44-93    145-217 (423)
 59 PF12013 DUF3505:  Protein of u  93.5   0.096 2.1E-06   37.5   3.5   25  262-286    81-109 (109)
 60 COG5236 Uncharacterized conser  93.4    0.12 2.6E-06   43.8   4.2  135  127-287   151-307 (493)
 61 KOG1146|consensus               92.5   0.041 8.8E-07   54.6   0.4   56  228-283   460-540 (1406)
 62 cd00350 rubredoxin_like Rubred  92.3   0.092   2E-06   28.5   1.4   10  206-215     2-11  (33)
 63 smart00451 ZnF_U1 U1-like zinc  92.0    0.13 2.8E-06   28.1   1.9   23   43-65      3-25  (35)
 64 smart00451 ZnF_U1 U1-like zinc  92.0    0.15 3.3E-06   27.8   2.2   23  177-199     3-25  (35)
 65 TIGR00622 ssl1 transcription f  91.8    0.46   1E-05   33.8   4.8   21  126-146    14-34  (112)
 66 KOG2893|consensus               91.6   0.058 1.3E-06   43.1   0.2   42  179-224    12-53  (341)
 67 COG4049 Uncharacterized protei  91.2    0.13 2.8E-06   31.0   1.3   31  256-286    12-42  (65)
 68 COG5048 FOG: Zn-finger [Genera  90.5   0.054 1.2E-06   48.8  -1.1  121  176-296   288-453 (467)
 69 PF12013 DUF3505:  Protein of u  90.1    0.53 1.1E-05   33.6   4.1   71  177-258    11-109 (109)
 70 KOG4173|consensus               88.9    0.25 5.5E-06   38.7   1.7   78   71-151    79-170 (253)
 71 COG4049 Uncharacterized protei  87.4    0.28 6.1E-06   29.6   0.9   26  176-201    16-41  (65)
 72 KOG2893|consensus               86.1     0.2 4.2E-06   40.2  -0.3   38  208-249    13-50  (341)
 73 PF09538 FYDLN_acid:  Protein o  85.8    0.63 1.4E-05   33.1   2.1   31  177-218     9-39  (108)
 74 COG5048 FOG: Zn-finger [Genera  85.8    0.25 5.3E-06   44.5   0.1   59   38-96     28-88  (467)
 75 KOG4173|consensus               85.5    0.39 8.5E-06   37.7   1.0   76  177-255    79-168 (253)
 76 cd00729 rubredoxin_SM Rubredox  85.3    0.49 1.1E-05   25.8   1.1   10  206-215     3-12  (34)
 77 PHA00626 hypothetical protein   83.9    0.83 1.8E-05   27.7   1.7   14  177-190    23-36  (59)
 78 PF13717 zinc_ribbon_4:  zinc-r  83.3    0.78 1.7E-05   25.4   1.4   11  177-187    25-35  (36)
 79 PF10571 UPF0547:  Uncharacteri  83.3    0.78 1.7E-05   23.3   1.2    8  208-215    17-24  (26)
 80 PF09723 Zn-ribbon_8:  Zinc rib  82.9     0.7 1.5E-05   26.6   1.1   29  156-185     6-34  (42)
 81 PF13719 zinc_ribbon_5:  zinc-r  82.2     0.8 1.7E-05   25.5   1.1   11  177-187    25-35  (37)
 82 PRK14890 putative Zn-ribbon RN  81.5    0.85 1.8E-05   28.2   1.2   10  204-213    47-56  (59)
 83 TIGR02098 MJ0042_CXXC MJ0042 f  80.5    0.97 2.1E-05   25.2   1.1    9  178-186    26-34  (38)
 84 smart00834 CxxC_CXXC_SSSS Puta  80.3    0.99 2.1E-05   25.6   1.1    9  177-185    26-34  (41)
 85 COG2888 Predicted Zn-ribbon RN  78.4     1.1 2.5E-05   27.5   1.0   32  177-213    27-58  (61)
 86 PF09986 DUF2225:  Uncharacteri  78.2    0.45 9.8E-06   38.6  -1.0   43  204-246     4-61  (214)
 87 PF02892 zf-BED:  BED zinc fing  76.1     1.2 2.6E-05   25.8   0.7   24  261-284    16-43  (45)
 88 PRK00398 rpoP DNA-directed RNA  75.8     1.8 3.8E-05   25.4   1.3    7  178-184    22-28  (46)
 89 PF02176 zf-TRAF:  TRAF-type zi  75.7     1.5 3.3E-05   27.2   1.1   39  233-271     9-52  (60)
 90 COG1592 Rubrerythrin [Energy p  75.5     1.7 3.6E-05   33.5   1.4   23  233-268   134-156 (166)
 91 smart00734 ZnF_Rad18 Rad18-lik  74.9       3 6.4E-05   21.2   1.8   20  178-198     2-21  (26)
 92 KOG2186|consensus               74.9     1.8 3.9E-05   35.3   1.5   46   44-92      4-49  (276)
 93 PRK00464 nrdR transcriptional   74.1    0.75 1.6E-05   35.0  -0.7   14  234-247    29-42  (154)
 94 TIGR02300 FYDLN_acid conserved  74.1     2.8   6E-05   30.5   2.2   31  177-218     9-39  (129)
 95 PF03604 DNA_RNApol_7kD:  DNA d  72.6     2.6 5.6E-05   22.6   1.3    9  177-185    17-25  (32)
 96 KOG2807|consensus               71.5       4 8.6E-05   34.7   2.8   36   40-89    273-308 (378)
 97 PF09986 DUF2225:  Uncharacteri  71.2    0.97 2.1E-05   36.7  -0.8   22   41-62      3-24  (214)
 98 TIGR00373 conserved hypothetic  70.7     4.1 8.9E-05   31.3   2.6   31  203-242   107-137 (158)
 99 smart00531 TFIIE Transcription  70.3     5.9 0.00013   30.0   3.4   14  204-217    98-111 (147)
100 TIGR01206 lysW lysine biosynth  70.3     3.2 6.8E-05   25.4   1.5   12  176-187    21-32  (54)
101 TIGR02605 CxxC_CxxC_SSSS putat  68.5     2.9 6.2E-05   25.2   1.1    9  129-137     7-15  (52)
102 TIGR00373 conserved hypothetic  67.9     4.8  0.0001   30.9   2.5   34  229-271   105-138 (158)
103 KOG2807|consensus               67.4       7 0.00015   33.3   3.4   25  260-284   344-368 (378)
104 smart00531 TFIIE Transcription  66.2     4.6 9.9E-05   30.6   2.0   38  230-271    96-133 (147)
105 PRK06266 transcription initiat  65.0     5.2 0.00011   31.4   2.2   30  204-242   116-145 (178)
106 KOG2186|consensus               64.2     3.3 7.3E-05   33.8   1.0   47  206-255     4-50  (276)
107 PF02176 zf-TRAF:  TRAF-type zi  63.9     3.7 8.1E-05   25.4   1.0   38   43-81      9-52  (60)
108 COG1996 RPC10 DNA-directed RNA  63.3       4 8.7E-05   24.3   1.0   11  177-187     6-16  (49)
109 PRK06266 transcription initiat  61.5     7.2 0.00016   30.6   2.4   33  230-271   114-146 (178)
110 PF12907 zf-met2:  Zinc-binding  61.2     8.3 0.00018   21.9   1.9   28  262-289     2-32  (40)
111 PF06524 NOA36:  NOA36 protein;  60.9     2.9 6.4E-05   34.3   0.1   23  231-253   207-229 (314)
112 COG1997 RPL43A Ribosomal prote  59.2     4.6 9.9E-05   27.2   0.8   31  177-217    35-65  (89)
113 KOG4377|consensus               57.9     4.9 0.00011   35.3   1.0  102  177-285   271-427 (480)
114 COG0068 HypF Hydrogenase matur  57.9     2.9 6.3E-05   39.6  -0.4   57  129-185   125-181 (750)
115 smart00614 ZnF_BED BED zinc fi  57.8     6.3 0.00014   23.5   1.2   10  235-244    20-29  (50)
116 PF12760 Zn_Tnp_IS1595:  Transp  55.3     8.7 0.00019   22.4   1.5    8  234-241    19-26  (46)
117 PF13878 zf-C2H2_3:  zinc-finge  55.1      12 0.00026   21.3   2.0   23   44-66     14-38  (41)
118 COG1198 PriA Primosomal protei  54.9     8.6 0.00019   37.2   2.2    8  233-240   475-482 (730)
119 PF06524 NOA36:  NOA36 protein;  54.5     4.3 9.4E-05   33.3   0.1   24  259-282   207-230 (314)
120 COG1198 PriA Primosomal protei  54.3     8.7 0.00019   37.2   2.1   12  258-269   472-483 (730)
121 KOG1280|consensus               54.2     9.8 0.00021   32.7   2.1   29  261-289    79-107 (381)
122 PF08274 PhnA_Zn_Ribbon:  PhnA   52.7     5.8 0.00013   20.9   0.4   10   71-80     19-28  (30)
123 PF04959 ARS2:  Arsenite-resist  52.4      14  0.0003   29.9   2.7   28  174-201    74-101 (214)
124 PF13240 zinc_ribbon_2:  zinc-r  52.2     5.1 0.00011   19.6   0.1    6  236-241     2-7   (23)
125 PF04810 zf-Sec23_Sec24:  Sec23  51.9      11 0.00024   21.3   1.5   30  156-185     3-32  (40)
126 PF07975 C1_4:  TFIIH C1-like d  51.8     3.5 7.7E-05   24.8  -0.6   26  175-200    19-44  (51)
127 PF05443 ROS_MUCR:  ROS/MUCR tr  51.7     7.7 0.00017   28.7   1.0   27  232-261    71-97  (132)
128 PF14353 CpXC:  CpXC protein     51.3     7.7 0.00017   28.5   1.0   20   71-90     38-57  (128)
129 PF04959 ARS2:  Arsenite-resist  49.9     4.9 0.00011   32.5  -0.2   26  262-287    78-103 (214)
130 PF14803 Nudix_N_2:  Nudix N-te  49.0      11 0.00024   20.5   1.1   10  177-186    22-31  (34)
131 KOG2593|consensus               47.7      17 0.00036   32.5   2.6   34   42-78    127-160 (436)
132 PRK04023 DNA polymerase II lar  47.7      23 0.00049   35.4   3.7   10  205-214   626-635 (1121)
133 COG5151 SSL1 RNA polymerase II  47.7      28 0.00061   29.6   3.8   74  127-200   322-411 (421)
134 PF00301 Rubredoxin:  Rubredoxi  47.5      16 0.00034   21.6   1.7    8  178-185    35-42  (47)
135 PF05443 ROS_MUCR:  ROS/MUCR tr  47.1      11 0.00024   27.9   1.3   28   40-70     69-96  (132)
136 KOG2071|consensus               46.7      20 0.00042   33.4   3.0   24  177-200   418-441 (579)
137 PRK04023 DNA polymerase II lar  46.4      19 0.00042   35.9   3.0    7  235-241   665-671 (1121)
138 PF05191 ADK_lid:  Adenylate ki  46.0     4.2 9.1E-05   22.5  -0.8    8  234-241    22-29  (36)
139 KOG3408|consensus               45.7      11 0.00025   27.0   1.1   26  231-256    55-80  (129)
140 PF07754 DUF1610:  Domain of un  45.3      11 0.00023   18.7   0.7   10  176-185    15-24  (24)
141 PRK09678 DNA-binding transcrip  45.3     5.2 0.00011   26.1  -0.6    6  238-243    34-39  (72)
142 PF15269 zf-C2H2_7:  Zinc-finge  44.5      15 0.00033   21.2   1.3   23   43-65     20-42  (54)
143 KOG4167|consensus               43.9     8.3 0.00018   36.6   0.2   25  262-286   793-817 (907)
144 PRK00432 30S ribosomal protein  43.8     8.6 0.00019   23.1   0.2    8  262-269    38-45  (50)
145 cd00730 rubredoxin Rubredoxin;  40.3      13 0.00028   22.3   0.6    7  100-106    35-41  (50)
146 PF14446 Prok-RING_1:  Prokaryo  40.1     7.9 0.00017   23.6  -0.3    9  235-243     7-15  (54)
147 KOG2272|consensus               39.6      28 0.00061   28.6   2.6  117   99-217    99-233 (332)
148 PF03811 Zn_Tnp_IS1:  InsA N-te  39.6     5.1 0.00011   22.2  -1.1   18  250-267    18-35  (36)
149 COG1998 RPS31 Ribosomal protei  39.4      11 0.00024   22.3   0.2   10  261-270    37-46  (51)
150 COG1594 RPB9 DNA-directed RNA   38.7      20 0.00044   25.7   1.5   40   43-82     72-111 (113)
151 PF09845 DUF2072:  Zn-ribbon co  38.1      15 0.00033   26.9   0.8   11  128-138     2-12  (131)
152 KOG2593|consensus               37.9      42 0.00091   30.1   3.6   39  201-242   124-162 (436)
153 PF13453 zf-TFIIB:  Transcripti  37.9      31 0.00068   19.4   2.0   19  177-195    19-37  (41)
154 KOG1280|consensus               36.7      32  0.0007   29.8   2.6   39   40-78     76-116 (381)
155 COG4888 Uncharacterized Zn rib  36.6      10 0.00022   26.3  -0.3   39   40-82     19-57  (104)
156 KOG2071|consensus               36.1      31 0.00066   32.2   2.5   16  231-246   511-526 (579)
157 PF05290 Baculo_IE-1:  Baculovi  35.6      32  0.0007   25.3   2.1   17  202-218    77-93  (140)
158 COG4530 Uncharacterized protei  35.0      22 0.00047   25.1   1.1   28  178-216    10-37  (129)
159 KOG1701|consensus               34.6      16 0.00035   32.4   0.6   42   45-86    276-317 (468)
160 KOG4167|consensus               34.3      10 0.00022   36.1  -0.8   30   39-68    788-817 (907)
161 PF15135 UPF0515:  Uncharacteri  34.2      53  0.0012   27.0   3.3   56  126-190   111-168 (278)
162 COG3357 Predicted transcriptio  32.7      25 0.00054   23.9   1.1   14  204-217    57-70  (97)
163 COG5151 SSL1 RNA polymerase II  32.1      45 0.00097   28.4   2.7   22  126-147   387-408 (421)
164 PF07800 DUF1644:  Protein of u  31.4 1.5E+02  0.0033   22.7   5.1   54  233-288    80-135 (162)
165 KOG3408|consensus               30.8      37  0.0008   24.5   1.7   26  258-283    54-79  (129)
166 PF12773 DZR:  Double zinc ribb  30.2      41 0.00089   19.8   1.7    8  234-241    30-37  (50)
167 PRK03824 hypA hydrogenase nick  30.1      20 0.00043   26.7   0.3   14  177-190    70-83  (135)
168 KOG4124|consensus               29.3      10 0.00022   32.6  -1.4   54  232-285   348-422 (442)
169 smart00440 ZnF_C2C2 C2C2 Zinc   28.5      46   0.001   18.8   1.6   14  175-188    26-39  (40)
170 COG1571 Predicted DNA-binding   28.1      37 0.00081   30.4   1.7   31  179-220   352-382 (421)
171 KOG1842|consensus               28.0      39 0.00084   30.4   1.8   25  233-257    15-39  (505)
172 PF01363 FYVE:  FYVE zinc finge  27.6      35 0.00075   21.7   1.1    8  178-185    26-33  (69)
173 PF10058 DUF2296:  Predicted in  27.5      38 0.00082   20.7   1.2    9  177-185    44-52  (54)
174 PTZ00255 60S ribosomal protein  27.3      32 0.00069   23.5   0.9   11   71-81     54-64  (90)
175 smart00661 RPOL9 RNA polymeras  27.2      42  0.0009   19.9   1.4    8  178-185    21-28  (52)
176 PRK14714 DNA polymerase II lar  27.2      72  0.0016   33.0   3.6    8  178-185   668-675 (1337)
177 PF02150 RNA_POL_M_15KD:  RNA p  27.2      27 0.00059   19.0   0.5   10  179-188    22-31  (35)
178 COG4896 Uncharacterized protei  26.8      35 0.00075   21.3   0.9    7  262-268    32-38  (68)
179 PF04438 zf-HIT:  HIT zinc fing  26.7      64  0.0014   16.9   1.8   14  177-190    13-26  (30)
180 KOG3507|consensus               26.5      37  0.0008   21.0   1.0   10  205-214    37-46  (62)
181 PF05495 zf-CHY:  CHY zinc fing  26.1      21 0.00047   23.1  -0.1   31  154-186    40-70  (71)
182 TIGR00595 priA primosomal prot  25.9      38 0.00083   31.5   1.5    6  207-212   215-220 (505)
183 COG2879 Uncharacterized small   25.6      63  0.0014   20.3   1.9   18  272-289    23-40  (65)
184 PF01096 TFIIS_C:  Transcriptio  25.3      35 0.00076   19.1   0.7   12  176-187    27-38  (39)
185 PF07295 DUF1451:  Protein of u  25.3      33 0.00072   25.9   0.8   10  233-242   112-121 (146)
186 TIGR00686 phnA alkylphosphonat  25.3      43 0.00093   23.7   1.3   11  234-244    20-30  (109)
187 PF08209 Sgf11:  Sgf11 (transcr  25.1      54  0.0012   17.7   1.4   22  177-199     4-25  (33)
188 PF13451 zf-trcl:  Probable zin  24.8      31 0.00067   20.6   0.4   14   41-54      2-15  (49)
189 COG2331 Uncharacterized protei  24.8      22 0.00048   23.2  -0.2   12   42-53     11-22  (82)
190 TIGR00280 L37a ribosomal prote  24.0      33 0.00071   23.5   0.5   11   71-81     53-63  (91)
191 PF01780 Ribosomal_L37ae:  Ribo  23.8      19 0.00041   24.6  -0.7   10  100-109    54-63  (90)
192 PRK12380 hydrogenase nickel in  23.7      29 0.00063   24.9   0.2   10  234-243    71-80  (113)
193 COG5152 Uncharacterized conser  23.4      41 0.00088   26.6   0.9   15  176-190   195-209 (259)
194 COG4957 Predicted transcriptio  23.4      48   0.001   24.5   1.2   25  178-205    77-101 (148)
195 KOG4377|consensus               23.3      73  0.0016   28.4   2.5   28    2-29    203-230 (480)
196 PF04780 DUF629:  Protein of un  22.9      46   0.001   30.4   1.4   26  262-287    58-83  (466)
197 PRK00564 hypA hydrogenase nick  22.8      36 0.00077   24.6   0.5   10  206-215    72-81  (117)
198 PF14311 DUF4379:  Domain of un  22.8      59  0.0013   19.7   1.5   10  206-215    29-38  (55)
199 TIGR00100 hypA hydrogenase nic  22.7      28 0.00061   25.0  -0.0   11  234-244    71-81  (115)
200 PF08271 TF_Zn_Ribbon:  TFIIB z  22.6      63  0.0014   18.4   1.5    9  178-186    20-28  (43)
201 cd00924 Cyt_c_Oxidase_Vb Cytoc  22.3      34 0.00073   23.8   0.3   22   33-55     70-91  (97)
202 PF07282 OrfB_Zn_ribbon:  Putat  22.3      98  0.0021   19.6   2.5   14   70-83     45-58  (69)
203 PF09963 DUF2197:  Uncharacteri  22.3      53  0.0012   20.2   1.1   12   96-107    28-39  (56)
204 PF07503 zf-HYPF:  HypF finger;  22.1      33 0.00071   18.8   0.2    6  179-184    23-28  (35)
205 PF02891 zf-MIZ:  MIZ/SP-RING z  21.6      51  0.0011   19.7   0.9   18   34-51     32-49  (50)
206 smart00154 ZnF_AN1 AN1-like Zi  21.6      46   0.001   18.7   0.7   13  233-245    12-24  (39)
207 PF08790 zf-LYAR:  LYAR-type C2  21.5      20 0.00043   18.6  -0.7   17   45-62      2-18  (28)
208 PLN02294 cytochrome c oxidase   21.3      38 0.00083   26.1   0.4   24   32-56    131-154 (174)
209 PF13824 zf-Mss51:  Zinc-finger  21.2 1.3E+02  0.0028   18.5   2.6    9  234-242    15-23  (55)
210 KOG3214|consensus               20.6      21 0.00045   24.7  -1.0   39  232-274    22-60  (109)
211 PF04216 FdhE:  Protein involve  20.6      24 0.00052   30.1  -0.9   72  157-243   174-248 (290)
212 PF01155 HypA:  Hydrogenase exp  20.4      61  0.0013   23.2   1.3   15  177-191    70-84  (113)
213 COG1655 Uncharacterized protei  20.3      30 0.00065   28.1  -0.3   27   40-66     16-42  (267)
214 TIGR01562 FdhE formate dehydro  20.3      72  0.0016   27.5   1.9   46  206-270   185-233 (305)
215 COG3091 SprT Zn-dependent meta  20.2      20 0.00044   27.0  -1.2   32   71-107   117-148 (156)
216 KOG3362|consensus               20.1      32 0.00069   25.7  -0.2   22  177-198   129-150 (156)
217 COG3677 Transposase and inacti  20.0      51  0.0011   24.3   0.9   15  287-301    51-65  (129)
218 PF07649 C1_3:  C1-like domain;  20.0      56  0.0012   16.9   0.8   10  177-186    15-24  (30)

No 1  
>KOG1074|consensus
Probab=99.95  E-value=8.5e-29  Score=221.55  Aligned_cols=191  Identities=27%  Similarity=0.528  Sum_probs=149.0

Q ss_pred             ccCCCChhhhccHHHHHHHHHhcccCCccccCcchhhccchHHHHHHhhhcCC----CCCcccc---ccccccccccc--
Q psy4573         100 YKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKHN----APPFECE---SCKKIFTYHKN--  170 (306)
Q Consensus       100 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~----~~~~~c~---~c~~~f~~~~~--  170 (306)
                      .+|-+|.+..+-.+.|+.|+++|++++||+|.+|+++|.++.+|+.|+..|..    ..++.|+   +|-+-|...-.  
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            67999999999999999999999999999999999999999999999766653    3457888   88887764322  


Q ss_pred             ---cccc--------------CcceeccccccccCChHHHHHHHhhccC----------------CC----CcccCcCCC
Q psy4573         171 ---TTHL--------------GIKFECEVCHRKLSTKNHLRLHMRTHTN----------------ER----PAVCSYCGK  213 (306)
Q Consensus       171 ---~~~~--------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~----------------~~----~~~C~~C~~  213 (306)
                         .+|.              ...-.|..|.+.|.+...+..++..|.+                +.    +..+..|+.
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence               1111              1135699999999999999998877621                11    344556666


Q ss_pred             ccCCcHHHHHHHHHc-----------------------cC----------------------------------------
Q psy4573         214 GFRRGDALTEHIRIH-----------------------TG----------------------------------------  230 (306)
Q Consensus       214 ~f~~~~~l~~H~~~h-----------------------~~----------------------------------------  230 (306)
                      .+.....+..+-..+                       +.                                        
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence            655444333331111                       00                                        


Q ss_pred             -------------------------------CCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcChHHHHH
Q psy4573         231 -------------------------------QRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRH  279 (306)
Q Consensus       231 -------------------------------~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  279 (306)
                                                     .....|..||+.|...+.|..|+++|.++++|.|.+|++.|+.+.+|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                           0116899999999999999999999999999999999999999999999


Q ss_pred             HhhhcCCCCCC
Q psy4573         280 HVRSHHSSARL  290 (306)
Q Consensus       280 H~~~~h~~~~~  290 (306)
                      ||.+|++..+.
T Consensus       926 HMgtH~w~q~~  936 (958)
T KOG1074|consen  926 HMGTHMWVQPP  936 (958)
T ss_pred             hhccccccCCC
Confidence            99999998763


No 2  
>KOG2462|consensus
Probab=99.95  E-value=1.4e-28  Score=195.38  Aligned_cols=137  Identities=30%  Similarity=0.637  Sum_probs=121.0

Q ss_pred             CccccCcchhhccchHHHHHHhhhcCCCCCcccccccccccccccccccCcceeccccccccCChHHHHHHHhhccCCCC
Q psy4573         126 YTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERP  205 (306)
Q Consensus       126 ~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  205 (306)
                      ..|+|+.|++.+.+..+|.+|...|-.-.                   ....+.|+.|++.|.+...|..|+++|+  -+
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~-------------------s~ka~~C~~C~K~YvSmpALkMHirTH~--l~  187 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLD-------------------SKKAFSCKYCGKVYVSMPALKMHIRTHT--LP  187 (279)
T ss_pred             Cceeccccccccccccccchhhccccccc-------------------ccccccCCCCCceeeehHHHhhHhhccC--CC
Confidence            35778888888888888888844444210                   1235789999999999999999999998  57


Q ss_pred             cccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcChHHHHHHhhh
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRS  283 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  283 (306)
                      .+|.+||+.|...+.|+.|+++|+||+||.|++|++.|.++++|+.||++|.+.+.|+|..|+++|+.++.|.+|...
T Consensus       188 c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  188 CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999765


No 3  
>KOG2462|consensus
Probab=99.94  E-value=2.9e-27  Score=187.88  Aligned_cols=124  Identities=33%  Similarity=0.688  Sum_probs=118.6

Q ss_pred             ceeccccccccCChHHHHHHHhhccC---CCCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHH
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTN---ERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHK  253 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~  253 (306)
                      .|+|+.||+.+.+..+|.+|..+|..   .+.+.|.+|++.|.+-..|..|+++|+  -+.+|.+||+.|+....|.-|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            69999999999999999999999864   577999999999999999999999997  6789999999999999999999


Q ss_pred             hhccCCCcccCCcchHhhcChHHHHHHhhhcCCCCCCCcccccccchhh
Q psy4573         254 RGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSARLGLNLLDHELSMI  302 (306)
Q Consensus       254 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~c~~~~~~~  302 (306)
                      ++|+|||||.|+.|+++|.++++|+.||++|.+.+.|+|..|+++|...
T Consensus       208 RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHH
Confidence            9999999999999999999999999999999999999999999999754


No 4  
>KOG3608|consensus
Probab=99.93  E-value=4.4e-26  Score=185.79  Aligned_cols=223  Identities=21%  Similarity=0.465  Sum_probs=156.5

Q ss_pred             cCCccccc--ccccccCChHHHHHHhhhcCCC------------C-ceecc--cchhccCChHHHhhhhhhcccCCcccC
Q psy4573          40 QDGSLACN--VCSKRCGSKSGLKIHMKSHTLS------------K-RYACS--ICLAEFHTLTEKDRHTLSHVVEGEYKC  102 (306)
Q Consensus        40 ~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~------------~-~~~C~--~C~~~~~~~~~l~~H~~~~~~~~~~~C  102 (306)
                      ....|.|.  .|+..|.+...|..|+..|..-            + .+.|.  .|...+.++..|++|++.|.+++..-|
T Consensus       131 ~g~~f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvAC  210 (467)
T KOG3608|consen  131 LGQNFRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVAC  210 (467)
T ss_pred             chhhhccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEec
Confidence            34446674  6888888888888887655321            0 12222  244444455555555555555555555


Q ss_pred             CCChhhhccHHHHHHHHHhcc--cCCccccCcchhhccchHHHHHHhhhcCCCCCcccccccccccccccccccCcceec
Q psy4573         103 NQCDHVAKKLAYLQAHMKKHR--NEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFEC  180 (306)
Q Consensus       103 ~~C~~~f~~~~~l~~H~~~~~--~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~~~~~C  180 (306)
                      +.|+..|.++..|.-|++.-+  ...+|+|..|.+.|.+...|..|+..+..                        -|+|
T Consensus       211 p~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn------------------------~ykC  266 (467)
T KOG3608|consen  211 PHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN------------------------CYKC  266 (467)
T ss_pred             chHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh------------------------cccc
Confidence            555555555555554543221  23345555555555555555555333332                        5899


Q ss_pred             cccccccCChHHHHHHHhh-ccCCCCcccCcCCCccCCcHHHHHHHHHccCCCCcccCc--ccCcCCChhHHHHHHhhcc
Q psy4573         181 EVCHRKLSTKNHLRLHMRT-HTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEI--CGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       181 ~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~L~~H~~~h~  257 (306)
                      ++|..+....++|.+|++. |..++||+|..|++.|...+.|..|+..|. +..|.|..  |.++|.....|++|++.++
T Consensus       267 plCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  267 PLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             cccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            9999999999999999997 888999999999999999999999999888 67799987  9999999999999998776


Q ss_pred             ---CCCcccCCcchHhhcChHHHHHHhhhcCCC
Q psy4573         258 ---GEIPYHCEFCSERFSTKALVRHHVRSHHSS  287 (306)
Q Consensus       258 ---~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  287 (306)
                         ++.+|.|-.|++.|++-.+|.+|+.+.|+=
T Consensus       346 Eg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  346 EGNNPILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             cCCCCCceeeecchhhhccchhHHHHHHHhhcc
Confidence               355699999999999999999999888864


No 5  
>KOG3608|consensus
Probab=99.93  E-value=1.4e-25  Score=182.90  Aligned_cols=236  Identities=24%  Similarity=0.467  Sum_probs=197.5

Q ss_pred             ccccc--ccccccCC-hHHHHHHhhhc-----------------CCC-----------------Cceecc--cchhccCC
Q psy4573          43 SLACN--VCSKRCGS-KSGLKIHMKSH-----------------TLS-----------------KRYACS--ICLAEFHT   83 (306)
Q Consensus        43 ~~~C~--~C~~~f~~-~~~l~~H~~~h-----------------~~~-----------------~~~~C~--~C~~~~~~   83 (306)
                      .+.|.  .|++...+ ..+|.+|.-.|                 ...                 ..|.|.  .|++.|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            57774  78877765 58899987433                 000                 125554  48999999


Q ss_pred             hHHHhhhhhhcccC------------Cc-ccC--CCChhhhccHHHHHHHHHhcccCCccccCcchhhccchHHHHHHhh
Q psy4573          84 LTEKDRHTLSHVVE------------GE-YKC--NQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNI  148 (306)
Q Consensus        84 ~~~l~~H~~~~~~~------------~~-~~C--~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  148 (306)
                      ...+..|+..|.-.            +| +.|  ..|.+.+.+++.|++|++.|.+++...|+.||.-|.++..|-.|.+
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~r  228 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLR  228 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHH
Confidence            99999998766321            11 344  4589999999999999999999999999999999999999999977


Q ss_pred             hcCCCCCcccccccccccccccccccCcceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHHH-
Q psy4573         149 QKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRI-  227 (306)
Q Consensus       149 ~~h~~~~~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-  227 (306)
                      ....-.                    ..+|.|..|.+.|+....|..|+..|.  +-|+|+.|+......+.|..|++. 
T Consensus       229 Rqt~l~--------------------~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~r  286 (467)
T KOG3608|consen  229 RQTELN--------------------TNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYR  286 (467)
T ss_pred             hhhhhc--------------------CCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhh
Confidence            766321                    126889999999999999999999987  569999999999999999999985 


Q ss_pred             ccCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCc--chHhhcChHHHHHHhhhcC-CCCC--CCcccccccchh
Q psy4573         228 HTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEF--CSERFSTKALVRHHVRSHH-SSAR--LGLNLLDHELSM  301 (306)
Q Consensus       228 h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h-~~~~--~~C~~c~~~~~~  301 (306)
                      |...+||+|+.|++.|.+.++|.+|+..|. +..|+|..  |.++|.+..+|.+|++.+| ++.+  |.|..|++.|+.
T Consensus       287 Hs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~  364 (467)
T KOG3608|consen  287 HSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTS  364 (467)
T ss_pred             hccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhcc
Confidence            888999999999999999999999999777 77799988  9999999999999999999 4433  999999999875


No 6  
>KOG1074|consensus
Probab=99.89  E-value=1.6e-24  Score=194.39  Aligned_cols=81  Identities=38%  Similarity=0.746  Sum_probs=73.7

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHHHccCC----CCcccC---cccCcCCChhHH
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQ----RPYVCE---ICGKGFTQKQAL  249 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----~~~~C~---~C~~~f~~~~~L  249 (306)
                      +..|-+|.++..-.+.|+.|.++|+|++||+|.+||+.|.++.+|+.|+.+|...    .++.|+   +|-+.|.+.-.|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            4669999999999999999999999999999999999999999999999998654    347798   899999999999


Q ss_pred             HHHHhhcc
Q psy4573         250 NTHKRGHT  257 (306)
Q Consensus       250 ~~H~~~h~  257 (306)
                      ..|+++|.
T Consensus       685 pQhIriH~  692 (958)
T KOG1074|consen  685 PQHIRIHL  692 (958)
T ss_pred             cceEEeec
Confidence            99999887


No 7  
>KOG3623|consensus
Probab=99.89  E-value=9.2e-24  Score=186.65  Aligned_cols=109  Identities=27%  Similarity=0.519  Sum_probs=96.6

Q ss_pred             cccccccccccCChHHHHHHhhh-cCC-CCceecccchhccCChHHHhhhhhhcccC-------------CcccCCCChh
Q psy4573          43 SLACNVCSKRCGSKSGLKIHMKS-HTL-SKRYACSICLAEFHTLTEKDRHTLSHVVE-------------GEYKCNQCDH  107 (306)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~C~~C~~~~~~~~~l~~H~~~~~~~-------------~~~~C~~C~~  107 (306)
                      ..+|+.|++.+.+...|+.|++. |.. +..|.|.+|..+|..+..|.+|+..|...             +.|+|.+|++
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            37899999999999999999875 433 55799999999999999999999988543             3499999999


Q ss_pred             hhccHHHHHHHHHhcccCCccccCcchhhccchHHHHHHhhhcC
Q psy4573         108 VAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQKH  151 (306)
Q Consensus       108 ~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h  151 (306)
                      .|..+-.|+.|+++|.|++||.|+.|++.|....++..|+.+.-
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSSKK  333 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSKK  333 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccccc
Confidence            99999999999999999999999999999999999999976543


No 8  
>KOG3623|consensus
Probab=99.83  E-value=6.4e-21  Score=168.86  Aligned_cols=119  Identities=29%  Similarity=0.531  Sum_probs=96.1

Q ss_pred             ccCCCChhhhccHHHHHHHHHhc--ccCCccccCcchhhccchHHHHHHhhhcCCCCCcccccccccccccccccccCcc
Q psy4573         100 YKCNQCDHVAKKLAYLQAHMKKH--RNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIK  177 (306)
Q Consensus       100 ~~C~~C~~~f~~~~~l~~H~~~~--~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~~~  177 (306)
                      ..|+.|.+.+.....|+.|++.-  ..+..|.|..|.++|.+...|.+|+..+....+-.         ..-......+.
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa---------~sltqsa~lRK  281 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQA---------ISLTQSALLRK  281 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCccc---------ccccchhhhcc
Confidence            78999999999999999998643  45668999999999999999999988887332100         00001122347


Q ss_pred             eeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHHH
Q psy4573         178 FECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRI  227 (306)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  227 (306)
                      |+|..|++.|..+..|+.|+++|.|++||.|+.|++.|..+..+..|+..
T Consensus       282 FKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  282 FKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            99999999999999999999999999999999999999998888888753


No 9  
>KOG3576|consensus
Probab=99.74  E-value=3.9e-19  Score=134.71  Aligned_cols=115  Identities=34%  Similarity=0.706  Sum_probs=108.3

Q ss_pred             CcceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHHh
Q psy4573         175 GIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKR  254 (306)
Q Consensus       175 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  254 (306)
                      ...|.|.+|++.|.....|++|++.|...+.|.|..||+.|.+.-.|.+|+++|+|.+||+|..|++.|+.+..|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            44799999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hccC-----------CCcccCCcchHhhcChHHHHHHhhhcCCCCC
Q psy4573         255 GHTG-----------EIPYHCEFCSERFSTKALVRHHVRSHHSSAR  289 (306)
Q Consensus       255 ~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  289 (306)
                      ..++           .+.|.|..|+++-...+.+..|++.+|+..+
T Consensus       195 kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            7776           3468999999999999999999999998765


No 10 
>KOG3576|consensus
Probab=99.69  E-value=9e-18  Score=127.35  Aligned_cols=119  Identities=29%  Similarity=0.480  Sum_probs=109.0

Q ss_pred             hhcCCcccccccccccCChHHHHHHhhhcCCCCceecccchhccCChHHHhhhhhhcccCCcccCCCChhhhccHHHHHH
Q psy4573          38 VEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQA  117 (306)
Q Consensus        38 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~  117 (306)
                      ..+...|.|..|++.|..+..|.+|++-|...+.+.|..||+.|+..-+|.+|+++|.+..||+|..|++.|..+-.|..
T Consensus       112 ssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  112 SSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHH
Confidence            44567799999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhccc-----------CCccccCcchhhccchHHHHHHhhhcCCCCCc
Q psy4573         118 HMKKHRN-----------EYTAYCDLCQEGFFRKAKYETHNIQKHNAPPF  156 (306)
Q Consensus       118 H~~~~~~-----------~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~  156 (306)
                      |++.-++           .+.|.|+.||.+......+..|+..+|+..|+
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence            9876554           46789999999999999999999999976654


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.29  E-value=1.3e-11  Score=110.81  Aligned_cols=147  Identities=17%  Similarity=0.395  Sum_probs=105.0

Q ss_pred             cccCcchhhccchHHHHHHhhhcCCCCCcccc--cccccccccccccccCcceeccccccccCChHHHHHHHhhccCCCC
Q psy4573         128 AYCDLCQEGFFRKAKYETHNIQKHNAPPFECE--SCKKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERP  205 (306)
Q Consensus       128 ~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~c~--~c~~~f~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  205 (306)
                      ..|+.|...... ..|..|. ..-......|+  .|+..|......    ..+.|+.|+..|. ...|..|+..++  .+
T Consensus       408 V~C~NC~~~i~l-~~l~lHe-~~C~r~~V~Cp~~~Cg~v~~r~el~----~H~~C~~Cgk~f~-~s~LekH~~~~H--kp  478 (567)
T PLN03086        408 VECRNCKHYIPS-RSIALHE-AYCSRHNVVCPHDGCGIVLRVEEAK----NHVHCEKCGQAFQ-QGEMEKHMKVFH--EP  478 (567)
T ss_pred             EECCCCCCccch-hHHHHHH-hhCCCcceeCCcccccceeeccccc----cCccCCCCCCccc-hHHHHHHHHhcC--CC
Confidence            356666554433 3344553 22233344555  366666433332    2358999999886 677999999975  78


Q ss_pred             cccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCC----------ChhHHHHHHhhccCCCcccCCcchHhhcChH
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFT----------QKQALNTHKRGHTGEIPYHCEFCSERFSTKA  275 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~  275 (306)
                      +.|+ |+..+ ....|..|+.+|.+.+++.|..|++.|.          ....|..|... .+.+++.|..|++.+.. .
T Consensus       479 v~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt~~C~~Cgk~Vrl-r  554 (567)
T PLN03086        479 LQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRTAPCDSCGRSVML-K  554 (567)
T ss_pred             ccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcceEccccCCeeee-h
Confidence            9999 99755 6689999999999999999999999884          23578899887 48889999999988754 4


Q ss_pred             HHHHHhhhcCCC
Q psy4573         276 LVRHHVRSHHSS  287 (306)
Q Consensus       276 ~l~~H~~~~h~~  287 (306)
                      .|..|+...|..
T Consensus       555 dm~~H~~~~h~~  566 (567)
T PLN03086        555 EMDIHQIAVHQK  566 (567)
T ss_pred             hHHHHHHHhhcC
Confidence            588888887753


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.19  E-value=1.6e-11  Score=110.31  Aligned_cols=93  Identities=17%  Similarity=0.409  Sum_probs=80.6

Q ss_pred             CCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhc----------C
Q psy4573         204 RPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFS----------T  273 (306)
Q Consensus       204 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~----------~  273 (306)
                      +.+.|+.|++.|. ...|..|+.+++  .++.|+ ||..+ .+..|..|+..|.+.+++.|++|++.|.          .
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhh
Confidence            4578999999996 678999999985  789999 99755 7799999999999999999999999985          2


Q ss_pred             hHHHHHHhhhcCCCCCCCcccccccchhh
Q psy4573         274 KALVRHHVRSHHSSARLGLNLLDHELSMI  302 (306)
Q Consensus       274 ~~~l~~H~~~~h~~~~~~C~~c~~~~~~~  302 (306)
                      ...|..|.... +..++.|..|++.+..+
T Consensus       527 ~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr  554 (567)
T PLN03086        527 LRGMSEHESIC-GSRTAPCDSCGRSVMLK  554 (567)
T ss_pred             hhhHHHHHHhc-CCcceEccccCCeeeeh
Confidence            45899998884 88999999999987654


No 13 
>PHA00733 hypothetical protein
Probab=99.17  E-value=2.7e-11  Score=89.01  Aligned_cols=95  Identities=20%  Similarity=0.339  Sum_probs=68.9

Q ss_pred             HHHHHHHhhccCCCCcccCcCCCccCCcHHHHHH--HH---HccCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCC
Q psy4573         191 NHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEH--IR---IHTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCE  265 (306)
Q Consensus       191 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~  265 (306)
                      ..|.++-..--..+++.|.+|...|.....|..+  +.   .+.+.+||.|+.||+.|.+...|..|++.+  ..+|.|.
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            3444433332334667788888777776666655  22   234577899999999999999999998865  3468999


Q ss_pred             cchHhhcChHHHHHHhhhcCCC
Q psy4573         266 FCSERFSTKALVRHHVRSHHSS  287 (306)
Q Consensus       266 ~C~~~f~~~~~l~~H~~~~h~~  287 (306)
                      .|+++|.....|..|+.+.|+.
T Consensus       104 ~CgK~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        104 VCGKEFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             CCCCccCCHHHHHHHHHHhcCc
Confidence            9999999999999999888865


No 14 
>PHA00733 hypothetical protein
Probab=99.05  E-value=2.9e-10  Score=83.60  Aligned_cols=80  Identities=23%  Similarity=0.384  Sum_probs=60.2

Q ss_pred             ceeccccccccCChHHH------HHHHhhccCCCCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHH
Q psy4573         177 KFECEVCHRKLSTKNHL------RLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALN  250 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l------~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~  250 (306)
                      ++.|.+|...|.....|      .+|+. +.+.+||.|+.|++.|.+...|..|++.+  +.+|.|++|++.|.....|.
T Consensus        40 ~~~~~~~~~~~~~~~~l~~~~~l~~~~~-~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~  116 (128)
T PHA00733         40 RLIRAVVKTLIYNPQLLDESSYLYKLLT-SKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTL  116 (128)
T ss_pred             hHHHHHHhhhccChhhhcchHHHHhhcc-cCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHH
Confidence            34444444444444444      44433 34578999999999999999999999876  35799999999999999999


Q ss_pred             HHHhhccCC
Q psy4573         251 THKRGHTGE  259 (306)
Q Consensus       251 ~H~~~h~~~  259 (306)
                      .|+...|+.
T Consensus       117 ~H~~~~h~~  125 (128)
T PHA00733        117 DHVCKKHNI  125 (128)
T ss_pred             HHHHHhcCc
Confidence            999877653


No 15 
>KOG3993|consensus
Probab=99.02  E-value=6.2e-11  Score=100.09  Aligned_cols=199  Identities=20%  Similarity=0.317  Sum_probs=126.0

Q ss_pred             ceecccchhccCChHHHhhhhhhcccCCcccCCCChhhhccHHHHHHHHHhcccCCccccCcchhhccchHHHHHHhhhc
Q psy4573          71 RYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKHRNEYTAYCDLCQEGFFRKAKYETHNIQK  150 (306)
Q Consensus        71 ~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~  150 (306)
                      .|.|.+|...|.+.-.|.+|.-.......|+|++|++.|+-..+|..|.+.|.....--                    .
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa--------------------~  326 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAA--------------------K  326 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhh--------------------h
Confidence            48888888888888888888755444556888888888888888888888886432100                    0


Q ss_pred             CCCCCccc-cccccccccc--ccccccCcceeccccccccCChHHHHHHHhhccCCCC-----------------cccCc
Q psy4573         151 HNAPPFEC-ESCKKIFTYH--KNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHTNERP-----------------AVCSY  210 (306)
Q Consensus       151 h~~~~~~c-~~c~~~f~~~--~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-----------------~~C~~  210 (306)
                      .+..|-+- ...+......  +-....+..|.|..|++.|+....|+.|+.+|.....                 +.+..
T Consensus       327 a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~  406 (500)
T KOG3993|consen  327 AGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQA  406 (500)
T ss_pred             cCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccc
Confidence            00000000 0000000000  0011223389999999999999999999888753211                 22344


Q ss_pred             CCCccCCcHHHHHHHHHccC-CCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcChHHHHHHhhhcCCCCC
Q psy4573         211 CGKGFRRGDALTEHIRIHTG-QRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKALVRHHVRSHHSSAR  289 (306)
Q Consensus       211 C~~~f~~~~~l~~H~~~h~~-~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  289 (306)
                      ++-.+.....-..++-.+.+ ..-..++.++..++++..=-.+.+.-..++.|.|.+|.-+|.....|.+|+..-|+...
T Consensus       407 ~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hpse~  486 (500)
T KOG3993|consen  407 VATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPSEL  486 (500)
T ss_pred             cccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChHHh
Confidence            44333322222222222211 12245788888888877766777666777889999999999999999999999888643


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.82  E-value=1.4e-09  Score=65.82  Aligned_cols=41  Identities=24%  Similarity=0.493  Sum_probs=20.2

Q ss_pred             cccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcChHH
Q psy4573         234 YVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTKAL  276 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~  276 (306)
                      |.|++||+.|+..+.|..|+++|.  ++|+|..|++.|...+.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~   46 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGE   46 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccce
Confidence            445555555555555555555544  34455555555544433


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.75  E-value=3e-09  Score=64.33  Aligned_cols=42  Identities=17%  Similarity=0.367  Sum_probs=21.3

Q ss_pred             cccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHH
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQAL  249 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L  249 (306)
                      |.|+.||+.|...+.|..|+++|+  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            445555555555555555555554  345555555555544443


No 18 
>KOG3993|consensus
Probab=98.54  E-value=2.8e-08  Score=84.36  Aligned_cols=188  Identities=17%  Similarity=0.189  Sum_probs=116.5

Q ss_pred             CcccccccccccCChHHHHHHhhhcCCCCceecccchhccCChHHHhhhhhhcccCCcccC---CCChhhhccHHHHHHH
Q psy4573          42 GSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKC---NQCDHVAKKLAYLQAH  118 (306)
Q Consensus        42 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C---~~C~~~f~~~~~l~~H  118 (306)
                      +.|.|..|...|.....|..|.-.-.-.-.|.|+.|+++|+.-.+|..|.+.|.....--=   +-=.+........+.-
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            3499999999999999999996543334469999999999999999999998854321100   0000000011111111


Q ss_pred             HHh--cccCCccccCcchhhccchHHHHHHhhhcCCC-CC-------c---------cccccccccccccc-------cc
Q psy4573         119 MKK--HRNEYTAYCDLCQEGFFRKAKYETHNIQKHNA-PP-------F---------ECESCKKIFTYHKN-------TT  172 (306)
Q Consensus       119 ~~~--~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~-~~-------~---------~c~~c~~~f~~~~~-------~~  172 (306)
                      .+.  ...+..|.|..|++.|....+|+.|+..++.. ..       +         -+..+...+.....       ..
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a  425 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVA  425 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeee
Confidence            110  12345789999999999999999998887721 10       1         12222222221111       01


Q ss_pred             ccCcceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHHHcc
Q psy4573         173 HLGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHT  229 (306)
Q Consensus       173 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  229 (306)
                      .......++.++-.+.++..--.+.+.-..+..|.|.+|.-.|.++..|.+|+...+
T Consensus       426 ~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  426 GSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             ccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcC
Confidence            111234577788666666544444444445667899999999999999999987643


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.47  E-value=9.1e-08  Score=49.39  Aligned_cols=20  Identities=55%  Similarity=1.301  Sum_probs=7.6

Q ss_pred             HHHHHccCCCCcccCcccCc
Q psy4573         223 EHIRIHTGQRPYVCEICGKG  242 (306)
Q Consensus       223 ~H~~~h~~~~~~~C~~C~~~  242 (306)
                      .|+++|++++||.|++|++.
T Consensus         4 ~H~~~H~~~k~~~C~~C~k~   23 (26)
T PF13465_consen    4 RHMRTHTGEKPYKCPYCGKS   23 (26)
T ss_dssp             HHHHHHSSSSSEEESSSSEE
T ss_pred             HHhhhcCCCCCCCCCCCcCe
Confidence            33333333333333333333


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.46  E-value=5.9e-08  Score=50.09  Aligned_cols=25  Identities=52%  Similarity=1.103  Sum_probs=17.9

Q ss_pred             HHHHHHhhccCCCcccCCcchHhhc
Q psy4573         248 ALNTHKRGHTGEIPYHCEFCSERFS  272 (306)
Q Consensus       248 ~L~~H~~~h~~~~~~~C~~C~~~f~  272 (306)
                      +|.+|+++|.++++|.|++|+++|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3667777777777777777777764


No 21 
>PHA00616 hypothetical protein
Probab=98.45  E-value=6.8e-08  Score=55.55  Aligned_cols=32  Identities=25%  Similarity=0.374  Sum_probs=16.4

Q ss_pred             cccCcccCcCCChhHHHHHHhhccCCCcccCC
Q psy4573         234 YVCEICGKGFTQKQALNTHKRGHTGEIPYHCE  265 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~  265 (306)
                      |+|+.||+.|.+.+.|..|++.|++++++.|.
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            45555555555555555555555555554443


No 22 
>PHA00732 hypothetical protein
Probab=98.28  E-value=4.7e-07  Score=60.33  Aligned_cols=46  Identities=33%  Similarity=0.491  Sum_probs=25.9

Q ss_pred             CcccCcCCCccCCcHHHHHHHHH-ccCCCCcccCcccCcCCChhHHHHHHhhc
Q psy4573         205 PAVCSYCGKGFRRGDALTEHIRI-HTGQRPYVCEICGKGFTQKQALNTHKRGH  256 (306)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  256 (306)
                      ||.|..|++.|.+...|..|++. |.   ++.|+.||+.|.   .|..|.++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            35566666666666666666653 33   235666666665   355555443


No 23 
>PHA00616 hypothetical protein
Probab=98.27  E-value=6e-07  Score=51.66  Aligned_cols=33  Identities=33%  Similarity=0.520  Sum_probs=30.8

Q ss_pred             cccCCcchHhhcChHHHHHHhhhcCCCCCCCcc
Q psy4573         261 PYHCEFCSERFSTKALVRHHVRSHHSSARLGLN  293 (306)
Q Consensus       261 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~  293 (306)
                      +|+|+.||+.|.+.+.|.+|+++||+..++.|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            589999999999999999999999999988763


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.20  E-value=2.5e-06  Score=52.78  Aligned_cols=51  Identities=27%  Similarity=0.582  Sum_probs=32.1

Q ss_pred             CcccCcccCcCCChhHHHHHHhhccC--CCcccCCcchHhhcChHHHHHHhhhcCC
Q psy4573         233 PYVCEICGKGFTQKQALNTHKRGHTG--EIPYHCEFCSERFSTKALVRHHVRSHHS  286 (306)
Q Consensus       233 ~~~C~~C~~~f~~~~~L~~H~~~h~~--~~~~~C~~C~~~f~~~~~l~~H~~~~h~  286 (306)
                      .|.||.|++. .+...|..|....|.  .+.+.|++|...+.  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            3677777773 455667777654433  23577777776544  377777777663


No 25 
>PHA00732 hypothetical protein
Probab=98.14  E-value=2.1e-06  Score=57.20  Aligned_cols=46  Identities=33%  Similarity=0.641  Sum_probs=26.7

Q ss_pred             ceeccccccccCChHHHHHHHhh-ccCCCCcccCcCCCccCCcHHHHHHHHHc
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRT-HTNERPAVCSYCGKGFRRGDALTEHIRIH  228 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  228 (306)
                      ||.|+.|++.|.+...|..|++. |.   ++.|+.|++.|.   .+..|+...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            35666666666666666666653 33   245666666665   345565443


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.94  E-value=1.7e-05  Score=48.98  Aligned_cols=49  Identities=33%  Similarity=0.587  Sum_probs=25.4

Q ss_pred             cccCcCCCccCCcHHHHHHHHH-ccC-CCCcccCcccCcCCChhHHHHHHhhcc
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRI-HTG-QRPYVCEICGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~C~~C~~~f~~~~~L~~H~~~h~  257 (306)
                      |.|++|++ ..+...|..|+.. |.. .+.+.||+|...+.  .+|..|+..++
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            55666666 3344556666543 332 23456666665433  36666665543


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.76  E-value=1.2e-05  Score=40.12  Aligned_cols=20  Identities=50%  Similarity=1.011  Sum_probs=8.8

Q ss_pred             ccCcccCcCCChhHHHHHHh
Q psy4573         235 VCEICGKGFTQKQALNTHKR  254 (306)
Q Consensus       235 ~C~~C~~~f~~~~~L~~H~~  254 (306)
                      +|++|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHh
Confidence            34444444444444444443


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.66  E-value=3.6e-05  Score=38.35  Aligned_cols=22  Identities=36%  Similarity=0.963  Sum_probs=14.4

Q ss_pred             eeccccccccCChHHHHHHHhh
Q psy4573         178 FECEVCHRKLSTKNHLRLHMRT  199 (306)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~  199 (306)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.63  E-value=2.7e-05  Score=39.16  Aligned_cols=24  Identities=38%  Similarity=1.034  Sum_probs=11.5

Q ss_pred             ccCCcchHhhcChHHHHHHhhhcC
Q psy4573         262 YHCEFCSERFSTKALVRHHVRSHH  285 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~~~h  285 (306)
                      |.|++|++.|.+...|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            345555555555555555555443


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.56  E-value=3.9e-05  Score=39.90  Aligned_cols=24  Identities=46%  Similarity=0.945  Sum_probs=13.1

Q ss_pred             cccCcccCcCCChhHHHHHHhhcc
Q psy4573         234 YVCEICGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~h~  257 (306)
                      |.|..|++.|.+...|..|++.|.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            455555555555555555555443


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.53  E-value=5.1e-05  Score=38.09  Aligned_cols=24  Identities=46%  Similarity=0.956  Sum_probs=14.0

Q ss_pred             cccCcccCcCCChhHHHHHHhhcc
Q psy4573         234 YVCEICGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~h~  257 (306)
                      |.|++|++.|.+...|..|++.|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666543


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.50  E-value=5e-05  Score=53.59  Aligned_cols=20  Identities=30%  Similarity=0.685  Sum_probs=0.0

Q ss_pred             ccccccccCChHHHHHHHhh
Q psy4573         180 CEVCHRKLSTKNHLRLHMRT  199 (306)
Q Consensus       180 C~~C~~~f~~~~~l~~H~~~  199 (306)
                      |..|+..|.+...|..|+..
T Consensus         2 C~~C~~~f~~~~~l~~H~~~   21 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKK   21 (100)
T ss_dssp             --------------------
T ss_pred             cccccccccccccccccccc
Confidence            55555555555555555544


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.41  E-value=8.1e-05  Score=52.49  Aligned_cols=73  Identities=19%  Similarity=0.254  Sum_probs=17.1

Q ss_pred             cccccccccCChHHHHHHhhhcCCCCceecccchhccCChHHHhhhhhhcccCCcccCCCChhhhccHHHHHHHHHhc
Q psy4573          45 ACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKH  122 (306)
Q Consensus        45 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  122 (306)
                      .|..|+..|.+...|..|+...++...-    ....+.....+..+++... ...+.|.+|++.|.+...|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            4777888888888888887665543211    1111122333333333221 22477777777777777777777654


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.36  E-value=7.7e-05  Score=38.77  Aligned_cols=26  Identities=42%  Similarity=0.894  Sum_probs=24.0

Q ss_pred             cccCCcchHhhcChHHHHHHhhhcCC
Q psy4573         261 PYHCEFCSERFSTKALVRHHVRSHHS  286 (306)
Q Consensus       261 ~~~C~~C~~~f~~~~~l~~H~~~~h~  286 (306)
                      +|.|..|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            58999999999999999999988875


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.16  E-value=0.00014  Score=60.08  Aligned_cols=53  Identities=26%  Similarity=0.698  Sum_probs=44.1

Q ss_pred             CCCCcccCc--ccCcCCChhHHHHHHhhcc-------------------CCCcccCCcchHhhcChHHHHHHhh
Q psy4573         230 GQRPYVCEI--CGKGFTQKQALNTHKRGHT-------------------GEIPYHCEFCSERFSTKALVRHHVR  282 (306)
Q Consensus       230 ~~~~~~C~~--C~~~f~~~~~L~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~  282 (306)
                      +++||+|++  |.+.+.++-.|.-|+.--|                   ..+||+|+.|++.+.+...|..|..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            458999976  9999999999999986433                   2478999999999999999998854


No 36 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.95  E-value=0.0003  Score=35.32  Aligned_cols=24  Identities=38%  Similarity=0.822  Sum_probs=13.6

Q ss_pred             ccCCcchHhhcChHHHHHHhhhcCC
Q psy4573         262 YHCEFCSERFSTKALVRHHVRSHHS  286 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~~~h~  286 (306)
                      |+|+.|++... ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            45666666665 6666666666553


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.67  E-value=0.0013  Score=38.87  Aligned_cols=24  Identities=29%  Similarity=0.504  Sum_probs=8.4

Q ss_pred             cccCcccCcCCChhHHHHHHhhcc
Q psy4573         234 YVCEICGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~h~  257 (306)
                      -.|++|+..+....+|.+|+..+|
T Consensus        25 atCP~C~a~~~~srnLrRHle~~H   48 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHLEIRH   48 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHHHHHT
T ss_pred             CCCCcchhhccchhhHHHHHHHHh
Confidence            334444444444444444443333


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.65  E-value=0.0017  Score=32.92  Aligned_cols=19  Identities=53%  Similarity=0.936  Sum_probs=7.7

Q ss_pred             cCcccCcCCChhHHHHHHh
Q psy4573         236 CEICGKGFTQKQALNTHKR  254 (306)
Q Consensus       236 C~~C~~~f~~~~~L~~H~~  254 (306)
                      |+.|++.|.+...|..|++
T Consensus         3 C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        3 CPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCcchhCCHHHHHHHHH
Confidence            3344444444444444433


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.53  E-value=0.0021  Score=32.49  Aligned_cols=24  Identities=33%  Similarity=0.863  Sum_probs=21.6

Q ss_pred             ccCCcchHhhcChHHHHHHhhhcC
Q psy4573         262 YHCEFCSERFSTKALVRHHVRSHH  285 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~~~h  285 (306)
                      |.|..|+++|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998654


No 40 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.50  E-value=0.0021  Score=37.92  Aligned_cols=34  Identities=21%  Similarity=0.416  Sum_probs=24.6

Q ss_pred             ccCCCcccCCcchHhhcChHHHHHHhhhcCCCCC
Q psy4573         256 HTGEIPYHCEFCSERFSTKALVRHHVRSHHSSAR  289 (306)
Q Consensus       256 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  289 (306)
                      +-.++|-.|++|+..+.+..+|.+|+...|+.++
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3457788999999999999999999999998654


No 41 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.43  E-value=0.0072  Score=50.82  Aligned_cols=128  Identities=24%  Similarity=0.419  Sum_probs=86.2

Q ss_pred             cccccc--cccccCChHHHHHHhhhcCCCCceecccch---hcc------CChHHHhhhhhhcccCCc----ccCCCChh
Q psy4573          43 SLACNV--CSKRCGSKSGLKIHMKSHTLSKRYACSICL---AEF------HTLTEKDRHTLSHVVEGE----YKCNQCDH  107 (306)
Q Consensus        43 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~---~~~------~~~~~l~~H~~~~~~~~~----~~C~~C~~  107 (306)
                      .|.||.  |..+......|..|.++.++.  +.|.+|-   +.|      .++..|..|...-..+.-    =.|..|..
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~  228 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKI  228 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccc
Confidence            488874  788888889999999886654  7788883   233      345566667643222212    25999999


Q ss_pred             hhccHHHHHHHHHhcccCCccccCcchhh-------ccchHHHHHHhhhcCCCCCcccccccccccccccccccCcceec
Q psy4573         108 VAKKLAYLQAHMKKHRNEYTAYCDLCQEG-------FFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFEC  180 (306)
Q Consensus       108 ~f~~~~~l~~H~~~~~~~~~~~C~~C~~~-------~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~~~~~C  180 (306)
                      .|-+...|..|++..+..    |-+|+..       |.+...|..|++..|-    .|..                    
T Consensus       229 ~FYdDDEL~~HcR~~HE~----ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy----~ct~--------------------  280 (493)
T COG5236         229 YFYDDDELRRHCRLRHEA----CHICDMVGPIRYQYFKSYEDLEAHFRNAHY----CCTF--------------------  280 (493)
T ss_pred             eecChHHHHHHHHhhhhh----hhhhhccCccchhhhhCHHHHHHHhhcCce----EEEE--------------------
Confidence            999999999999876643    5555543       6677888888776662    1211                    


Q ss_pred             cccc----cccCChHHHHHHHhhc
Q psy4573         181 EVCH----RKLSTKNHLRLHMRTH  200 (306)
Q Consensus       181 ~~C~----~~f~~~~~l~~H~~~h  200 (306)
                      ..|-    .+|++...|..|+...
T Consensus       281 qtc~~~k~~vf~~~~el~~h~~~~  304 (493)
T COG5236         281 QTCRVGKCYVFPYHTELLEHLTRF  304 (493)
T ss_pred             EEEecCcEEEeccHHHHHHHHHHH
Confidence            0121    3588888899998653


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.41  E-value=0.0018  Score=32.42  Aligned_cols=23  Identities=30%  Similarity=0.629  Sum_probs=11.7

Q ss_pred             cccCcccCcCCChhHHHHHHhhcc
Q psy4573         234 YVCEICGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~h~  257 (306)
                      |+|+.|+.... ...|.+|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45556665555 555666655543


No 43 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.23  E-value=0.0014  Score=54.36  Aligned_cols=51  Identities=22%  Similarity=0.444  Sum_probs=35.9

Q ss_pred             CCcccCCC--ChhhhccHHHHHHHHHhcc-------------------cCCccccCcchhhccchHHHHHHh
Q psy4573          97 EGEYKCNQ--CDHVAKKLAYLQAHMKKHR-------------------NEYTAYCDLCQEGFFRKAKYETHN  147 (306)
Q Consensus        97 ~~~~~C~~--C~~~f~~~~~l~~H~~~~~-------------------~~~~~~C~~C~~~~~~~~~l~~H~  147 (306)
                      ++||+|++  |++.+.+.-.|+.|+..-+                   .++||+|++|++.+.....|+.|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            47788866  7788888778887775433                   136777777777777777777663


No 44 
>KOG1146|consensus
Probab=96.07  E-value=0.003  Score=62.13  Aligned_cols=111  Identities=16%  Similarity=0.287  Sum_probs=72.9

Q ss_pred             CCcccccccccccCChHHHHHHhhhcCCCCceecccchhccCChHHHhhhhhhcccCCcccCCCChhhhccHHHHHHHHH
Q psy4573          41 DGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMK  120 (306)
Q Consensus        41 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  120 (306)
                      .+.+.|+.|++.|.....|..||+.-+.+..-  .+|... .....+.+-...-.+..+|.|..|...+....+|.+|++
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~g-q~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCKAG-QNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccch--hHhHhc-cccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            36788999999999999999998885444322  333322 122222222223345677888888888888888888875


Q ss_pred             hccc-------------------------------------------CCccccCcchhhccchHHHHHHhhhcCCCC
Q psy4573         121 KHRN-------------------------------------------EYTAYCDLCQEGFFRKAKYETHNIQKHNAP  154 (306)
Q Consensus       121 ~~~~-------------------------------------------~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~  154 (306)
                      .-..                                           .-.|.|..|++......+|+.|+...+...
T Consensus       540 S~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmtss~~s~  616 (1406)
T KOG1146|consen  540 SDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTASPSSS  616 (1406)
T ss_pred             HHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhccccccccCCCCC
Confidence            4210                                           123678888888888888888877666433


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.05  E-value=0.0042  Score=31.35  Aligned_cols=22  Identities=32%  Similarity=0.830  Sum_probs=14.1

Q ss_pred             ccccccccccCChHHHHHHhhh
Q psy4573          44 LACNVCSKRCGSKSGLKIHMKS   65 (306)
Q Consensus        44 ~~C~~C~~~f~~~~~l~~H~~~   65 (306)
                      |.|..|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666654


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.01  E-value=0.0054  Score=30.95  Aligned_cols=22  Identities=41%  Similarity=1.055  Sum_probs=14.4

Q ss_pred             eeccccccccCChHHHHHHHhh
Q psy4573         178 FECEVCHRKLSTKNHLRLHMRT  199 (306)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~  199 (306)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666654


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=95.90  E-value=0.0042  Score=47.54  Aligned_cols=34  Identities=26%  Similarity=0.662  Sum_probs=16.0

Q ss_pred             cccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcC
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGF  243 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  243 (306)
                      |.|. |+.   ....+..|.++|+++++|.|..|+..|
T Consensus       120 Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        120 YRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            4444 443   333444455555544455555554444


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=95.89  E-value=0.0042  Score=47.54  Aligned_cols=37  Identities=24%  Similarity=0.551  Sum_probs=25.0

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCC
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRR  217 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  217 (306)
                      +|.|. |+.   ....+.+|.++|.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            67776 766   45556777777777777777777766543


No 49 
>KOG2785|consensus
Probab=95.59  E-value=0.036  Score=47.62  Aligned_cols=51  Identities=29%  Similarity=0.510  Sum_probs=44.6

Q ss_pred             CcccCcccCcCCChhHHHHHHhhccCCC-----------------------cccCCcch---HhhcChHHHHHHhhh
Q psy4573         233 PYVCEICGKGFTQKQALNTHKRGHTGEI-----------------------PYHCEFCS---ERFSTKALVRHHVRS  283 (306)
Q Consensus       233 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~-----------------------~~~C~~C~---~~f~~~~~l~~H~~~  283 (306)
                      |-.|..|+..+.+...-..||..+|+-.                       -|.|=.|+   +.|......+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4679999999999999999999888732                       27888899   999999999999976


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.57  E-value=0.0035  Score=32.38  Aligned_cols=21  Identities=24%  Similarity=0.828  Sum_probs=10.1

Q ss_pred             ccCCcchHhhcChHHHHHHhh
Q psy4573         262 YHCEFCSERFSTKALVRHHVR  282 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~  282 (306)
                      |.|..|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            344455555555555444443


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.53  E-value=0.005  Score=31.80  Aligned_cols=22  Identities=27%  Similarity=0.774  Sum_probs=17.1

Q ss_pred             cccCcccCcCCChhHHHHHHhh
Q psy4573         234 YVCEICGKGFTQKQALNTHKRG  255 (306)
Q Consensus       234 ~~C~~C~~~f~~~~~L~~H~~~  255 (306)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888877764


No 52 
>KOG2231|consensus
Probab=95.32  E-value=0.04  Score=51.40  Aligned_cols=107  Identities=21%  Similarity=0.404  Sum_probs=60.8

Q ss_pred             eccccccccCChHHHHHHHhhccCCCCcccCcCCC---------ccCCcHHHHHHHHHccC-CCC----cccCcccCcCC
Q psy4573         179 ECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGK---------GFRRGDALTEHIRIHTG-QRP----YVCEICGKGFT  244 (306)
Q Consensus       179 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~---------~f~~~~~l~~H~~~h~~-~~~----~~C~~C~~~f~  244 (306)
                      .|..| -.|.+...|..|+.--+.  .+.|.+|-.         ...+...|..|+..-.. ++.    -.|..|...|.
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fl  193 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFL  193 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhc
Confidence            46666 666677778888754321  244444332         22345566677654221 211    35777777788


Q ss_pred             ChhHHHHHHhhccCCCcccC---CcchHhhcChHHHHHHhhhcCCCCC
Q psy4573         245 QKQALNTHKRGHTGEIPYHC---EFCSERFSTKALVRHHVRSHHSSAR  289 (306)
Q Consensus       245 ~~~~L~~H~~~h~~~~~~~C---~~C~~~f~~~~~l~~H~~~~h~~~~  289 (306)
                      ....|.+|++.++-.-.| |   +.++.-|..-..|..|.+.+|.-..
T Consensus       194 d~~el~rH~~~~h~~chf-C~~~~~~neyy~~~~dLe~HfR~~HflCE  240 (669)
T KOG2231|consen  194 DDDELYRHLRFDHEFCHF-CDYKTGQNEYYNDYDDLEEHFRKGHFLCE  240 (669)
T ss_pred             cHHHHHHhhccceeheee-cCcccccchhcccchHHHHHhhhcCcccc
Confidence            888887777755433221 2   2234556667777777777775444


No 53 
>KOG2482|consensus
Probab=94.64  E-value=0.098  Score=44.21  Aligned_cols=153  Identities=19%  Similarity=0.303  Sum_probs=91.5

Q ss_pred             CccccCcchhhc-cchHHHHHHhhhcCCCCCcccccccccccccccccccC---cceeccccccccCChHHHHHHHhh--
Q psy4573         126 YTAYCDLCQEGF-FRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLG---IKFECEVCHRKLSTKNHLRLHMRT--  199 (306)
Q Consensus       126 ~~~~C~~C~~~~-~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~---~~~~C~~C~~~f~~~~~l~~H~~~--  199 (306)
                      ...+|-.|+..+ ...+.+..|+-..|+-..   +.-++...-.....+..   ..+.|-.|.+.|+++..|+.||+.  
T Consensus       143 fslqClFCn~e~lgnRs~~l~Hlf~~H~lni---GlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~  219 (423)
T KOG2482|consen  143 FSLQCLFCNNEGLGNRSEILEHLFHVHGLNI---GLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKR  219 (423)
T ss_pred             eeeEEEEecchhcccHHHHHHHHHHHhhhcc---CCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhcc
Confidence            456788888776 457777788777773210   00000000001111111   158899999999999999999987  


Q ss_pred             ccCCCC--------cccCc--CCCccCCcHHHHHHH--HHc---------------cCCCC--cccCcccCcCCChhHHH
Q psy4573         200 HTNERP--------AVCSY--CGKGFRRGDALTEHI--RIH---------------TGQRP--YVCEICGKGFTQKQALN  250 (306)
Q Consensus       200 h~~~~~--------~~C~~--C~~~f~~~~~l~~H~--~~h---------------~~~~~--~~C~~C~~~f~~~~~L~  250 (306)
                      |..-+|        |.=.+  -|++   ......+.  .+.               .+..+  .+|..|.....+...|.
T Consensus       220 HrrinPknreYDkfyiINY~ev~ks---~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~  296 (423)
T KOG2482|consen  220 HRRINPKNREYDKFYIINYLEVGKS---WTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLF  296 (423)
T ss_pred             CcccCCCccccceEEEEeHhhcCCc---cchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHH
Confidence            443333        11000  0111   11111111  111               11122  58999999999999999


Q ss_pred             HHHhhccC---------------------------CCcccCCcchHhhcChHHHHHHhhhc
Q psy4573         251 THKRGHTG---------------------------EIPYHCEFCSERFSTKALVRHHVRSH  284 (306)
Q Consensus       251 ~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~~~  284 (306)
                      .||+..|.                           .+.-.|-.|.-.|-.+..|..||..+
T Consensus       297 eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  297 EHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             HHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            99987663                           11246999999999999999998653


No 54 
>KOG2231|consensus
Probab=94.63  E-value=0.092  Score=49.06  Aligned_cols=22  Identities=18%  Similarity=0.264  Sum_probs=11.5

Q ss_pred             cCCCChhhhccHHHHHHHHHhc
Q psy4573         101 KCNQCDHVAKKLAYLQAHMKKH  122 (306)
Q Consensus       101 ~C~~C~~~f~~~~~l~~H~~~~  122 (306)
                      .|..|...|.....|..|++.+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~  205 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD  205 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc
Confidence            3555555555555555555443


No 55 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.26  E-value=0.079  Score=37.59  Aligned_cols=76  Identities=22%  Similarity=0.409  Sum_probs=42.1

Q ss_pred             ceeccccccccCChHHHHHHHhhccC--CC------------CcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCc
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTN--ER------------PAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKG  242 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~--~~------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  242 (306)
                      |..|+.||.+..+...|.+-.  |+-  ..            ...|-.|...|.......  ...-.....|+|+.|...
T Consensus        15 P~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        15 PVECPICGLTLILSTHLARSY--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCcCCcCCCEEeccchHHHhh--hccCCCcccccccccccCCCCcccCcCCCCCCccccc--ccccccccceeCCCCCCc
Confidence            678888988888888776642  210  01            123666776665442111  000122335667777666


Q ss_pred             CCChhHHHHHHhhc
Q psy4573         243 FTQKQALNTHKRGH  256 (306)
Q Consensus       243 f~~~~~L~~H~~~h  256 (306)
                      |-..-++..|...|
T Consensus        91 FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        91 FCVDCDVFVHESLH  104 (112)
T ss_pred             cccccchhhhhhcc
Confidence            66666666665544


No 56 
>KOG2785|consensus
Probab=94.15  E-value=0.094  Score=45.12  Aligned_cols=51  Identities=24%  Similarity=0.559  Sum_probs=43.0

Q ss_pred             CcccCcCCCccCCcHHHHHHHHHccCC-----------------------CCcccCccc---CcCCChhHHHHHHhh
Q psy4573         205 PAVCSYCGKGFRRGDALTEHIRIHTGQ-----------------------RPYVCEICG---KGFTQKQALNTHKRG  255 (306)
Q Consensus       205 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~L~~H~~~  255 (306)
                      |-.|-.|+..+.+-.....|+..+++-                       ..+.|..|+   +.|.+....+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            356999999999999999999887652                       347898998   999999999999964


No 57 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.02  E-value=0.038  Score=27.89  Aligned_cols=20  Identities=20%  Similarity=0.647  Sum_probs=11.9

Q ss_pred             ccCCcchHhhcChHHHHHHhh
Q psy4573         262 YHCEFCSERFSTKALVRHHVR  282 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~  282 (306)
                      ..|++|++.| ..+.|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566666666 5555666654


No 58 
>KOG2482|consensus
Probab=93.92  E-value=0.087  Score=44.52  Aligned_cols=50  Identities=22%  Similarity=0.403  Sum_probs=33.3

Q ss_pred             cccccccccc-CChHHHHHHhhhcCC------C----------------CceecccchhccCChHHHhhhhhh
Q psy4573          44 LACNVCSKRC-GSKSGLKIHMKSHTL------S----------------KRYACSICLAEFHTLTEKDRHTLS   93 (306)
Q Consensus        44 ~~C~~C~~~f-~~~~~l~~H~~~h~~------~----------------~~~~C~~C~~~~~~~~~l~~H~~~   93 (306)
                      ..|-.|...+ ..++....|+-..++      +                ..+.|-+|.+.|..+..|..||+.
T Consensus       145 lqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  145 LQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            5688887766 445555566543211      1                147888888888888888888875


No 59 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.53  E-value=0.096  Score=37.51  Aligned_cols=25  Identities=32%  Similarity=0.648  Sum_probs=23.3

Q ss_pred             ccC----CcchHhhcChHHHHHHhhhcCC
Q psy4573         262 YHC----EFCSERFSTKALVRHHVRSHHS  286 (306)
Q Consensus       262 ~~C----~~C~~~f~~~~~l~~H~~~~h~  286 (306)
                      |.|    ..|++...+...|..|++.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999999885


No 60 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.38  E-value=0.12  Score=43.79  Aligned_cols=135  Identities=26%  Similarity=0.475  Sum_probs=70.6

Q ss_pred             ccccCc--chhhccchHHHHHHhhhcCCCCCcccccc---cccccccccccccCcceeccccccccCChHHHHHHHhhcc
Q psy4573         127 TAYCDL--CQEGFFRKAKYETHNIQKHNAPPFECESC---KKIFTYHKNTTHLGIKFECEVCHRKLSTKNHLRLHMRTHT  201 (306)
Q Consensus       127 ~~~C~~--C~~~~~~~~~l~~H~~~~h~~~~~~c~~c---~~~f~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  201 (306)
                      .|.||.  |.........|..|.+..|+.  +.|.+|   .+.|+..                ...-.+..|..|...-.
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E----------------~~lF~~~~Lr~H~~~G~  212 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNE----------------IRLFRSSTLRDHKNGGL  212 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccc----------------eeeeecccccccccCCc
Confidence            467764  777777777788887777753  334433   3333321                11222334555554433


Q ss_pred             CCCCc----ccCcCCCccCCcHHHHHHHHHccCCCCcccCcccC-------cCCChhHHHHHHhhccCCCcccCCc--ch
Q psy4573         202 NERPA----VCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGK-------GFTQKQALNTHKRGHTGEIPYHCEF--CS  268 (306)
Q Consensus       202 ~~~~~----~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~L~~H~~~h~~~~~~~C~~--C~  268 (306)
                      .+..|    .|..|...|.+...|..|.+.-+ +   +|-+|+.       -|.+...|..|-+.-|    |.|..  |-
T Consensus       213 ~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~H-E---~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~  284 (493)
T COG5236         213 EEEGFKGHPLCIFCKIYFYDDDELRRHCRLRH-E---ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCR  284 (493)
T ss_pred             cccCcCCCchhhhccceecChHHHHHHHHhhh-h---hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEe
Confidence            22222    36666666666666666665432 2   2333332       2555666666654211    33322  21


Q ss_pred             ----HhhcChHHHHHHhhhcCCC
Q psy4573         269 ----ERFSTKALVRHHVRSHHSS  287 (306)
Q Consensus       269 ----~~f~~~~~l~~H~~~~h~~  287 (306)
                          +.|.....|..|+...|+.
T Consensus       285 ~~k~~vf~~~~el~~h~~~~h~~  307 (493)
T COG5236         285 VGKCYVFPYHTELLEHLTRFHKV  307 (493)
T ss_pred             cCcEEEeccHHHHHHHHHHHhhc
Confidence                3567777777777776664


No 61 
>KOG1146|consensus
Probab=92.50  E-value=0.041  Score=54.62  Aligned_cols=56  Identities=25%  Similarity=0.462  Sum_probs=46.7

Q ss_pred             ccCCCCcccCcccCcCCChhHHHHHHhhcc-------------------------CCCcccCCcchHhhcChHHHHHHhh
Q psy4573         228 HTGQRPYVCEICGKGFTQKQALNTHKRGHT-------------------------GEIPYHCEFCSERFSTKALVRHHVR  282 (306)
Q Consensus       228 h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~-------------------------~~~~~~C~~C~~~f~~~~~l~~H~~  282 (306)
                      +...+.|+|+.|+..|.....|..|++..+                         +.++|.|..|.++++...+|..|++
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            444577899999999999999999998733                         2346999999999999999999986


Q ss_pred             h
Q psy4573         283 S  283 (306)
Q Consensus       283 ~  283 (306)
                      .
T Consensus       540 S  540 (1406)
T KOG1146|consen  540 S  540 (1406)
T ss_pred             H
Confidence            5


No 62 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.27  E-value=0.092  Score=28.50  Aligned_cols=10  Identities=40%  Similarity=0.952  Sum_probs=4.4

Q ss_pred             cccCcCCCcc
Q psy4573         206 AVCSYCGKGF  215 (306)
Q Consensus       206 ~~C~~C~~~f  215 (306)
                      |.|..||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            3444444443


No 63 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.02  E-value=0.13  Score=28.15  Aligned_cols=23  Identities=17%  Similarity=0.548  Sum_probs=15.1

Q ss_pred             cccccccccccCChHHHHHHhhh
Q psy4573          43 SLACNVCSKRCGSKSGLKIHMKS   65 (306)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~   65 (306)
                      +|.|..|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777766666666543


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.99  E-value=0.15  Score=27.84  Aligned_cols=23  Identities=17%  Similarity=0.603  Sum_probs=16.3

Q ss_pred             ceeccccccccCChHHHHHHHhh
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRT  199 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~  199 (306)
                      +|.|.+|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777777777777653


No 65 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.76  E-value=0.46  Score=33.77  Aligned_cols=21  Identities=10%  Similarity=0.309  Sum_probs=12.8

Q ss_pred             CccccCcchhhccchHHHHHH
Q psy4573         126 YTAYCDLCQEGFFRKAKYETH  146 (306)
Q Consensus       126 ~~~~C~~C~~~~~~~~~l~~H  146 (306)
                      -|..|+.|+-.......|.+.
T Consensus        14 LP~~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARS   34 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHh
Confidence            356677777666666555543


No 66 
>KOG2893|consensus
Probab=91.55  E-value=0.058  Score=43.12  Aligned_cols=42  Identities=26%  Similarity=0.508  Sum_probs=33.3

Q ss_pred             eccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHH
Q psy4573         179 ECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEH  224 (306)
Q Consensus       179 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  224 (306)
                      =|..|++.|.+..-|..|++.-+    |+|.+|.+...+-..|..|
T Consensus        12 wcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceee
Confidence            38889999999998988886543    8899998887776666666


No 67 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.18  E-value=0.13  Score=31.00  Aligned_cols=31  Identities=26%  Similarity=0.410  Sum_probs=21.6

Q ss_pred             ccCCCcccCCcchHhhcChHHHHHHhhhcCC
Q psy4573         256 HTGEIPYHCEFCSERFSTKALVRHHVRSHHS  286 (306)
Q Consensus       256 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  286 (306)
                      -.|+..++|+-|+..|....+..+|+..-|+
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3456667777777777777777777766554


No 68 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.50  E-value=0.054  Score=48.83  Aligned_cols=121  Identities=29%  Similarity=0.490  Sum_probs=86.5

Q ss_pred             cceeccccccccCChHHHHHHHh--hccCC--CCcccC--cCCCccCCcHHHHHHHHHccCCCCcccCc-----------
Q psy4573         176 IKFECEVCHRKLSTKNHLRLHMR--THTNE--RPAVCS--YCGKGFRRGDALTEHIRIHTGQRPYVCEI-----------  238 (306)
Q Consensus       176 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~-----------  238 (306)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.....+..|...|.+..++.+..           
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            36889999999999999999999  79999  899999  79999999999999999887665544422           


Q ss_pred             --------------------------ccCcCCChhHHHHHHhhccCCC--cccCCcchHhhcChHHHHHHhhhcCCCCCC
Q psy4573         239 --------------------------CGKGFTQKQALNTHKRGHTGEI--PYHCEFCSERFSTKALVRHHVRSHHSSARL  290 (306)
Q Consensus       239 --------------------------C~~~f~~~~~L~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~  290 (306)
                                                |-..+.....+..|...|....  .+.+..|...|.....+..|++.+.-..++
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  447 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPL  447 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCce
Confidence                                      2222333333333333333322  356777888888888888888887777665


Q ss_pred             Cccccc
Q psy4573         291 GLNLLD  296 (306)
Q Consensus       291 ~C~~c~  296 (306)
                      -|..+.
T Consensus       448 ~~~~~~  453 (467)
T COG5048         448 LCSILK  453 (467)
T ss_pred             eecccc
Confidence            554443


No 69 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=90.11  E-value=0.53  Score=33.64  Aligned_cols=71  Identities=23%  Similarity=0.413  Sum_probs=45.9

Q ss_pred             ceeccccccccCChHHHHHHHhh-ccCCCCcccCcCCCccCCcHHHHHHHHHcc--------------C---------CC
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRT-HTNERPAVCSYCGKGFRRGDALTEHIRIHT--------------G---------QR  232 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--------------~---------~~  232 (306)
                      ...|..|+..... +.+..|++. |+......          ...+..-++.-.              +         -.
T Consensus        11 vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~----------~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~   79 (109)
T PF12013_consen   11 VLICRQCQYAVQP-SEVESHLRKRHHILKSQE----------RQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYD   79 (109)
T ss_pred             EEEeCCCCcccCc-hHHHHHHHHhcccccHHH----------HHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCC
Confidence            5789999988777 789999985 43321110          011111111100              0         12


Q ss_pred             Cccc----CcccCcCCChhHHHHHHhhccC
Q psy4573         233 PYVC----EICGKGFTQKQALNTHKRGHTG  258 (306)
Q Consensus       233 ~~~C----~~C~~~f~~~~~L~~H~~~h~~  258 (306)
                      .|.|    ..|++.+.+...|..|++.+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999998775


No 70 
>KOG4173|consensus
Probab=88.94  E-value=0.25  Score=38.67  Aligned_cols=78  Identities=24%  Similarity=0.440  Sum_probs=60.9

Q ss_pred             ceeccc--chhccCChHHHhhhhhhcccCCcccCCCChhhhccHHHHHHHHHhc----------ccCCccccC--cchhh
Q psy4573          71 RYACSI--CLAEFHTLTEKDRHTLSHVVEGEYKCNQCDHVAKKLAYLQAHMKKH----------RNEYTAYCD--LCQEG  136 (306)
Q Consensus        71 ~~~C~~--C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~----------~~~~~~~C~--~C~~~  136 (306)
                      .+.|++  |...|.+.+....|...-++   ..|.+|.+.|++...|..|+...          .+.-.|+|-  .|+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            477877  77788888888888765544   36889999999988888887543          235568884  59999


Q ss_pred             ccchHHHHHHhhhcC
Q psy4573         137 FFRKAKYETHNIQKH  151 (306)
Q Consensus       137 ~~~~~~l~~H~~~~h  151 (306)
                      |.+...-..|+...|
T Consensus       156 FkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhHHHHhc
Confidence            999999999988887


No 71 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=87.43  E-value=0.28  Score=29.58  Aligned_cols=26  Identities=12%  Similarity=0.257  Sum_probs=20.6

Q ss_pred             cceeccccccccCChHHHHHHHhhcc
Q psy4573         176 IKFECEVCHRKLSTKNHLRLHMRTHT  201 (306)
Q Consensus       176 ~~~~C~~C~~~f~~~~~l~~H~~~h~  201 (306)
                      .-++||.|+..|....+..+|....+
T Consensus        16 ~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          16 EFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            36788888888888888888887643


No 72 
>KOG2893|consensus
Probab=86.10  E-value=0.2  Score=40.21  Aligned_cols=38  Identities=29%  Similarity=0.724  Sum_probs=16.6

Q ss_pred             cCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHH
Q psy4573         208 CSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQAL  249 (306)
Q Consensus       208 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L  249 (306)
                      |=+|++.|.+...|.+|++-    +-|+|.+|.+..-+-..|
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpgl   50 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGL   50 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCc
Confidence            34445555554444444432    224444444443333333


No 73 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.82  E-value=0.63  Score=33.10  Aligned_cols=31  Identities=35%  Similarity=0.722  Sum_probs=19.1

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCc
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRG  218 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  218 (306)
                      +..|+.||..|-..           ++.|..|+.||..|.-.
T Consensus         9 KR~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            45566666666552           34666777777666544


No 74 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=85.78  E-value=0.25  Score=44.50  Aligned_cols=59  Identities=25%  Similarity=0.323  Sum_probs=46.4

Q ss_pred             hhcCCcccccccccccCChHHHHHHhhhcCCCCceecccch--hccCChHHHhhhhhhccc
Q psy4573          38 VEQDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICL--AEFHTLTEKDRHTLSHVV   96 (306)
Q Consensus        38 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~--~~~~~~~~l~~H~~~~~~   96 (306)
                      ......+.|+.|...|........|...+..+.++.|...+  ..+.....+..|...+..
T Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (467)
T COG5048          28 SNAPRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHN   88 (467)
T ss_pred             ccCCchhhcccccccccccchhhhhcccccccCCccccccccccccCCcchhhhhcccccc
Confidence            44566788999999999999999999999999999998854  455566666666665543


No 75 
>KOG4173|consensus
Probab=85.52  E-value=0.39  Score=37.66  Aligned_cols=76  Identities=29%  Similarity=0.600  Sum_probs=48.8

Q ss_pred             ceeccc--cccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHH-Hc---------cCCCCcccC--cccCc
Q psy4573         177 KFECEV--CHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIR-IH---------TGQRPYVCE--ICGKG  242 (306)
Q Consensus       177 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~-~h---------~~~~~~~C~--~C~~~  242 (306)
                      .+.|+.  |...|.+..++..|..+-++   -.|..|.+.|.+...|..|+. .|         .|...|.|-  .|+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            466765  66777777777777655332   357777777777777777764 23         234557773  37777


Q ss_pred             CCChhHHHHHHhh
Q psy4573         243 FTQKQALNTHKRG  255 (306)
Q Consensus       243 f~~~~~L~~H~~~  255 (306)
                      |.+...-..|+-.
T Consensus       156 FkT~r~RkdH~I~  168 (253)
T KOG4173|consen  156 FKTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhhHHHH
Confidence            7777777777643


No 76 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=85.28  E-value=0.49  Score=25.81  Aligned_cols=10  Identities=40%  Similarity=0.733  Sum_probs=4.9

Q ss_pred             cccCcCCCcc
Q psy4573         206 AVCSYCGKGF  215 (306)
Q Consensus       206 ~~C~~C~~~f  215 (306)
                      |.|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            4455555444


No 77 
>PHA00626 hypothetical protein
Probab=83.91  E-value=0.83  Score=27.70  Aligned_cols=14  Identities=21%  Similarity=0.411  Sum_probs=7.8

Q ss_pred             ceeccccccccCCh
Q psy4573         177 KFECEVCHRKLSTK  190 (306)
Q Consensus       177 ~~~C~~C~~~f~~~  190 (306)
                      .|.|+.||+.|...
T Consensus        23 rYkCkdCGY~ft~~   36 (59)
T PHA00626         23 DYVCCDCGYNDSKD   36 (59)
T ss_pred             ceEcCCCCCeechh
Confidence            46666666655443


No 78 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=83.32  E-value=0.78  Score=25.41  Aligned_cols=11  Identities=27%  Similarity=0.748  Sum_probs=5.9

Q ss_pred             ceecccccccc
Q psy4573         177 KFECEVCHRKL  187 (306)
Q Consensus       177 ~~~C~~C~~~f  187 (306)
                      ..+|+.|+..|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            45555555544


No 79 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=83.26  E-value=0.78  Score=23.31  Aligned_cols=8  Identities=50%  Similarity=1.364  Sum_probs=3.1

Q ss_pred             cCcCCCcc
Q psy4573         208 CSYCGKGF  215 (306)
Q Consensus       208 C~~C~~~f  215 (306)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            33333333


No 80 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.90  E-value=0.7  Score=26.60  Aligned_cols=29  Identities=21%  Similarity=0.587  Sum_probs=12.6

Q ss_pred             cccccccccccccccccccCcceecccccc
Q psy4573         156 FECESCKKIFTYHKNTTHLGIKFECEVCHR  185 (306)
Q Consensus       156 ~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~  185 (306)
                      |.|..||..|........ ...-.|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC-CCCCcCCCCCC
Confidence            344444444443333222 33445555554


No 81 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=82.15  E-value=0.8  Score=25.53  Aligned_cols=11  Identities=27%  Similarity=0.727  Sum_probs=5.7

Q ss_pred             ceecccccccc
Q psy4573         177 KFECEVCHRKL  187 (306)
Q Consensus       177 ~~~C~~C~~~f  187 (306)
                      ..+|+.|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            45555555444


No 82 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=81.51  E-value=0.85  Score=28.16  Aligned_cols=10  Identities=40%  Similarity=1.009  Sum_probs=5.6

Q ss_pred             CCcccCcCCC
Q psy4573         204 RPAVCSYCGK  213 (306)
Q Consensus       204 ~~~~C~~C~~  213 (306)
                      ++|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4566666654


No 83 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=80.49  E-value=0.97  Score=25.22  Aligned_cols=9  Identities=22%  Similarity=0.685  Sum_probs=4.0

Q ss_pred             eeccccccc
Q psy4573         178 FECEVCHRK  186 (306)
Q Consensus       178 ~~C~~C~~~  186 (306)
                      ..|+.|+..
T Consensus        26 v~C~~C~~~   34 (38)
T TIGR02098        26 VRCGKCGHV   34 (38)
T ss_pred             EECCCCCCE
Confidence            444444443


No 84 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.31  E-value=0.99  Score=25.56  Aligned_cols=9  Identities=22%  Similarity=0.508  Sum_probs=4.4

Q ss_pred             ceecccccc
Q psy4573         177 KFECEVCHR  185 (306)
Q Consensus       177 ~~~C~~C~~  185 (306)
                      ...|+.||.
T Consensus        26 ~~~CP~Cg~   34 (41)
T smart00834       26 LATCPECGG   34 (41)
T ss_pred             CCCCCCCCC
Confidence            344555554


No 85 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=78.36  E-value=1.1  Score=27.54  Aligned_cols=32  Identities=25%  Similarity=0.407  Sum_probs=16.9

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCcccCcCCC
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGK  213 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  213 (306)
                      .|.||.||........--+     ...++|.|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~~CR-----k~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCAKCR-----KLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhhhHH-----HcCCceECCCcCc
Confidence            5666666654443332211     1235677777775


No 86 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=78.16  E-value=0.45  Score=38.57  Aligned_cols=43  Identities=30%  Similarity=0.733  Sum_probs=22.9

Q ss_pred             CCcccCcCCCccCCcHHHHHHHHHc----------cCCCC-----cccCcccCcCCCh
Q psy4573         204 RPAVCSYCGKGFRRGDALTEHIRIH----------TGQRP-----YVCEICGKGFTQK  246 (306)
Q Consensus       204 ~~~~C~~C~~~f~~~~~l~~H~~~h----------~~~~~-----~~C~~C~~~f~~~  246 (306)
                      +.+.|+.|+..|.+.......+++-          .+..|     ..||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            4456666666666554444443321          11222     4688888776544


No 87 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=76.12  E-value=1.2  Score=25.84  Aligned_cols=24  Identities=13%  Similarity=0.562  Sum_probs=10.4

Q ss_pred             cccCCcchHhhcC----hHHHHHHhhhc
Q psy4573         261 PYHCEFCSERFST----KALVRHHVRSH  284 (306)
Q Consensus       261 ~~~C~~C~~~f~~----~~~l~~H~~~~  284 (306)
                      ...|.+|++.+..    -+.|.+|++..
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            3455555554433    24566665443


No 88 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=75.85  E-value=1.8  Score=25.41  Aligned_cols=7  Identities=29%  Similarity=0.975  Sum_probs=3.1

Q ss_pred             eeccccc
Q psy4573         178 FECEVCH  184 (306)
Q Consensus       178 ~~C~~C~  184 (306)
                      ..|+.||
T Consensus        22 ~~Cp~CG   28 (46)
T PRK00398         22 VRCPYCG   28 (46)
T ss_pred             eECCCCC
Confidence            4444444


No 89 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=75.66  E-value=1.5  Score=27.23  Aligned_cols=39  Identities=26%  Similarity=0.658  Sum_probs=17.8

Q ss_pred             CcccCc-ccCcCCChhHHHHHHhhccCCCcccCCc----chHhh
Q psy4573         233 PYVCEI-CGKGFTQKQALNTHKRGHTGEIPYHCEF----CSERF  271 (306)
Q Consensus       233 ~~~C~~-C~~~f~~~~~L~~H~~~h~~~~~~~C~~----C~~~f  271 (306)
                      +..|+. |+..-..+..|..|+...-...+..|++    |+..+
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~   52 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERV   52 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EE
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCcc
Confidence            345555 3322234556666666555555566666    66555


No 90 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=75.53  E-value=1.7  Score=33.49  Aligned_cols=23  Identities=43%  Similarity=1.112  Sum_probs=13.8

Q ss_pred             CcccCcccCcCCChhHHHHHHhhccCCCcccCCcch
Q psy4573         233 PYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCS  268 (306)
Q Consensus       233 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~  268 (306)
                      .|+|++||..             +.++-|-.||+|+
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            5666666654             3445556666666


No 91 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=74.88  E-value=3  Score=21.16  Aligned_cols=20  Identities=30%  Similarity=0.800  Sum_probs=15.0

Q ss_pred             eeccccccccCChHHHHHHHh
Q psy4573         178 FECEVCHRKLSTKNHLRLHMR  198 (306)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~  198 (306)
                      ..||.|++.+ ....++.|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3588888887 5577888875


No 92 
>KOG2186|consensus
Probab=74.87  E-value=1.8  Score=35.32  Aligned_cols=46  Identities=26%  Similarity=0.517  Sum_probs=36.8

Q ss_pred             ccccccccccCChHHHHHHhhhcCCCCceecccchhccCChHHHhhhhh
Q psy4573          44 LACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDRHTL   92 (306)
Q Consensus        44 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~H~~   92 (306)
                      |.|..||.... ...+.+|+-..++ .-|.|--|+..|.. .+...|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            78999998876 6678889888887 47899999999977 66677754


No 93 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=74.13  E-value=0.75  Score=35.03  Aligned_cols=14  Identities=43%  Similarity=0.771  Sum_probs=7.7

Q ss_pred             cccCcccCcCCChh
Q psy4573         234 YVCEICGKGFTQKQ  247 (306)
Q Consensus       234 ~~C~~C~~~f~~~~  247 (306)
                      ++|+.||..|.+..
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            55666666555443


No 94 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=74.08  E-value=2.8  Score=30.46  Aligned_cols=31  Identities=35%  Similarity=0.501  Sum_probs=18.9

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCc
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRG  218 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  218 (306)
                      +..|+.||..|...           ++.|..|+.||..|.-.
T Consensus         9 Kr~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         9 KRICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            45566666666552           44666777777666544


No 95 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=72.58  E-value=2.6  Score=22.61  Aligned_cols=9  Identities=22%  Similarity=0.763  Sum_probs=4.2

Q ss_pred             ceecccccc
Q psy4573         177 KFECEVCHR  185 (306)
Q Consensus       177 ~~~C~~C~~  185 (306)
                      +.+|+.||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            445555553


No 96 
>KOG2807|consensus
Probab=71.46  E-value=4  Score=34.72  Aligned_cols=36  Identities=22%  Similarity=0.470  Sum_probs=25.9

Q ss_pred             cCCcccccccccccCChHHHHHHhhhcCCCCceecccchhccCChHHHhh
Q psy4573          40 QDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTEKDR   89 (306)
Q Consensus        40 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~l~~   89 (306)
                      ..+.|.||.|....-+.              |..|++|+-+.-....|++
T Consensus       273 ~~~Gy~CP~CkakvCsL--------------P~eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  273 SGGGYFCPQCKAKVCSL--------------PIECPICSLTLVSSPHLAR  308 (378)
T ss_pred             ccCceeCCcccCeeecC--------------CccCCccceeEecchHHHH
Confidence            34568899886544332              7889999988877777775


No 97 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=71.19  E-value=0.97  Score=36.66  Aligned_cols=22  Identities=27%  Similarity=0.459  Sum_probs=14.3

Q ss_pred             CCcccccccccccCChHHHHHH
Q psy4573          41 DGSLACNVCSKRCGSKSGLKIH   62 (306)
Q Consensus        41 ~~~~~C~~C~~~f~~~~~l~~H   62 (306)
                      ++.++||.|+..|.+.......
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~   24 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGK   24 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCC
Confidence            4567788888888766443333


No 98 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=70.72  E-value=4.1  Score=31.26  Aligned_cols=31  Identities=19%  Similarity=0.406  Sum_probs=16.1

Q ss_pred             CCCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCc
Q psy4573         203 ERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKG  242 (306)
Q Consensus       203 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  242 (306)
                      ...|.|+.|+..|+...++.         ..|.|+.||..
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            34455666665555555443         13556655543


No 99 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=70.35  E-value=5.9  Score=30.00  Aligned_cols=14  Identities=14%  Similarity=0.337  Sum_probs=7.6

Q ss_pred             CCcccCcCCCccCC
Q psy4573         204 RPAVCSYCGKGFRR  217 (306)
Q Consensus       204 ~~~~C~~C~~~f~~  217 (306)
                      ..|.|+.|+..|..
T Consensus        98 ~~Y~Cp~C~~~y~~  111 (147)
T smart00531       98 AYYKCPNCQSKYTF  111 (147)
T ss_pred             cEEECcCCCCEeeH
Confidence            34556666655553


No 100
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=70.30  E-value=3.2  Score=25.38  Aligned_cols=12  Identities=25%  Similarity=0.545  Sum_probs=6.3

Q ss_pred             cceecccccccc
Q psy4573         176 IKFECEVCHRKL  187 (306)
Q Consensus       176 ~~~~C~~C~~~f  187 (306)
                      ....|+.||..+
T Consensus        21 eiV~Cp~CGael   32 (54)
T TIGR01206        21 ELVICDECGAEL   32 (54)
T ss_pred             CEEeCCCCCCEE
Confidence            345566665543


No 101
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=68.52  E-value=2.9  Score=25.17  Aligned_cols=9  Identities=33%  Similarity=0.940  Sum_probs=3.4

Q ss_pred             ccCcchhhc
Q psy4573         129 YCDLCQEGF  137 (306)
Q Consensus       129 ~C~~C~~~~  137 (306)
                      .|+.|+..|
T Consensus         7 ~C~~Cg~~f   15 (52)
T TIGR02605         7 RCTACGHRF   15 (52)
T ss_pred             EeCCCCCEe
Confidence            333333333


No 102
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=67.86  E-value=4.8  Score=30.91  Aligned_cols=34  Identities=21%  Similarity=0.502  Sum_probs=23.0

Q ss_pred             cCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhh
Q psy4573         229 TGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERF  271 (306)
Q Consensus       229 ~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f  271 (306)
                      ....-|.|+.|+..|+....+.         .-|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            3445577888887777776664         247788887654


No 103
>KOG2807|consensus
Probab=67.36  E-value=7  Score=33.30  Aligned_cols=25  Identities=32%  Similarity=0.460  Sum_probs=13.6

Q ss_pred             CcccCCcchHhhcChHHHHHHhhhc
Q psy4573         260 IPYHCEFCSERFSTKALVRHHVRSH  284 (306)
Q Consensus       260 ~~~~C~~C~~~f~~~~~l~~H~~~~  284 (306)
                      ..|+|+.|...|-.--+..-|...|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            3466666666665555555554443


No 104
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=66.22  E-value=4.6  Score=30.59  Aligned_cols=38  Identities=21%  Similarity=0.424  Sum_probs=22.4

Q ss_pred             CCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhh
Q psy4573         230 GQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERF  271 (306)
Q Consensus       230 ~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f  271 (306)
                      ...-|.|+.|+..|+....+.. .  . ....|.|+.|+...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            3456888888887775433321 0  1 13338888888654


No 105
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=64.95  E-value=5.2  Score=31.40  Aligned_cols=30  Identities=23%  Similarity=0.511  Sum_probs=16.8

Q ss_pred             CCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCc
Q psy4573         204 RPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKG  242 (306)
Q Consensus       204 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  242 (306)
                      ..|.|+.|+..|.....+.         ..|.|+.||..
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             CEEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            4466666666665554432         24666666654


No 106
>KOG2186|consensus
Probab=64.22  E-value=3.3  Score=33.82  Aligned_cols=47  Identities=21%  Similarity=0.581  Sum_probs=32.1

Q ss_pred             cccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCcCCChhHHHHHHhh
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKGFTQKQALNTHKRG  255 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  255 (306)
                      |.|..||...... .+..|+..-.+ .-|.|-.|+..|.. .....|..-
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            6778888776544 45667777665 45778888888876 666666653


No 107
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=63.93  E-value=3.7  Score=25.41  Aligned_cols=38  Identities=16%  Similarity=0.470  Sum_probs=17.4

Q ss_pred             cccccc--cccccCChHHHHHHhhhcCCCCceeccc----chhcc
Q psy4573          43 SLACNV--CSKRCGSKSGLKIHMKSHTLSKRYACSI----CLAEF   81 (306)
Q Consensus        43 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~~   81 (306)
                      ...|+.  |...+. ...|..|+...-+..+..|++    |+..+
T Consensus         9 ~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~   52 (60)
T PF02176_consen    9 PVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERV   52 (60)
T ss_dssp             EEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EE
T ss_pred             EeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCcc
Confidence            445655  333332 455666666555555566666    65544


No 108
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=63.30  E-value=4  Score=24.28  Aligned_cols=11  Identities=27%  Similarity=1.053  Sum_probs=6.7

Q ss_pred             ceecccccccc
Q psy4573         177 KFECEVCHRKL  187 (306)
Q Consensus       177 ~~~C~~C~~~f  187 (306)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            46666666665


No 109
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=61.51  E-value=7.2  Score=30.59  Aligned_cols=33  Identities=24%  Similarity=0.594  Sum_probs=22.1

Q ss_pred             CCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhh
Q psy4573         230 GQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERF  271 (306)
Q Consensus       230 ~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f  271 (306)
                      ...-|.|+.|+..|+....+.         ..|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            344577888887777766553         247888887654


No 110
>PF12907 zf-met2:  Zinc-binding
Probab=61.20  E-value=8.3  Score=21.89  Aligned_cols=28  Identities=18%  Similarity=0.612  Sum_probs=20.1

Q ss_pred             ccCCcchHhh---cChHHHHHHhhhcCCCCC
Q psy4573         262 YHCEFCSERF---STKALVRHHVRSHHSSAR  289 (306)
Q Consensus       262 ~~C~~C~~~f---~~~~~l~~H~~~~h~~~~  289 (306)
                      +.|.+|.-+|   .+...|..|....|++..
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~   32 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNT   32 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCC
Confidence            5688888655   355678888888887753


No 111
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=60.93  E-value=2.9  Score=34.25  Aligned_cols=23  Identities=22%  Similarity=0.521  Sum_probs=12.5

Q ss_pred             CCCcccCcccCcCCChhHHHHHH
Q psy4573         231 QRPYVCEICGKGFTQKQALNTHK  253 (306)
Q Consensus       231 ~~~~~C~~C~~~f~~~~~L~~H~  253 (306)
                      .+++.||.||........|..-.
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmSt  229 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMST  229 (314)
T ss_pred             CCCCCCCCCCCcccccccceeee
Confidence            35566666666555555554333


No 112
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=59.15  E-value=4.6  Score=27.17  Aligned_cols=31  Identities=29%  Similarity=0.549  Sum_probs=17.3

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCC
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRR  217 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  217 (306)
                      +|.||.|++.-..        +  .+...|.|..|+..|..
T Consensus        35 ~~~Cp~C~~~~Vk--------R--~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          35 KHVCPFCGRTTVK--------R--IATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CCcCCCCCCccee--------e--eccCeEEcCCCCCeecc
Confidence            5667777664211        1  12345777777777654


No 113
>KOG4377|consensus
Probab=57.89  E-value=4.9  Score=35.30  Aligned_cols=102  Identities=25%  Similarity=0.505  Sum_probs=65.6

Q ss_pred             ceecc--ccccccCChHHHHHHHhhccCC------------CCcccC--cCCCccCCcHHHHHHHHHccCC-------CC
Q psy4573         177 KFECE--VCHRKLSTKNHLRLHMRTHTNE------------RPAVCS--YCGKGFRRGDALTEHIRIHTGQ-------RP  233 (306)
Q Consensus       177 ~~~C~--~C~~~f~~~~~l~~H~~~h~~~------------~~~~C~--~C~~~f~~~~~l~~H~~~h~~~-------~~  233 (306)
                      -|.|-  .|+..+-.+.++.+|+.+|...            ..|-|.  +|.+   +.+.+..|-..|+..       --
T Consensus       271 hyhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrth  347 (480)
T KOG4377|consen  271 HYHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTH  347 (480)
T ss_pred             hhcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceecce
Confidence            35664  6998888899999999988543            225664  4776   556666776666432       23


Q ss_pred             cccCccc--CcCCChhHHHHHHhhccCCCc----------------------------ccCCc--chHhhcChHHHHHHh
Q psy4573         234 YVCEICG--KGFTQKQALNTHKRGHTGEIP----------------------------YHCEF--CSERFSTKALVRHHV  281 (306)
Q Consensus       234 ~~C~~C~--~~f~~~~~L~~H~~~h~~~~~----------------------------~~C~~--C~~~f~~~~~l~~H~  281 (306)
                      |-|..+|  ..|.    ...|...|.....                            |.|..  |+.++...+++..|-
T Consensus       348 fhC~r~gCTdtfK----~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shk  423 (480)
T KOG4377|consen  348 FHCQRIGCTDTFK----DSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHK  423 (480)
T ss_pred             eEEeccCCccccc----cccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhh
Confidence            6787766  4444    4445444432111                            44543  889999999999887


Q ss_pred             hhcC
Q psy4573         282 RSHH  285 (306)
Q Consensus       282 ~~~h  285 (306)
                      +.|-
T Consensus       424 rkhe  427 (480)
T KOG4377|consen  424 RKHE  427 (480)
T ss_pred             hhhh
Confidence            6654


No 114
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=57.89  E-value=2.9  Score=39.57  Aligned_cols=57  Identities=18%  Similarity=0.236  Sum_probs=40.4

Q ss_pred             ccCcchhhccchHHHHHHhhhcCCCCCcccccccccccccccccccCcceecccccc
Q psy4573         129 YCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYHKNTTHLGIKFECEVCHR  185 (306)
Q Consensus       129 ~C~~C~~~~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~  185 (306)
                      .|..||-.|+....|-.-+.+..-..--.|+.|.+.+....+.....++..|+.||-
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfHAQp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFHAQPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccccccccccccCcccCC
Confidence            488888888777666665444444444468888888877777777777888888884


No 115
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=57.80  E-value=6.3  Score=23.51  Aligned_cols=10  Identities=40%  Similarity=1.132  Sum_probs=5.0

Q ss_pred             ccCcccCcCC
Q psy4573         235 VCEICGKGFT  244 (306)
Q Consensus       235 ~C~~C~~~f~  244 (306)
                      .|..|++.++
T Consensus        20 ~C~~C~~~l~   29 (50)
T smart00614       20 KCKYCGKKLS   29 (50)
T ss_pred             EecCCCCEee
Confidence            4555555443


No 116
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=55.31  E-value=8.7  Score=22.44  Aligned_cols=8  Identities=50%  Similarity=1.477  Sum_probs=3.9

Q ss_pred             cccCcccC
Q psy4573         234 YVCEICGK  241 (306)
Q Consensus       234 ~~C~~C~~  241 (306)
                      +.|+.||.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            34555553


No 117
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=55.06  E-value=12  Score=21.33  Aligned_cols=23  Identities=26%  Similarity=0.483  Sum_probs=14.9

Q ss_pred             ccccccccccCC--hHHHHHHhhhc
Q psy4573          44 LACNVCSKRCGS--KSGLKIHMKSH   66 (306)
Q Consensus        44 ~~C~~C~~~f~~--~~~l~~H~~~h   66 (306)
                      -+|+.||+.|..  ..+-..|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            578888888843  34555565554


No 118
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=54.93  E-value=8.6  Score=37.21  Aligned_cols=8  Identities=50%  Similarity=1.302  Sum_probs=3.5

Q ss_pred             CcccCccc
Q psy4573         233 PYVCEICG  240 (306)
Q Consensus       233 ~~~C~~C~  240 (306)
                      |..|+.||
T Consensus       475 p~~Cp~Cg  482 (730)
T COG1198         475 PQSCPECG  482 (730)
T ss_pred             CCCCCCCC
Confidence            34444444


No 119
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=54.48  E-value=4.3  Score=33.32  Aligned_cols=24  Identities=17%  Similarity=0.260  Sum_probs=15.0

Q ss_pred             CCcccCCcchHhhcChHHHHHHhh
Q psy4573         259 EIPYHCEFCSERFSTKALVRHHVR  282 (306)
Q Consensus       259 ~~~~~C~~C~~~f~~~~~l~~H~~  282 (306)
                      .++++||.|++.......|..-.+
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR  230 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTR  230 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeee
Confidence            466788888877665555544333


No 120
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=54.32  E-value=8.7  Score=37.19  Aligned_cols=12  Identities=33%  Similarity=0.766  Sum_probs=6.2

Q ss_pred             CCCcccCCcchH
Q psy4573         258 GEIPYHCEFCSE  269 (306)
Q Consensus       258 ~~~~~~C~~C~~  269 (306)
                      ...|..|+.|+-
T Consensus       472 ~~~p~~Cp~Cgs  483 (730)
T COG1198         472 EPIPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            344555555553


No 121
>KOG1280|consensus
Probab=54.21  E-value=9.8  Score=32.75  Aligned_cols=29  Identities=28%  Similarity=0.466  Sum_probs=17.6

Q ss_pred             cccCCcchHhhcChHHHHHHhhhcCCCCC
Q psy4573         261 PYHCEFCSERFSTKALVRHHVRSHHSSAR  289 (306)
Q Consensus       261 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~  289 (306)
                      -|.|++|++.=.+...|..|+...|++..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~  107 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEAS  107 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccC
Confidence            46666666655555666666666666554


No 122
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=52.73  E-value=5.8  Score=20.91  Aligned_cols=10  Identities=30%  Similarity=0.567  Sum_probs=5.5

Q ss_pred             ceecccchhc
Q psy4573          71 RYACSICLAE   80 (306)
Q Consensus        71 ~~~C~~C~~~   80 (306)
                      .+.|+.|+..
T Consensus        19 ~~vCp~C~~e   28 (30)
T PF08274_consen   19 LLVCPECGHE   28 (30)
T ss_dssp             SEEETTTTEE
T ss_pred             EEeCCccccc
Confidence            4566666543


No 123
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=52.39  E-value=14  Score=29.89  Aligned_cols=28  Identities=18%  Similarity=0.403  Sum_probs=20.8

Q ss_pred             cCcceeccccccccCChHHHHHHHhhcc
Q psy4573         174 LGIKFECEVCHRKLSTKNHLRLHMRTHT  201 (306)
Q Consensus       174 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~  201 (306)
                      ....|.|++|++.|.....+..|+..-+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            3447999999999999999999987643


No 124
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=52.23  E-value=5.1  Score=19.61  Aligned_cols=6  Identities=50%  Similarity=1.436  Sum_probs=2.4

Q ss_pred             cCcccC
Q psy4573         236 CEICGK  241 (306)
Q Consensus       236 C~~C~~  241 (306)
                      |+.||.
T Consensus         2 Cp~CG~    7 (23)
T PF13240_consen    2 CPNCGA    7 (23)
T ss_pred             CcccCC
Confidence            344443


No 125
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=51.95  E-value=11  Score=21.26  Aligned_cols=30  Identities=17%  Similarity=0.492  Sum_probs=12.1

Q ss_pred             cccccccccccccccccccCcceecccccc
Q psy4573         156 FECESCKKIFTYHKNTTHLGIKFECEVCHR  185 (306)
Q Consensus       156 ~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~  185 (306)
                      ..|..|+..+.........+....|++|+.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~w~C~~C~~   32 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKTWICNFCGT   32 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTEEEETTT--
T ss_pred             cccCCCCCEECCcceEcCCCCEEECcCCCC
Confidence            445555555544444444445566666654


No 126
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=51.79  E-value=3.5  Score=24.80  Aligned_cols=26  Identities=15%  Similarity=0.508  Sum_probs=11.8

Q ss_pred             CcceeccccccccCChHHHHHHHhhc
Q psy4573         175 GIKFECEVCHRKLSTKNHLRLHMRTH  200 (306)
Q Consensus       175 ~~~~~C~~C~~~f~~~~~l~~H~~~h  200 (306)
                      ...|.|+.|...|-..-++-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            34677777777777666665554333


No 127
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=51.75  E-value=7.7  Score=28.69  Aligned_cols=27  Identities=37%  Similarity=0.677  Sum_probs=15.7

Q ss_pred             CCcccCcccCcCCChhHHHHHHhhccCCCc
Q psy4573         232 RPYVCEICGKGFTQKQALNTHKRGHTGEIP  261 (306)
Q Consensus       232 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~  261 (306)
                      .-..|-+||+.|...   .+|++.|+|..+
T Consensus        71 d~i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   71 DYIICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             S-EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             CeeEEccCCcccchH---HHHHHHccCCCH
Confidence            346799999887654   888888877543


No 128
>PF14353 CpXC:  CpXC protein
Probab=51.29  E-value=7.7  Score=28.50  Aligned_cols=20  Identities=20%  Similarity=0.373  Sum_probs=11.6

Q ss_pred             ceecccchhccCChHHHhhh
Q psy4573          71 RYACSICLAEFHTLTEKDRH   90 (306)
Q Consensus        71 ~~~C~~C~~~~~~~~~l~~H   90 (306)
                      .+.|+.||..+.-...+..|
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             EEECCCCCCceecCCCEEEE
Confidence            46777777766544444433


No 129
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=49.91  E-value=4.9  Score=32.47  Aligned_cols=26  Identities=27%  Similarity=0.752  Sum_probs=13.2

Q ss_pred             ccCCcchHhhcChHHHHHHhhhcCCC
Q psy4573         262 YHCEFCSERFSTKALVRHHVRSHHSS  287 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~~~h~~  287 (306)
                      |.|+.|++.|.-..-+..|+...|++
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHH
Confidence            55555555555555555565555543


No 130
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=49.02  E-value=11  Score=20.53  Aligned_cols=10  Identities=20%  Similarity=0.623  Sum_probs=6.8

Q ss_pred             ceeccccccc
Q psy4573         177 KFECEVCHRK  186 (306)
Q Consensus       177 ~~~C~~C~~~  186 (306)
                      .+.|+.||..
T Consensus        22 R~vC~~Cg~I   31 (34)
T PF14803_consen   22 RLVCPACGFI   31 (34)
T ss_dssp             EEEETTTTEE
T ss_pred             ceECCCCCCE
Confidence            5777777764


No 131
>KOG2593|consensus
Probab=47.70  E-value=17  Score=32.46  Aligned_cols=34  Identities=21%  Similarity=0.434  Sum_probs=15.2

Q ss_pred             CcccccccccccCChHHHHHHhhhcCCCCceecccch
Q psy4573          42 GSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICL   78 (306)
Q Consensus        42 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~   78 (306)
                      ..|.|+.|.+.|.....+   ...-.....|.|..|+
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~---~L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEAL---QLLDNETGEFHCENCG  160 (436)
T ss_pred             ccccCCccccchhhhHHH---HhhcccCceEEEecCC
Confidence            445555555555433322   2222223345555554


No 132
>PRK04023 DNA polymerase II large subunit; Validated
Probab=47.70  E-value=23  Score=35.40  Aligned_cols=10  Identities=40%  Similarity=0.909  Sum_probs=6.3

Q ss_pred             CcccCcCCCc
Q psy4573         205 PAVCSYCGKG  214 (306)
Q Consensus       205 ~~~C~~C~~~  214 (306)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            3567777755


No 133
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=47.66  E-value=28  Score=29.55  Aligned_cols=74  Identities=16%  Similarity=0.410  Sum_probs=37.4

Q ss_pred             ccccCcchhhccchHHHHHHhhhcCCCCCc------------ccccccccccccccc----cccCcceeccccccccCCh
Q psy4573         127 TAYCDLCQEGFFRKAKYETHNIQKHNAPPF------------ECESCKKIFTYHKNT----THLGIKFECEVCHRKLSTK  190 (306)
Q Consensus       127 ~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~------------~c~~c~~~f~~~~~~----~~~~~~~~C~~C~~~f~~~  190 (306)
                      |..||.|.........|.+-..---+-++|            .|-.|.-.|......    .-....|.|+.|...|-..
T Consensus       322 Pi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~~~~ss~rY~Ce~CK~~FC~d  401 (421)
T COG5151         322 PISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFDESTSSGRYQCELCKSTFCSD  401 (421)
T ss_pred             CccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCcccccccccceechhhhhhhhhh
Confidence            456777776665555544321100022222            355555555443321    1112357777777777777


Q ss_pred             HHHHHHHhhc
Q psy4573         191 NHLRLHMRTH  200 (306)
Q Consensus       191 ~~l~~H~~~h  200 (306)
                      -+.-.|-..|
T Consensus       402 CdvfiHe~Lh  411 (421)
T COG5151         402 CDVFIHETLH  411 (421)
T ss_pred             hHHHHHHHHh
Confidence            6666665444


No 134
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=47.51  E-value=16  Score=21.61  Aligned_cols=8  Identities=38%  Similarity=1.065  Sum_probs=3.3

Q ss_pred             eecccccc
Q psy4573         178 FECEVCHR  185 (306)
Q Consensus       178 ~~C~~C~~  185 (306)
                      +.|+.|+.
T Consensus        35 w~CP~C~a   42 (47)
T PF00301_consen   35 WVCPVCGA   42 (47)
T ss_dssp             -B-TTTSS
T ss_pred             CcCcCCCC
Confidence            55666554


No 135
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=47.15  E-value=11  Score=27.89  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=15.8

Q ss_pred             cCCcccccccccccCChHHHHHHhhhcCCCC
Q psy4573          40 QDGSLACNVCSKRCGSKSGLKIHMKSHTLSK   70 (306)
Q Consensus        40 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~   70 (306)
                      .+....|-+||+.|+..   .+|++.|++..
T Consensus        69 ~~d~i~clecGk~~k~L---krHL~~~~glt   96 (132)
T PF05443_consen   69 TPDYIICLECGKKFKTL---KRHLRTHHGLT   96 (132)
T ss_dssp             -SS-EE-TBT--EESBH---HHHHHHTT-S-
T ss_pred             ccCeeEEccCCcccchH---HHHHHHccCCC
Confidence            44557888888888644   88888887654


No 136
>KOG2071|consensus
Probab=46.74  E-value=20  Score=33.44  Aligned_cols=24  Identities=21%  Similarity=0.488  Sum_probs=18.0

Q ss_pred             ceeccccccccCChHHHHHHHhhc
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRTH  200 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~h  200 (306)
                      +..|..||..|.+......||..|
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             cchhcccccccccchhhhhHhhhh
Confidence            467888888888887777777665


No 137
>PRK04023 DNA polymerase II large subunit; Validated
Probab=46.36  E-value=19  Score=35.85  Aligned_cols=7  Identities=57%  Similarity=1.516  Sum_probs=3.0

Q ss_pred             ccCcccC
Q psy4573         235 VCEICGK  241 (306)
Q Consensus       235 ~C~~C~~  241 (306)
                      .|+.||.
T Consensus       665 ~CPKCG~  671 (1121)
T PRK04023        665 ECEKCGR  671 (1121)
T ss_pred             cCCCCCC
Confidence            3444443


No 138
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=46.01  E-value=4.2  Score=22.48  Aligned_cols=8  Identities=50%  Similarity=1.157  Sum_probs=3.4

Q ss_pred             cccCcccC
Q psy4573         234 YVCEICGK  241 (306)
Q Consensus       234 ~~C~~C~~  241 (306)
                      -+|+.||.
T Consensus        22 ~~Cd~cg~   29 (36)
T PF05191_consen   22 GVCDNCGG   29 (36)
T ss_dssp             TBCTTTTE
T ss_pred             CccCCCCC
Confidence            34444443


No 139
>KOG3408|consensus
Probab=45.66  E-value=11  Score=27.03  Aligned_cols=26  Identities=27%  Similarity=0.534  Sum_probs=20.9

Q ss_pred             CCCcccCcccCcCCChhHHHHHHhhc
Q psy4573         231 QRPYVCEICGKGFTQKQALNTHKRGH  256 (306)
Q Consensus       231 ~~~~~C~~C~~~f~~~~~L~~H~~~h  256 (306)
                      ...|.|.+|.+-|.+...|..|.++.
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhcc
Confidence            34588999999999999998888653


No 140
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=45.32  E-value=11  Score=18.74  Aligned_cols=10  Identities=30%  Similarity=0.823  Sum_probs=7.6

Q ss_pred             cceecccccc
Q psy4573         176 IKFECEVCHR  185 (306)
Q Consensus       176 ~~~~C~~C~~  185 (306)
                      ..|.||.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4788888874


No 141
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=45.30  E-value=5.2  Score=26.08  Aligned_cols=6  Identities=33%  Similarity=0.811  Sum_probs=2.4

Q ss_pred             cccCcC
Q psy4573         238 ICGKGF  243 (306)
Q Consensus       238 ~C~~~f  243 (306)
                      .||..|
T Consensus        34 eCg~tF   39 (72)
T PRK09678         34 NCSATF   39 (72)
T ss_pred             CCCCEE
Confidence            344443


No 142
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=44.50  E-value=15  Score=21.15  Aligned_cols=23  Identities=39%  Similarity=0.589  Sum_probs=19.4

Q ss_pred             cccccccccccCChHHHHHHhhh
Q psy4573          43 SLACNVCSKRCGSKSGLKIHMKS   65 (306)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~   65 (306)
                      .|+|-+|+.+...++.|-.||+-
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            37899999999999999888863


No 143
>KOG4167|consensus
Probab=43.86  E-value=8.3  Score=36.64  Aligned_cols=25  Identities=20%  Similarity=0.519  Sum_probs=22.9

Q ss_pred             ccCCcchHhhcChHHHHHHhhhcCC
Q psy4573         262 YHCEFCSERFSTKALVRHHVRSHHS  286 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~~~h~  286 (306)
                      |.|..|++.|..-.++..||++|.-
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            9999999999999999999998854


No 144
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=43.85  E-value=8.6  Score=23.06  Aligned_cols=8  Identities=38%  Similarity=1.111  Sum_probs=3.6

Q ss_pred             ccCCcchH
Q psy4573         262 YHCEFCSE  269 (306)
Q Consensus       262 ~~C~~C~~  269 (306)
                      +.|+.|++
T Consensus        38 ~~C~~Cgy   45 (50)
T PRK00432         38 WHCGKCGY   45 (50)
T ss_pred             EECCCcCC
Confidence            44444444


No 145
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=40.29  E-value=13  Score=22.31  Aligned_cols=7  Identities=29%  Similarity=1.099  Sum_probs=3.2

Q ss_pred             ccCCCCh
Q psy4573         100 YKCNQCD  106 (306)
Q Consensus       100 ~~C~~C~  106 (306)
                      |.|++|+
T Consensus        35 w~CP~C~   41 (50)
T cd00730          35 WVCPVCG   41 (50)
T ss_pred             CCCCCCC
Confidence            4444443


No 146
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=40.12  E-value=7.9  Score=23.59  Aligned_cols=9  Identities=56%  Similarity=1.464  Sum_probs=4.8

Q ss_pred             ccCcccCcC
Q psy4573         235 VCEICGKGF  243 (306)
Q Consensus       235 ~C~~C~~~f  243 (306)
                      +|+.||+.|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            455555554


No 147
>KOG2272|consensus
Probab=39.58  E-value=28  Score=28.59  Aligned_cols=117  Identities=16%  Similarity=0.332  Sum_probs=50.6

Q ss_pred             cccCCCChhhhccHHHHHHHHH----------hcccCCccccCcchhhccchHHHHHHhhhcCCCCCccccccccccccc
Q psy4573          99 EYKCNQCDHVAKKLAYLQAHMK----------KHRNEYTAYCDLCQEGFFRKAKYETHNIQKHNAPPFECESCKKIFTYH  168 (306)
Q Consensus        99 ~~~C~~C~~~f~~~~~l~~H~~----------~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~c~~c~~~f~~~  168 (306)
                      -|.|++|++...+...++..-+          ...+...|.|..|...... ..|. -+...-..--|.|..|++...+.
T Consensus        99 CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~-~~l~-fr~d~yH~yHFkCt~C~keL~sd  176 (332)
T KOG2272|consen   99 CFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDE-QPLT-FRGDPYHPYHFKCTTCGKELTSD  176 (332)
T ss_pred             cchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhccc-cccc-ccCCCCCccceecccccccccch
Confidence            4778888776655544432211          1112234666666543322 1111 11111112235677777766544


Q ss_pred             ccccccCc-------ceeccccccccCChH-HHHHHHhhccCCCCcccCcCCCccCC
Q psy4573         169 KNTTHLGI-------KFECEVCHRKLSTKN-HLRLHMRTHTNERPAVCSYCGKGFRR  217 (306)
Q Consensus       169 ~~~~~~~~-------~~~C~~C~~~f~~~~-~l~~H~~~h~~~~~~~C~~C~~~f~~  217 (306)
                      ...+..+.       .+.+++|+.--.... ....=+..|....-|.|..|.+-|..
T Consensus       177 aRevk~eLyClrChD~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlG  233 (332)
T KOG2272|consen  177 AREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLG  233 (332)
T ss_pred             hhhhccceeccccccccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccc
Confidence            43222221       234444443211111 11111223333444777777766654


No 148
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=39.58  E-value=5.1  Score=22.17  Aligned_cols=18  Identities=22%  Similarity=0.682  Sum_probs=8.7

Q ss_pred             HHHHhhccCCCcccCCcc
Q psy4573         250 NTHKRGHTGEIPYHCEFC  267 (306)
Q Consensus       250 ~~H~~~h~~~~~~~C~~C  267 (306)
                      .+|=+...|.+.|.|..|
T Consensus        18 ~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   18 KKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCCEeEecCcC
Confidence            344444444555555554


No 149
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=39.37  E-value=11  Score=22.31  Aligned_cols=10  Identities=20%  Similarity=0.627  Sum_probs=5.7

Q ss_pred             cccCCcchHh
Q psy4573         261 PYHCEFCSER  270 (306)
Q Consensus       261 ~~~C~~C~~~  270 (306)
                      ++.|+.|+++
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            3556666654


No 150
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=38.69  E-value=20  Score=25.74  Aligned_cols=40  Identities=15%  Similarity=0.341  Sum_probs=22.2

Q ss_pred             cccccccccccCChHHHHHHhhhcCCCCceecccchhccC
Q psy4573          43 SLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFH   82 (306)
Q Consensus        43 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~   82 (306)
                      ...|+.|+..=.....|+.-........-|.|..||..|.
T Consensus        72 ~~~CpkCg~~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          72 KEKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             cccCCCCCCceeEEEeeehhccCCCceEEEEecccCCEee
Confidence            3678888755444444433322222222378888888764


No 151
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=38.11  E-value=15  Score=26.94  Aligned_cols=11  Identities=27%  Similarity=0.534  Sum_probs=4.7

Q ss_pred             cccCcchhhcc
Q psy4573         128 AYCDLCQEGFF  138 (306)
Q Consensus       128 ~~C~~C~~~~~  138 (306)
                      ++|..||+.|.
T Consensus         2 H~Ct~Cg~~f~   12 (131)
T PF09845_consen    2 HQCTKCGRVFE   12 (131)
T ss_pred             cccCcCCCCcC
Confidence            34444444443


No 152
>KOG2593|consensus
Probab=37.93  E-value=42  Score=30.07  Aligned_cols=39  Identities=31%  Similarity=0.571  Sum_probs=24.6

Q ss_pred             cCCCCcccCcCCCccCCcHHHHHHHHHccCCCCcccCcccCc
Q psy4573         201 TNERPAVCSYCGKGFRRGDALTEHIRIHTGQRPYVCEICGKG  242 (306)
Q Consensus       201 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  242 (306)
                      +..+.|.|+.|.+.|.....++   .+-.....|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCCc
Confidence            4556688888888886654432   23333456788888754


No 153
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=37.86  E-value=31  Score=19.44  Aligned_cols=19  Identities=16%  Similarity=0.137  Sum_probs=13.2

Q ss_pred             ceeccccccccCChHHHHH
Q psy4573         177 KFECEVCHRKLSTKNHLRL  195 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~  195 (306)
                      .+.|+.|+-.+.+...|.+
T Consensus        19 id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEECCCCCeEEccHHHHHH
Confidence            5678888777777666654


No 154
>KOG1280|consensus
Probab=36.72  E-value=32  Score=29.75  Aligned_cols=39  Identities=18%  Similarity=0.387  Sum_probs=27.9

Q ss_pred             cCCcccccccccccCChHHHHHHhhhcCCCCc--eecccch
Q psy4573          40 QDGSLACNVCSKRCGSKSGLKIHMKSHTLSKR--YACSICL   78 (306)
Q Consensus        40 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~   78 (306)
                      .+..|+|+.|+..=.+...|..|+...+.+..  ..|++|.
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            34478899998887788888888877666543  3466664


No 155
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=36.61  E-value=10  Score=26.26  Aligned_cols=39  Identities=18%  Similarity=0.314  Sum_probs=22.7

Q ss_pred             cCCcccccccccccCChHHHHHHhhhcCCCCceecccchhccC
Q psy4573          40 QDGSLACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFH   82 (306)
Q Consensus        40 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~   82 (306)
                      .++.|.|+.|+..-...-.+    +.-.......|..||..|.
T Consensus        19 L~k~FtCp~Cghe~vs~ctv----kk~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTV----KKTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CCceEecCccCCeeeeEEEE----EecCceeEEEcccCcceEE
Confidence            46778888888665543221    2222233456888877664


No 156
>KOG2071|consensus
Probab=36.05  E-value=31  Score=32.23  Aligned_cols=16  Identities=31%  Similarity=0.673  Sum_probs=12.7

Q ss_pred             CCCcccCcccCcCCCh
Q psy4573         231 QRPYVCEICGKGFTQK  246 (306)
Q Consensus       231 ~~~~~C~~C~~~f~~~  246 (306)
                      +++..|++|+..|...
T Consensus       511 e~~~~C~IC~EkFe~v  526 (579)
T KOG2071|consen  511 ERQASCPICQEKFEVV  526 (579)
T ss_pred             ccccCCccccccccee
Confidence            6678899999988653


No 157
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=35.56  E-value=32  Score=25.32  Aligned_cols=17  Identities=12%  Similarity=0.323  Sum_probs=9.6

Q ss_pred             CCCCcccCcCCCccCCc
Q psy4573         202 NERPAVCSYCGKGFRRG  218 (306)
Q Consensus       202 ~~~~~~C~~C~~~f~~~  218 (306)
                      ..+.|+|.+|..+..+.
T Consensus        77 d~~lYeCnIC~etS~ee   93 (140)
T PF05290_consen   77 DPKLYECNICKETSAEE   93 (140)
T ss_pred             CCCceeccCcccccchh
Confidence            33556666666555443


No 158
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.96  E-value=22  Score=25.10  Aligned_cols=28  Identities=25%  Similarity=0.330  Sum_probs=16.6

Q ss_pred             eeccccccccCChHHHHHHHhhccCCCCcccCcCCCccC
Q psy4573         178 FECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFR  216 (306)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  216 (306)
                      -.||.|++.|-.           .+..|..|++||++|.
T Consensus        10 ridPetg~KFYD-----------LNrdPiVsPytG~s~P   37 (129)
T COG4530          10 RIDPETGKKFYD-----------LNRDPIVSPYTGKSYP   37 (129)
T ss_pred             ccCccccchhhc-----------cCCCccccCcccccch
Confidence            445666665554           2446666777777663


No 159
>KOG1701|consensus
Probab=34.58  E-value=16  Score=32.43  Aligned_cols=42  Identities=14%  Similarity=0.294  Sum_probs=28.1

Q ss_pred             cccccccccCChHHHHHHhhhcCCCCceecccchhccCChHH
Q psy4573          45 ACNVCSKRCGSKSGLKIHMKSHTLSKRYACSICLAEFHTLTE   86 (306)
Q Consensus        45 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~~~~~~~   86 (306)
                      .|..|++...-...-..-|...--..-|+|..|.+.+..++-
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~F  317 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSF  317 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccc
Confidence            799999888766665555544222336899999887655443


No 160
>KOG4167|consensus
Probab=34.28  E-value=10  Score=36.12  Aligned_cols=30  Identities=27%  Similarity=0.469  Sum_probs=23.9

Q ss_pred             hcCCcccccccccccCChHHHHHHhhhcCC
Q psy4573          39 EQDGSLACNVCSKRCGSKSGLKIHMKSHTL   68 (306)
Q Consensus        39 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   68 (306)
                      +.++-|.|.+|++.|.-.-.+..||++|.-
T Consensus       788 ~~~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  788 DPTGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CCCceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            345678899999999888888888888754


No 161
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=34.15  E-value=53  Score=27.04  Aligned_cols=56  Identities=18%  Similarity=0.459  Sum_probs=27.2

Q ss_pred             CccccCcchhhccchHHHHHHhhhcC-CCCCcccccccccccccccccccCc-ceeccccccccCCh
Q psy4573         126 YTAYCDLCQEGFFRKAKYETHNIQKH-NAPPFECESCKKIFTYHKNTTHLGI-KFECEVCHRKLSTK  190 (306)
Q Consensus       126 ~~~~C~~C~~~~~~~~~l~~H~~~~h-~~~~~~c~~c~~~f~~~~~~~~~~~-~~~C~~C~~~f~~~  190 (306)
                      ..|.|..|+...     ++    .+. ....-.|..|.+.|.-.-....-+. .|.|+.|+..|..-
T Consensus       111 rqFaC~~Cd~~W-----wR----rvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  111 RQFACSSCDHMW-----WR----RVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             eeeeccccchHH-----Hh----ccCcccccccccccccccCCCccccccceeeeecccccccchhh
Confidence            567777775431     11    122 1222346666665543221111121 47777777777653


No 162
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=32.71  E-value=25  Score=23.93  Aligned_cols=14  Identities=57%  Similarity=1.132  Sum_probs=7.7

Q ss_pred             CCcccCcCCCccCC
Q psy4573         204 RPAVCSYCGKGFRR  217 (306)
Q Consensus       204 ~~~~C~~C~~~f~~  217 (306)
                      .|-.|..||+.|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            34556666666554


No 163
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=32.10  E-value=45  Score=28.42  Aligned_cols=22  Identities=23%  Similarity=0.471  Sum_probs=13.8

Q ss_pred             CccccCcchhhccchHHHHHHh
Q psy4573         126 YTAYCDLCQEGFFRKAKYETHN  147 (306)
Q Consensus       126 ~~~~C~~C~~~~~~~~~l~~H~  147 (306)
                      ..|+|+.|...|-..-+.-.|.
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe  408 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHE  408 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHH
Confidence            3566777777666666655663


No 164
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=31.39  E-value=1.5e+02  Score=22.69  Aligned_cols=54  Identities=26%  Similarity=0.404  Sum_probs=35.8

Q ss_pred             CcccCcccCcCCChhHHHHHHhhccCCCcccCCc--chHhhcChHHHHHHhhhcCCCC
Q psy4573         233 PYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEF--CSERFSTKALVRHHVRSHHSSA  288 (306)
Q Consensus       233 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~  288 (306)
                      ...|+.|.-........ .-.+.+.+.|+=.|..  |... .+-..|.+|++..|+..
T Consensus        80 ~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~  135 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSA  135 (162)
T ss_pred             cccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCC
Confidence            47899997554333333 3355566667666765  6654 36678999999999864


No 165
>KOG3408|consensus
Probab=30.78  E-value=37  Score=24.52  Aligned_cols=26  Identities=19%  Similarity=0.485  Sum_probs=23.3

Q ss_pred             CCCcccCCcchHhhcChHHHHHHhhh
Q psy4573         258 GEIPYHCEFCSERFSTKALVRHHVRS  283 (306)
Q Consensus       258 ~~~~~~C~~C~~~f~~~~~l~~H~~~  283 (306)
                      |..+|.|-.|.+-|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            45569999999999999999999876


No 166
>PF12773 DZR:  Double zinc ribbon
Probab=30.25  E-value=41  Score=19.76  Aligned_cols=8  Identities=38%  Similarity=1.119  Sum_probs=3.8

Q ss_pred             cccCcccC
Q psy4573         234 YVCEICGK  241 (306)
Q Consensus       234 ~~C~~C~~  241 (306)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            34555544


No 167
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=30.06  E-value=20  Score=26.69  Aligned_cols=14  Identities=29%  Similarity=0.624  Sum_probs=9.3

Q ss_pred             ceeccccccccCCh
Q psy4573         177 KFECEVCHRKLSTK  190 (306)
Q Consensus       177 ~~~C~~C~~~f~~~  190 (306)
                      .+.|..||..|...
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            57777777666553


No 168
>KOG4124|consensus
Probab=29.30  E-value=10  Score=32.65  Aligned_cols=54  Identities=31%  Similarity=0.708  Sum_probs=37.5

Q ss_pred             CCcccC--cccCcCCChhHHHHHHhhcc-------------------CCCcccCCcchHhhcChHHHHHHhhhcC
Q psy4573         232 RPYVCE--ICGKGFTQKQALNTHKRGHT-------------------GEIPYHCEFCSERFSTKALVRHHVRSHH  285 (306)
Q Consensus       232 ~~~~C~--~C~~~f~~~~~L~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~~~h  285 (306)
                      ++|.|+  .|.+.+++.-.|.-|...-|                   ..|+|+|++|.+.+.....|..|+...|
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~~~~  422 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRTHSH  422 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceeehhh
Confidence            567774  48888888777777654322                   2567899999998877766666654444


No 169
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=28.55  E-value=46  Score=18.76  Aligned_cols=14  Identities=14%  Similarity=0.574  Sum_probs=9.0

Q ss_pred             CcceeccccccccC
Q psy4573         175 GIKFECEVCHRKLS  188 (306)
Q Consensus       175 ~~~~~C~~C~~~f~  188 (306)
                      ..-|.|..|+..+.
T Consensus        26 T~fy~C~~C~~~w~   39 (40)
T smart00440       26 TVFYVCTKCGHRWR   39 (40)
T ss_pred             eEEEEeCCCCCEeC
Confidence            33577777776553


No 170
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=28.15  E-value=37  Score=30.45  Aligned_cols=31  Identities=19%  Similarity=0.449  Sum_probs=21.1

Q ss_pred             eccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHH
Q psy4573         179 ECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDA  220 (306)
Q Consensus       179 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  220 (306)
                      .|+.||....+.           |.+-|+|+.|+..+.+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~~~  382 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARETLI  382 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCcccc
Confidence            588888765553           4447888888887776543


No 171
>KOG1842|consensus
Probab=28.04  E-value=39  Score=30.37  Aligned_cols=25  Identities=28%  Similarity=0.493  Sum_probs=16.7

Q ss_pred             CcccCcccCcCCChhHHHHHHhhcc
Q psy4573         233 PYVCEICGKGFTQKQALNTHKRGHT  257 (306)
Q Consensus       233 ~~~C~~C~~~f~~~~~L~~H~~~h~  257 (306)
                      .|.||+|...|.+...|..|.-.-|
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhc
Confidence            4667777777777777777765433


No 172
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=27.60  E-value=35  Score=21.71  Aligned_cols=8  Identities=38%  Similarity=1.032  Sum_probs=2.0

Q ss_pred             eecccccc
Q psy4573         178 FECEVCHR  185 (306)
Q Consensus       178 ~~C~~C~~  185 (306)
                      +.|..||.
T Consensus        26 hhCr~CG~   33 (69)
T PF01363_consen   26 HHCRNCGR   33 (69)
T ss_dssp             EE-TTT--
T ss_pred             EccCCCCC
Confidence            33444443


No 173
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=27.45  E-value=38  Score=20.68  Aligned_cols=9  Identities=22%  Similarity=0.977  Sum_probs=5.3

Q ss_pred             ceecccccc
Q psy4573         177 KFECEVCHR  185 (306)
Q Consensus       177 ~~~C~~C~~  185 (306)
                      .|+|+.|+.
T Consensus        44 ~y~C~~Cg~   52 (54)
T PF10058_consen   44 QYRCPYCGA   52 (54)
T ss_pred             EEEcCCCCC
Confidence            566666653


No 174
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=27.30  E-value=32  Score=23.53  Aligned_cols=11  Identities=18%  Similarity=0.522  Sum_probs=5.9

Q ss_pred             ceecccchhcc
Q psy4573          71 RYACSICLAEF   81 (306)
Q Consensus        71 ~~~C~~C~~~~   81 (306)
                      .+.|..|++.|
T Consensus        54 IW~C~~C~~~~   64 (90)
T PTZ00255         54 IWRCKGCKKTV   64 (90)
T ss_pred             EEEcCCCCCEE
Confidence            45555555554


No 175
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=27.24  E-value=42  Score=19.86  Aligned_cols=8  Identities=38%  Similarity=0.982  Sum_probs=3.6

Q ss_pred             eecccccc
Q psy4573         178 FECEVCHR  185 (306)
Q Consensus       178 ~~C~~C~~  185 (306)
                      +.|+.||.
T Consensus        21 ~vC~~Cg~   28 (52)
T smart00661       21 FVCRKCGY   28 (52)
T ss_pred             EECCcCCC
Confidence            44444444


No 176
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=27.20  E-value=72  Score=33.02  Aligned_cols=8  Identities=25%  Similarity=0.712  Sum_probs=3.7

Q ss_pred             eecccccc
Q psy4573         178 FECEVCHR  185 (306)
Q Consensus       178 ~~C~~C~~  185 (306)
                      ++|+.||.
T Consensus       668 rkCPkCG~  675 (1337)
T PRK14714        668 RRCPSCGT  675 (1337)
T ss_pred             EECCCCCC
Confidence            44444444


No 177
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=27.19  E-value=27  Score=19.05  Aligned_cols=10  Identities=20%  Similarity=0.634  Sum_probs=5.6

Q ss_pred             eccccccccC
Q psy4573         179 ECEVCHRKLS  188 (306)
Q Consensus       179 ~C~~C~~~f~  188 (306)
                      .|..|++.+.
T Consensus        22 ~C~~C~Y~~~   31 (35)
T PF02150_consen   22 ACRTCGYEEP   31 (35)
T ss_dssp             EESSSS-EEE
T ss_pred             CCCCCCCccC
Confidence            6777766543


No 178
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.83  E-value=35  Score=21.25  Aligned_cols=7  Identities=43%  Similarity=1.203  Sum_probs=2.9

Q ss_pred             ccCCcch
Q psy4573         262 YHCEFCS  268 (306)
Q Consensus       262 ~~C~~C~  268 (306)
                      |.|+.|.
T Consensus        32 ymC~eC~   38 (68)
T COG4896          32 YMCPECE   38 (68)
T ss_pred             EechhhH
Confidence            4444443


No 179
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=26.66  E-value=64  Score=16.91  Aligned_cols=14  Identities=21%  Similarity=0.700  Sum_probs=7.2

Q ss_pred             ceeccccccccCCh
Q psy4573         177 KFECEVCHRKLSTK  190 (306)
Q Consensus       177 ~~~C~~C~~~f~~~  190 (306)
                      .|.|+.|+..+-+.
T Consensus        13 kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen   13 KYRCPRCGARYCSL   26 (30)
T ss_dssp             SEE-TTT--EESSH
T ss_pred             EEECCCcCCceeCc
Confidence            57888887765543


No 180
>KOG3507|consensus
Probab=26.49  E-value=37  Score=20.98  Aligned_cols=10  Identities=30%  Similarity=0.634  Sum_probs=5.2

Q ss_pred             CcccCcCCCc
Q psy4573         205 PAVCSYCGKG  214 (306)
Q Consensus       205 ~~~C~~C~~~  214 (306)
                      .+.|..||..
T Consensus        37 ~irCReCG~R   46 (62)
T KOG3507|consen   37 VIRCRECGYR   46 (62)
T ss_pred             cEehhhcchH
Confidence            4555555543


No 181
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=26.11  E-value=21  Score=23.12  Aligned_cols=31  Identities=16%  Similarity=0.471  Sum_probs=12.8

Q ss_pred             CCcccccccccccccccccccCcceeccccccc
Q psy4573         154 PPFECESCKKIFTYHKNTTHLGIKFECEVCHRK  186 (306)
Q Consensus       154 ~~~~c~~c~~~f~~~~~~~~~~~~~~C~~C~~~  186 (306)
                      ....|+.|+...+.....-  +..|.|+.|+..
T Consensus        40 ~~v~Cg~C~~~~~~~~~~c--~~~~~C~~C~~~   70 (71)
T PF05495_consen   40 KRVICGKCRTEQPIDEYSC--GADYFCPICGLY   70 (71)
T ss_dssp             -EEEETTT--EEES-SBTT----SEEETTTTEE
T ss_pred             cCeECCCCCCccChhhhhc--CCCccCcCcCCC
Confidence            3556666665554433210  034666666543


No 182
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.94  E-value=38  Score=31.54  Aligned_cols=6  Identities=50%  Similarity=1.625  Sum_probs=2.9

Q ss_pred             ccCcCC
Q psy4573         207 VCSYCG  212 (306)
Q Consensus       207 ~C~~C~  212 (306)
                      .|..||
T Consensus       215 ~C~~Cg  220 (505)
T TIGR00595       215 LCRSCG  220 (505)
T ss_pred             EhhhCc
Confidence            355454


No 183
>COG2879 Uncharacterized small protein [Function unknown]
Probab=25.64  E-value=63  Score=20.33  Aligned_cols=18  Identities=17%  Similarity=0.204  Sum_probs=13.7

Q ss_pred             cChHHHHHHhhhcCCCCC
Q psy4573         272 STKALVRHHVRSHHSSAR  289 (306)
Q Consensus       272 ~~~~~l~~H~~~~h~~~~  289 (306)
                      .+-++..+||+.+|++++
T Consensus        23 pdYdnYVehmr~~hPd~p   40 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CcHHHHHHHHHHhCcCCC
Confidence            355677888888888876


No 184
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=25.35  E-value=35  Score=19.11  Aligned_cols=12  Identities=17%  Similarity=0.603  Sum_probs=8.6

Q ss_pred             cceecccccccc
Q psy4573         176 IKFECEVCHRKL  187 (306)
Q Consensus       176 ~~~~C~~C~~~f  187 (306)
                      .-|.|..|+..+
T Consensus        27 ~fy~C~~C~~~w   38 (39)
T PF01096_consen   27 LFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEESSSTEEE
T ss_pred             EEEEeCCCCCee
Confidence            367888888754


No 185
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=25.29  E-value=33  Score=25.92  Aligned_cols=10  Identities=50%  Similarity=1.122  Sum_probs=6.0

Q ss_pred             CcccCcccCc
Q psy4573         233 PYVCEICGKG  242 (306)
Q Consensus       233 ~~~C~~C~~~  242 (306)
                      .|+|..||..
T Consensus       112 ~l~C~~Cg~~  121 (146)
T PF07295_consen  112 TLVCENCGHE  121 (146)
T ss_pred             eEecccCCCE
Confidence            4666666643


No 186
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=25.27  E-value=43  Score=23.69  Aligned_cols=11  Identities=18%  Similarity=0.625  Sum_probs=5.4

Q ss_pred             cccCcccCcCC
Q psy4573         234 YVCEICGKGFT  244 (306)
Q Consensus       234 ~~C~~C~~~f~  244 (306)
                      |.|++|+..+.
T Consensus        20 ~iCpeC~~EW~   30 (109)
T TIGR00686        20 LICPSCLYEWN   30 (109)
T ss_pred             eECcccccccc
Confidence            45555554443


No 187
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=25.12  E-value=54  Score=17.73  Aligned_cols=22  Identities=23%  Similarity=0.560  Sum_probs=12.2

Q ss_pred             ceeccccccccCChHHHHHHHhh
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMRT  199 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~~  199 (306)
                      .+.|+.|++...... +..|+..
T Consensus         4 ~~~C~nC~R~v~a~R-fA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPVAASR-FAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEEEGGG-HHHHHHH
T ss_pred             eEECCCCcCCcchhh-hHHHHHH
Confidence            466777777655433 5566543


No 188
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=24.83  E-value=31  Score=20.59  Aligned_cols=14  Identities=29%  Similarity=0.641  Sum_probs=7.9

Q ss_pred             CCcccccccccccC
Q psy4573          41 DGSLACNVCSKRCG   54 (306)
Q Consensus        41 ~~~~~C~~C~~~f~   54 (306)
                      ++.+.|..||..|.
T Consensus         2 Dk~l~C~dCg~~Fv   15 (49)
T PF13451_consen    2 DKTLTCKDCGAEFV   15 (49)
T ss_pred             CeeEEcccCCCeEE
Confidence            34556666665553


No 189
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.82  E-value=22  Score=23.23  Aligned_cols=12  Identities=33%  Similarity=0.692  Sum_probs=7.6

Q ss_pred             Cccccccccccc
Q psy4573          42 GSLACNVCSKRC   53 (306)
Q Consensus        42 ~~~~C~~C~~~f   53 (306)
                      -.|+|..|+..|
T Consensus        11 Y~Y~c~~cg~~~   22 (82)
T COG2331          11 YSYECTECGNRF   22 (82)
T ss_pred             eEEeecccchHH
Confidence            346777777555


No 190
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=24.05  E-value=33  Score=23.51  Aligned_cols=11  Identities=36%  Similarity=0.884  Sum_probs=5.8

Q ss_pred             ceecccchhcc
Q psy4573          71 RYACSICLAEF   81 (306)
Q Consensus        71 ~~~C~~C~~~~   81 (306)
                      .+.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (91)
T TIGR00280        53 IWTCRKCGAKF   63 (91)
T ss_pred             EEEcCCCCCEE
Confidence            35555555544


No 191
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=23.80  E-value=19  Score=24.59  Aligned_cols=10  Identities=30%  Similarity=0.976  Sum_probs=5.0

Q ss_pred             ccCCCChhhh
Q psy4573         100 YKCNQCDHVA  109 (306)
Q Consensus       100 ~~C~~C~~~f  109 (306)
                      |.|..|++.|
T Consensus        54 W~C~~C~~~~   63 (90)
T PF01780_consen   54 WKCKKCGKKF   63 (90)
T ss_dssp             EEETTTTEEE
T ss_pred             eecCCCCCEE
Confidence            5555555443


No 192
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=23.67  E-value=29  Score=24.90  Aligned_cols=10  Identities=20%  Similarity=0.295  Sum_probs=5.8

Q ss_pred             cccCcccCcC
Q psy4573         234 YVCEICGKGF  243 (306)
Q Consensus       234 ~~C~~C~~~f  243 (306)
                      +.|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            5566666554


No 193
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=23.40  E-value=41  Score=26.60  Aligned_cols=15  Identities=27%  Similarity=0.840  Sum_probs=9.0

Q ss_pred             cceeccccccccCCh
Q psy4573         176 IKFECEVCHRKLSTK  190 (306)
Q Consensus       176 ~~~~C~~C~~~f~~~  190 (306)
                      +||.|.+|-+.|.+.
T Consensus       195 IPF~C~iCKkdy~sp  209 (259)
T COG5152         195 IPFLCGICKKDYESP  209 (259)
T ss_pred             Cceeehhchhhccch
Confidence            366666666665554


No 194
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=23.36  E-value=48  Score=24.47  Aligned_cols=25  Identities=28%  Similarity=0.464  Sum_probs=18.9

Q ss_pred             eeccccccccCChHHHHHHHhhccCCCC
Q psy4573         178 FECEVCHRKLSTKNHLRLHMRTHTNERP  205 (306)
Q Consensus       178 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~  205 (306)
                      ..|-.+|+.|.+   |++|+.+|.+.-|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            568888888765   8899999876543


No 195
>KOG4377|consensus
Probab=23.27  E-value=73  Score=28.39  Aligned_cols=28  Identities=18%  Similarity=0.433  Sum_probs=19.4

Q ss_pred             CCCCCCCceEEEEEEeecccccCcccCc
Q psy4573           2 CPYKKPSLHQVSFRFYASRKKRGHEKTL   29 (306)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~   29 (306)
                      ||-.-|..++-.+++++.+--.+.-...
T Consensus       203 ~p~s~P~~sp~~l~~~f~~d~sp~t~~~  230 (480)
T KOG4377|consen  203 CPLSEPIYSPIELEMYFWRDYSPKTEKS  230 (480)
T ss_pred             CCcCCcccCccceeEEEeecCCCCCCcc
Confidence            6677788888888887766555554443


No 196
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=22.93  E-value=46  Score=30.40  Aligned_cols=26  Identities=27%  Similarity=0.612  Sum_probs=17.1

Q ss_pred             ccCCcchHhhcChHHHHHHhhhcCCC
Q psy4573         262 YHCEFCSERFSTKALVRHHVRSHHSS  287 (306)
Q Consensus       262 ~~C~~C~~~f~~~~~l~~H~~~~h~~  287 (306)
                      ..|+.|.+.|.....+..|+...|..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhh
Confidence            45666776777777777776665554


No 197
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.84  E-value=36  Score=24.63  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=4.4

Q ss_pred             cccCcCCCcc
Q psy4573         206 AVCSYCGKGF  215 (306)
Q Consensus       206 ~~C~~C~~~f  215 (306)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            3444444333


No 198
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=22.82  E-value=59  Score=19.67  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=3.9

Q ss_pred             cccCcCCCcc
Q psy4573         206 AVCSYCGKGF  215 (306)
Q Consensus       206 ~~C~~C~~~f  215 (306)
                      ++|+.|+..|
T Consensus        29 W~C~~Cgh~w   38 (55)
T PF14311_consen   29 WKCPKCGHEW   38 (55)
T ss_pred             EECCCCCCee
Confidence            3344443333


No 199
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=22.70  E-value=28  Score=25.05  Aligned_cols=11  Identities=27%  Similarity=0.691  Sum_probs=6.5

Q ss_pred             cccCcccCcCC
Q psy4573         234 YVCEICGKGFT  244 (306)
Q Consensus       234 ~~C~~C~~~f~  244 (306)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            55666665553


No 200
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.62  E-value=63  Score=18.37  Aligned_cols=9  Identities=22%  Similarity=0.560  Sum_probs=3.8

Q ss_pred             eeccccccc
Q psy4573         178 FECEVCHRK  186 (306)
Q Consensus       178 ~~C~~C~~~  186 (306)
                      +.|+.||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            445555443


No 201
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=22.34  E-value=34  Score=23.83  Aligned_cols=22  Identities=9%  Similarity=-0.009  Sum_probs=16.3

Q ss_pred             hhhhhhhcCCcccccccccccCC
Q psy4573          33 KKCREVEQDGSLACNVCSKRCGS   55 (306)
Q Consensus        33 ~~~~~~~~~~~~~C~~C~~~f~~   55 (306)
                      .|.+...+ ++.+|+.||..|.-
T Consensus        70 ~W~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          70 IWMWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEEEeCC-CceeCCCCCcEEEE
Confidence            45555555 78999999999863


No 202
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=22.31  E-value=98  Score=19.58  Aligned_cols=14  Identities=21%  Similarity=0.612  Sum_probs=8.3

Q ss_pred             CceecccchhccCC
Q psy4573          70 KRYACSICLAEFHT   83 (306)
Q Consensus        70 ~~~~C~~C~~~~~~   83 (306)
                      ..|.|+.||..+..
T Consensus        45 r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   45 RVFTCPNCGFEMDR   58 (69)
T ss_pred             ceEEcCCCCCEECc
Confidence            35666666665544


No 203
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=22.31  E-value=53  Score=20.21  Aligned_cols=12  Identities=25%  Similarity=0.783  Sum_probs=6.1

Q ss_pred             cCCcccCCCChh
Q psy4573          96 VEGEYKCNQCDH  107 (306)
Q Consensus        96 ~~~~~~C~~C~~  107 (306)
                      +...|-|+.|..
T Consensus        28 Pi~tYmC~eC~~   39 (56)
T PF09963_consen   28 PIHTYMCDECKE   39 (56)
T ss_pred             CCcceeChhHHH
Confidence            344455555544


No 204
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=22.10  E-value=33  Score=18.81  Aligned_cols=6  Identities=33%  Similarity=1.082  Sum_probs=2.2

Q ss_pred             eccccc
Q psy4573         179 ECEVCH  184 (306)
Q Consensus       179 ~C~~C~  184 (306)
                      .|+.||
T Consensus        23 sC~~CG   28 (35)
T PF07503_consen   23 SCTNCG   28 (35)
T ss_dssp             -BTTCC
T ss_pred             cCCCCC
Confidence            344444


No 205
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=21.56  E-value=51  Score=19.66  Aligned_cols=18  Identities=17%  Similarity=0.436  Sum_probs=6.5

Q ss_pred             hhhhhhcCCccccccccc
Q psy4573          34 KCREVEQDGSLACNVCSK   51 (306)
Q Consensus        34 ~~~~~~~~~~~~C~~C~~   51 (306)
                      ........+.|.|++|++
T Consensus        32 fl~~~~~~~~W~CPiC~~   49 (50)
T PF02891_consen   32 FLESNQRTPKWKCPICNK   49 (50)
T ss_dssp             HHHHHHHS---B-TTT--
T ss_pred             HHHHhhccCCeECcCCcC
Confidence            333344455577777764


No 206
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=21.56  E-value=46  Score=18.65  Aligned_cols=13  Identities=31%  Similarity=0.807  Sum_probs=9.0

Q ss_pred             CcccCcccCcCCC
Q psy4573         233 PYVCEICGKGFTQ  245 (306)
Q Consensus       233 ~~~C~~C~~~f~~  245 (306)
                      |+.|..|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            6777777777643


No 207
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=21.50  E-value=20  Score=18.57  Aligned_cols=17  Identities=35%  Similarity=0.597  Sum_probs=7.5

Q ss_pred             cccccccccCChHHHHHH
Q psy4573          45 ACNVCSKRCGSKSGLKIH   62 (306)
Q Consensus        45 ~C~~C~~~f~~~~~l~~H   62 (306)
                      .|-.|++.| .....+.|
T Consensus         2 sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    2 SCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EETTTTEEE-EGGGTTT-
T ss_pred             eeecCCCCc-CcCCcCCC
Confidence            455555555 23333333


No 208
>PLN02294 cytochrome c oxidase subunit Vb
Probab=21.26  E-value=38  Score=26.14  Aligned_cols=24  Identities=17%  Similarity=0.230  Sum_probs=16.4

Q ss_pred             hhhhhhhhcCCcccccccccccCCh
Q psy4573          32 AKKCREVEQDGSLACNVCSKRCGSK   56 (306)
Q Consensus        32 ~~~~~~~~~~~~~~C~~C~~~f~~~   56 (306)
                      ..|.+..+ +++.+|++||..|+-.
T Consensus       131 v~Wf~L~k-Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        131 VVWFWLEK-GKSFECPVCTQYFELE  154 (174)
T ss_pred             eEEEEecC-CCceeCCCCCCEEEEE
Confidence            34555554 4678899999988643


No 209
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=21.23  E-value=1.3e+02  Score=18.46  Aligned_cols=9  Identities=33%  Similarity=0.918  Sum_probs=3.9

Q ss_pred             cccCcccCc
Q psy4573         234 YVCEICGKG  242 (306)
Q Consensus       234 ~~C~~C~~~  242 (306)
                      |.|+.||..
T Consensus        15 ~~Cp~cGip   23 (55)
T PF13824_consen   15 FECPDCGIP   23 (55)
T ss_pred             CcCCCCCCc
Confidence            444444443


No 210
>KOG3214|consensus
Probab=20.58  E-value=21  Score=24.72  Aligned_cols=39  Identities=21%  Similarity=0.458  Sum_probs=20.4

Q ss_pred             CCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHhhcCh
Q psy4573         232 RPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSERFSTK  274 (306)
Q Consensus       232 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~  274 (306)
                      ..|.|+.|.--=+-.-.|.+    -+...-..|.+|+.+|...
T Consensus        22 t~FnClfcnHek~v~~~~Dk----~~~iG~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   22 TQFNCLFCNHEKSVSCTLDK----KHNIGKASCRICEESFQTT   60 (109)
T ss_pred             eeeccCccccccceeeeehh----hcCcceeeeeehhhhhccc
Confidence            35778888643222222211    1222335688888888644


No 211
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=20.57  E-value=24  Score=30.12  Aligned_cols=72  Identities=19%  Similarity=0.327  Sum_probs=25.7

Q ss_pred             ccccccccccccccccc---cCcceeccccccccCChHHHHHHHhhccCCCCcccCcCCCccCCcHHHHHHHHHccCCCC
Q psy4573         157 ECESCKKIFTYHKNTTH---LGIKFECEVCHRKLSTKNHLRLHMRTHTNERPAVCSYCGKGFRRGDALTEHIRIHTGQRP  233 (306)
Q Consensus       157 ~c~~c~~~f~~~~~~~~---~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  233 (306)
                      .|++||..-........   ..+-..|..|+.....              ....|+.||..-...-.+.. ...-.+.+.
T Consensus       174 ~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~--------------~R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rv  238 (290)
T PF04216_consen  174 YCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRF--------------VRIKCPYCGNTDHEKLEYFT-VEGEPAYRV  238 (290)
T ss_dssp             S-TTT---EEEEEEE------EEEEEETTT--EEE----------------TTS-TTT---SS-EEE---------SEEE
T ss_pred             cCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeee--------------cCCCCcCCCCCCCcceeeEe-cCCCCcEEE
Confidence            56666655433322222   1235667777764322              22568888865443322211 111223455


Q ss_pred             cccCcccCcC
Q psy4573         234 YVCEICGKGF  243 (306)
Q Consensus       234 ~~C~~C~~~f  243 (306)
                      +.|..|+.-+
T Consensus       239 e~C~~C~~Yl  248 (290)
T PF04216_consen  239 EVCESCGSYL  248 (290)
T ss_dssp             EEETTTTEEE
T ss_pred             EECCcccchH
Confidence            6787777443


No 212
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=20.38  E-value=61  Score=23.21  Aligned_cols=15  Identities=13%  Similarity=0.565  Sum_probs=9.1

Q ss_pred             ceeccccccccCChH
Q psy4573         177 KFECEVCHRKLSTKN  191 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~  191 (306)
                      ...|..||..|....
T Consensus        70 ~~~C~~Cg~~~~~~~   84 (113)
T PF01155_consen   70 RARCRDCGHEFEPDE   84 (113)
T ss_dssp             EEEETTTS-EEECHH
T ss_pred             cEECCCCCCEEecCC
Confidence            466777777776543


No 213
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.35  E-value=30  Score=28.10  Aligned_cols=27  Identities=11%  Similarity=0.273  Sum_probs=17.9

Q ss_pred             cCCcccccccccccCChHHHHHHhhhc
Q psy4573          40 QDGSLACNVCSKRCGSKSGLKIHMKSH   66 (306)
Q Consensus        40 ~~~~~~C~~C~~~f~~~~~l~~H~~~h   66 (306)
                      -++.+.||.|+..|.....+..-.++-
T Consensus        16 ~kk~ieCPvC~tkFkkeev~tgsiRii   42 (267)
T COG1655          16 YKKTIECPVCNTKFKKEEVKTGSIRII   42 (267)
T ss_pred             hhceeccCcccchhhhhheeccceeEe
Confidence            356788999999997665444444433


No 214
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=20.30  E-value=72  Score=27.48  Aligned_cols=46  Identities=26%  Similarity=0.664  Sum_probs=28.7

Q ss_pred             cccCcCCCccCCcHHHHHHHHH---ccCCCCcccCcccCcCCChhHHHHHHhhccCCCcccCCcchHh
Q psy4573         206 AVCSYCGKGFRRGDALTEHIRI---HTGQRPYVCEICGKGFTQKQALNTHKRGHTGEIPYHCEFCSER  270 (306)
Q Consensus       206 ~~C~~C~~~f~~~~~l~~H~~~---h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~  270 (306)
                      -.|+.||..-.     ..-++.   ..|.+-..|..|+-.+.              ..+..|+.|+.+
T Consensus       185 ~~CPvCGs~P~-----~s~~~~~~~~~G~RyL~CslC~teW~--------------~~R~~C~~Cg~~  233 (305)
T TIGR01562       185 TLCPACGSPPV-----ASMVRQGGKETGLRYLSCSLCATEWH--------------YVRVKCSHCEES  233 (305)
T ss_pred             CcCCCCCChhh-----hhhhcccCCCCCceEEEcCCCCCccc--------------ccCccCCCCCCC
Confidence            36999994431     111222   45677788999986541              123689999975


No 215
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=20.16  E-value=20  Score=27.01  Aligned_cols=32  Identities=28%  Similarity=0.716  Sum_probs=14.8

Q ss_pred             ceecccchhccCChHHHhhhhhhcccCCcccCCCChh
Q psy4573          71 RYACSICLAEFHTLTEKDRHTLSHVVEGEYKCNQCDH  107 (306)
Q Consensus        71 ~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~  107 (306)
                      +|.|. |+..+-+   ..+|-..-.++ .|.|..|+.
T Consensus       117 ~Y~C~-C~q~~l~---~RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         117 PYRCQ-CQQHYLR---IRRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eEEee-cCCccch---hhhcccccccc-eEEeccCCc
Confidence            55666 6555432   22232233333 566666654


No 216
>KOG3362|consensus
Probab=20.10  E-value=32  Score=25.65  Aligned_cols=22  Identities=27%  Similarity=0.569  Sum_probs=14.9

Q ss_pred             ceeccccccccCChHHHHHHHh
Q psy4573         177 KFECEVCHRKLSTKNHLRLHMR  198 (306)
Q Consensus       177 ~~~C~~C~~~f~~~~~l~~H~~  198 (306)
                      +|.|..||-.+-+..-+..|..
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhHHHhcCCceeechhhhhccc
Confidence            4667777777777776666654


No 217
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.03  E-value=51  Score=24.30  Aligned_cols=15  Identities=7%  Similarity=0.087  Sum_probs=8.6

Q ss_pred             CCCCCcccccccchh
Q psy4573         287 SARLGLNLLDHELSM  301 (306)
Q Consensus       287 ~~~~~C~~c~~~~~~  301 (306)
                      .++|+|+.|+++|+.
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            355666666666553


No 218
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=20.03  E-value=56  Score=16.85  Aligned_cols=10  Identities=20%  Similarity=0.707  Sum_probs=3.8

Q ss_pred             ceeccccccc
Q psy4573         177 KFECEVCHRK  186 (306)
Q Consensus       177 ~~~C~~C~~~  186 (306)
                      .|.|..|+..
T Consensus        15 ~Y~C~~Cdf~   24 (30)
T PF07649_consen   15 FYRCSECDFD   24 (30)
T ss_dssp             EEE-TTT---
T ss_pred             eEECccCCCc
Confidence            4666666554


Done!