Diaphorina citri psyllid: psy4583


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MQSTINYESMQRYVSPVNPAIFPHLTILLLGIGIFFTAWFFVYEVTSTKLSRDLVKELVIALVAALFSGFGTLFLLLW
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
*********MQRYVSPVNPAIFPHLTILLLGIGIFFTAWFFVYEVTSTKLSRDLVKELVIALVAALFSGFGTLFLLLW
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSTINYESMQRYVSPVNPAIFPHLTILLLGIGIFFTAWFFVYEVTSTKLSRDLVKELVIALVAALFSGFGTLFLLLW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane protein 258 very confidentP61165
Transmembrane protein 258 very confidentP61166
Transmembrane protein 258 very confidentQ32P84

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted