Query         psy4606
Match_columns 69
No_of_seqs    139 out of 1261
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 21:12:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4606.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4606hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd07693 Ig1_Robo First immunog  99.4 4.3E-12 9.2E-17   59.6   6.0   44    9-55      1-44  (100)
  2 cd05762 Ig8_MLCK Eighth immuno  99.3   2E-11 4.3E-16   57.9   6.6   45   10-57      1-45  (98)
  3 cd05848 Ig1_Contactin-5 First   99.3 2.7E-11 5.8E-16   57.0   6.5   43   10-55      2-47  (94)
  4 cd05747 Ig5_Titin_like M5, fif  99.3 3.8E-11 8.3E-16   56.1   6.4   45    8-55      2-46  (92)
  5 cd05851 Ig3_Contactin-1 Third   99.3   2E-11 4.4E-16   56.8   4.8   42    9-53      1-42  (88)
  6 cd05730 Ig3_NCAM-1_like Third   99.2   1E-10 2.2E-15   54.9   6.5   47    9-56      1-47  (95)
  7 cd05850 Ig1_Contactin-2 First   99.2 1.8E-10 3.9E-15   54.1   6.3   42   10-54      2-46  (94)
  8 cd05737 Ig_Myomesin_like_C C-t  99.2 2.8E-10 6.1E-15   53.2   6.7   39   18-57      8-46  (92)
  9 cd05849 Ig1_Contactin-1 First   99.2 2.3E-10 4.9E-15   53.8   6.2   42   10-54      2-46  (93)
 10 cd05773 Ig8_hNephrin_like Eigh  99.2 1.2E-10 2.6E-15   56.1   5.3   49    6-55      1-51  (109)
 11 cd05749 Ig2_Tyro3_like Second   99.2 1.2E-10 2.6E-15   53.6   4.6   36   18-54      5-41  (81)
 12 PF07679 I-set:  Immunoglobulin  99.2 6.4E-10 1.4E-14   51.4   7.1   46   10-58      1-46  (90)
 13 cd05745 Ig3_Peroxidasin Third   99.1 2.2E-10 4.8E-15   51.6   4.5   31   25-56      1-31  (74)
 14 cd05894 Ig_C5_MyBP-C C5 immuno  99.1 7.2E-10 1.6E-14   51.4   6.2   35   20-55      4-38  (86)
 15 cd05722 Ig1_Neogenin First imm  99.1 5.1E-10 1.1E-14   52.5   5.5   37   18-55      6-42  (95)
 16 cd05868 Ig4_NrCAM Fourth immun  99.1 4.5E-10 9.8E-15   50.9   4.9   28   26-54      1-28  (76)
 17 cd05728 Ig4_Contactin-2-like F  99.1 6.1E-10 1.3E-14   51.4   5.2   37   18-55      6-42  (85)
 18 cd04975 Ig4_SCFR_like Fourth i  99.1 8.4E-10 1.8E-14   52.6   5.5   39   18-57     10-49  (101)
 19 cd05892 Ig_Myotilin_C C-termin  99.1 4.6E-10 9.9E-15   50.9   4.4   30   29-59      1-30  (75)
 20 cd05869 Ig5_NCAM-1 Fifth immun  99.1   1E-09 2.2E-14   51.7   5.6   42    9-53      2-43  (97)
 21 cd04968 Ig3_Contactin_like Thi  99.0 1.3E-09 2.9E-14   50.4   5.6   40   10-52      2-41  (88)
 22 cd05739 Ig3_RPTP_IIa_LAR_like   99.0   6E-10 1.3E-14   49.7   4.1   28   26-54      1-28  (69)
 23 cd05893 Ig_Palladin_C C-termin  99.0 1.1E-09 2.4E-14   49.6   4.4   27   29-56      1-27  (75)
 24 cd04972 Ig_TrkABC_d4 Fourth do  99.0 1.6E-09 3.5E-14   50.4   5.1   36   18-54      7-42  (90)
 25 cd05852 Ig5_Contactin-1 Fifth   99.0 1.3E-09 2.9E-14   49.1   4.6   30   26-56      1-30  (73)
 26 cd05867 Ig4_L1-CAM_like Fourth  99.0 1.6E-09 3.5E-14   49.0   4.9   28   26-54      1-28  (76)
 27 cd05870 Ig5_NCAM-2 Fifth immun  99.0 1.5E-09 3.2E-14   51.3   4.8   38    8-48      1-38  (98)
 28 KOG3513|consensus               99.0 1.7E-09 3.7E-14   67.1   6.1   52    2-56    324-375 (1051)
 29 cd05891 Ig_M-protein_C C-termi  99.0   6E-09 1.3E-13   48.8   6.7   37   18-55      8-44  (92)
 30 cd05723 Ig4_Neogenin Fourth im  99.0 2.5E-09 5.3E-14   47.8   5.1   27   28-55      1-27  (71)
 31 cd05758 Ig5_KIRREL3-like Fifth  99.0 4.5E-09 9.8E-14   49.6   6.2   43    9-55      2-45  (98)
 32 cd05743 Ig_Perlecan_D2_like Im  99.0 3.8E-09 8.3E-14   48.0   5.4   28   26-54      1-28  (78)
 33 cd05865 Ig1_NCAM-1 First immun  99.0 7.2E-09 1.6E-13   49.0   6.3   38   18-55      7-45  (96)
 34 cd04967 Ig1_Contactin First Ig  98.9   6E-09 1.3E-13   48.6   5.7   41   10-53      2-45  (91)
 35 cd05845 Ig2_L1-CAM_like Second  98.9 2.6E-09 5.6E-14   50.5   4.3   51   18-69     10-61  (95)
 36 cd05732 Ig5_NCAM-1_like Fifth   98.9 3.5E-09 7.5E-14   49.6   4.7   41    9-53      2-42  (96)
 37 cd05744 Ig_Myotilin_C_like Imm  98.9 2.8E-09 6.2E-14   48.2   4.2   27   29-56      1-27  (75)
 38 cd05724 Ig2_Robo Second immuno  98.9 4.6E-09   1E-13   48.2   4.9   37   18-55      3-40  (86)
 39 KOG4194|consensus               98.9 1.2E-09 2.5E-14   65.2   3.2   52    2-55    605-656 (873)
 40 cd05760 Ig2_PTK7 Second immuno  98.9 4.3E-09 9.4E-14   47.7   4.3   27   29-56      1-27  (77)
 41 cd05859 Ig4_PDGFR-alpha Fourth  98.9 9.2E-09   2E-13   49.0   5.3   36   20-56     12-47  (101)
 42 cd04978 Ig4_L1-NrCAM_like Four  98.9 9.1E-09   2E-13   46.3   4.9   29   26-55      1-29  (76)
 43 cd04969 Ig5_Contactin_like Fif  98.9 8.9E-09 1.9E-13   46.2   4.8   29   26-55      1-29  (73)
 44 cd05740 Ig_CEACAM_D4 Fourth im  98.9   1E-08 2.3E-13   48.0   5.1   42   10-53      2-43  (91)
 45 cd05733 Ig6_L1-CAM_like Sixth   98.9 3.5E-09 7.7E-14   48.0   3.4   25   29-54      1-25  (77)
 46 cd05875 Ig6_hNeurofascin_like   98.9   5E-09 1.1E-13   47.6   3.8   24   29-53      1-24  (77)
 47 cd05738 Ig2_RPTP_IIa_LAR_like   98.9 8.7E-09 1.9E-13   46.4   4.5   25   29-54      1-25  (74)
 48 cd05857 Ig2_FGFR Second immuno  98.9 5.9E-09 1.3E-13   47.8   3.9   34   21-55      4-37  (85)
 49 cd05874 Ig6_NrCAM Sixth immuno  98.9 5.2E-09 1.1E-13   47.6   3.5   24   29-53      1-24  (77)
 50 cd05863 Ig2_VEGFR-3 Second imm  98.8 9.2E-09   2E-13   45.7   4.1   25   29-54      1-25  (67)
 51 cd05748 Ig_Titin_like Immunogl  98.8 1.7E-08 3.6E-13   45.3   4.8   27   28-55      1-27  (74)
 52 cd05752 Ig1_FcgammaR_like Frst  98.8 4.9E-08 1.1E-12   44.5   6.1   39   18-57      7-46  (78)
 53 cd05866 Ig1_NCAM-2 First immun  98.8 7.9E-08 1.7E-12   45.1   6.9   37   18-55      7-43  (92)
 54 cd05735 Ig8_DSCAM Eight immuno  98.8 2.4E-08 5.3E-13   46.4   4.7   30   26-56      1-30  (88)
 55 cd05746 Ig4_Peroxidasin Fourth  98.8 1.1E-08 2.4E-13   45.4   3.4   26   29-55      1-26  (69)
 56 cd04977 Ig1_NCAM-1_like First   98.8 1.8E-07 3.8E-12   43.8   7.6   37   18-55      7-43  (92)
 57 KOG4221|consensus               98.8   2E-08 4.4E-13   63.3   5.4   61    1-65    320-380 (1381)
 58 cd07702 Ig2_VEGFR-1 Second imm  98.8 1.8E-08 3.8E-13   45.4   3.7   26   29-55      1-26  (72)
 59 cd05856 Ig2_FGFRL1-like Second  98.8 1.9E-08   4E-13   45.7   3.8   32   21-53      4-35  (82)
 60 cd05873 Ig_Sema4D_like Immunog  98.7 7.9E-08 1.7E-12   44.8   5.3   42   18-61      3-44  (87)
 61 cd05764 Ig_2 Subgroup of the i  98.7 7.9E-08 1.7E-12   43.1   5.1   29   26-54      1-29  (74)
 62 cd05771 IgC_Tapasin_R Tapasin-  98.7 1.3E-07 2.7E-12   47.2   6.2   46    2-50     31-78  (139)
 63 cd05864 Ig2_VEGFR-2 Second imm  98.7 2.7E-08 5.8E-13   44.6   3.2   26   29-55      1-26  (70)
 64 cd05727 Ig2_Contactin-2-like S  98.7 6.3E-08 1.4E-12   45.8   4.1   50   19-69     11-63  (96)
 65 cd05882 Ig1_Necl-1 First (N-te  98.7 2.6E-07 5.7E-12   43.6   6.2   33   18-50      4-36  (95)
 66 KOG3513|consensus               98.7 1.1E-07 2.5E-12   59.4   6.1   65    2-68    416-481 (1051)
 67 cd04976 Ig2_VEGFR Second immun  98.7   4E-08 8.8E-13   43.9   3.1   26   29-55      1-26  (71)
 68 PF08205 C2-set_2:  CD80-like C  98.6 1.9E-07 4.1E-12   43.2   5.2   27   26-53     14-41  (89)
 69 cd04971 Ig_TrKABC_d5 Fifth dom  98.6   1E-07 2.2E-12   43.8   4.0   26   30-56      2-27  (81)
 70 cd04973 Ig1_FGFR First immunog  98.6 1.2E-07 2.7E-12   43.1   4.2   35   20-56      3-37  (79)
 71 cd05876 Ig3_L1-CAM Third immun  98.6   5E-08 1.1E-12   43.5   2.9   24   29-53      1-24  (71)
 72 cd05763 Ig_1 Subgroup of the i  98.6 6.8E-08 1.5E-12   43.4   3.2   22   29-51      1-22  (75)
 73 cd07701 Ig1_Necl-3 First (N-te  98.6   2E-07 4.4E-12   43.9   4.8   32   18-49      4-35  (95)
 74 cd04974 Ig3_FGFR Third immunog  98.6 7.7E-08 1.7E-12   44.8   3.3   23   26-48      1-23  (90)
 75 cd05726 Ig4_Robo Fhird immunog  98.6 1.4E-07 3.1E-12   43.8   4.2   23   26-48      1-23  (90)
 76 cd05855 Ig_TrkB_d5 Fifth domai  98.6 9.2E-08   2E-12   43.8   3.4   25   30-55      2-26  (79)
 77 cd05734 Ig7_DSCAM Seventh immu  98.6 1.7E-07 3.6E-12   42.6   3.9   22   29-50      1-22  (79)
 78 cd05736 Ig2_Follistatin_like S  98.6 1.8E-07 3.8E-12   42.1   3.8   25   29-54      1-25  (76)
 79 cd05759 Ig2_KIRREL3-like Secon  98.5 3.3E-07 7.2E-12   41.9   4.3   25   29-54      2-27  (82)
 80 KOG4221|consensus               98.5 7.5E-07 1.6E-11   56.6   6.8   39   18-57    244-282 (1381)
 81 cd05772 IgC_SIRP Signal-regula  98.5 6.4E-07 1.4E-11   43.4   5.1   31   23-54     18-50  (111)
 82 cd05858 Ig3_FGFR-2 Third immun  98.5 2.4E-07 5.2E-12   43.1   3.6   22   26-47      1-22  (90)
 83 cd05731 Ig3_L1-CAM_like Third   98.5 2.1E-07 4.6E-12   41.2   3.2   24   29-53      1-24  (71)
 84 cd05765 Ig_3 Subgroup of the i  98.5 2.2E-07 4.8E-12   42.1   2.9   23   26-48      1-23  (81)
 85 cd04979 Ig_Semaphorin_C Immuno  98.5 1.2E-06 2.6E-11   40.6   5.3   34   18-53      3-36  (89)
 86 cd07705 Ig2_Necl-1 Second immu  98.5 4.3E-07 9.4E-12   41.8   3.8   26   29-55      2-28  (83)
 87 cd05884 Ig2_Necl-3 Second immu  98.5   4E-07 8.7E-12   42.0   3.6   25   29-54      2-27  (83)
 88 cd05729 Ig2_FGFR_like Second i  98.4 1.4E-06 2.9E-11   39.6   5.2   33   21-54      4-36  (85)
 89 cd05761 Ig2_Necl-1-4_like Seco  98.4 6.3E-07 1.4E-11   41.1   3.9   25   29-54      2-27  (82)
 90 cd05750 Ig_Pro_neuregulin Immu  98.4 2.8E-07 6.2E-12   41.2   2.6   26   29-55      1-27  (75)
 91 cd07698 IgC_MHC_I_alpha3 Class  98.4 2.6E-06 5.6E-11   39.9   5.9   25   26-51     14-40  (93)
 92 cd05854 Ig6_Contactin-2 Sixth   98.4 7.9E-07 1.7E-11   41.1   3.9   28   27-55      1-30  (85)
 93 KOG4222|consensus               98.4 5.3E-07 1.1E-11   56.9   4.1   50    2-53    308-357 (1281)
 94 cd00098 IgC Immunoglobulin Con  98.4 9.9E-07 2.2E-11   41.1   4.1   31   24-55     11-43  (95)
 95 cd05725 Ig3_Robo Third immunog  98.3 4.2E-07 9.2E-12   40.2   2.3   24   29-53      1-24  (69)
 96 cd05898 Ig5_KIRREL3 Fifth immu  98.3 4.7E-06   1E-10   39.6   5.8   44    8-55      1-45  (98)
 97 cd04970 Ig6_Contactin_like Six  98.3   2E-06 4.3E-11   39.5   4.3   28   27-55      1-30  (85)
 98 cd05717 Ig1_Necl-1-3_like Firs  98.3 3.1E-06 6.7E-11   39.6   4.9   33   18-50      4-36  (95)
 99 cd05756 Ig1_IL1R_like First im  98.3 1.6E-06 3.4E-11   40.8   3.8   32   20-52      8-44  (94)
100 PHA02785 IL-beta-binding prote  98.3 5.7E-06 1.2E-10   46.6   6.6   36   18-54    227-265 (326)
101 cd05770 IgC_beta2m Class I maj  98.3 4.3E-06 9.4E-11   39.4   5.2   29   25-54     14-44  (93)
102 PF13895 Ig_2:  Immunoglobulin   98.3 7.8E-06 1.7E-10   36.5   5.9   35   21-56      9-43  (80)
103 KOG4222|consensus               98.3 8.5E-07 1.8E-11   56.1   3.1   49    2-53    218-266 (1281)
104 KOG4194|consensus               98.3 1.7E-06 3.6E-11   52.4   4.2   52    2-56    699-751 (873)
105 PHA02826 IL-1 receptor-like pr  98.2 5.4E-06 1.2E-10   44.7   5.5   35   21-56    139-178 (227)
106 cd05885 Ig2_Necl-4 Second immu  98.2 1.5E-06 3.2E-11   39.9   2.8   26   28-54      1-27  (80)
107 cd05767 IgC_MHC_II_alpha Class  98.2 1.1E-05 2.4E-10   38.1   5.6   29   25-54     14-44  (94)
108 cd05766 IgC_MHC_II_beta Class   98.2 6.1E-06 1.3E-10   38.9   4.7   30   25-55     13-44  (94)
109 cd05754 Ig3_Perlecan_like Thir  98.2 6.8E-06 1.5E-10   37.7   4.3   33   18-51      8-41  (85)
110 smart00408 IGc2 Immunoglobulin  98.1 7.7E-06 1.7E-10   34.6   3.9   29   25-54      1-29  (63)
111 smart00407 IGc1 Immunoglobulin  98.1 8.1E-06 1.8E-10   36.8   3.8   24   29-53      2-27  (75)
112 cd05769 IgC_TCR_beta T cell re  98.1 1.1E-05 2.5E-10   39.4   4.4   29   25-54     17-47  (115)
113 cd05883 Ig2_Necl-2 Second immu  98.1 6.5E-06 1.4E-10   38.0   3.2   26   29-55      2-28  (82)
114 cd05853 Ig6_Contactin-4 Sixth   98.1   2E-05 4.2E-10   36.6   4.5   27   28-55      2-30  (85)
115 cd07699 IgC_L Immunoglobulin C  98.1 8.5E-06 1.9E-10   38.8   3.4   29   25-54     16-46  (100)
116 cd05755 Ig2_ICAM-1_like Second  98.0   2E-05 4.3E-10   37.6   4.4   32   22-54     12-46  (100)
117 cd05860 Ig4_SCFR Fourth immuno  98.0 8.7E-05 1.9E-09   35.5   6.5   35   18-53     10-45  (101)
118 cd07690 Ig1_CD4 First immunogl  98.0 4.2E-05 9.2E-10   36.1   5.3   27   21-47      2-28  (94)
119 cd05742 Ig1_VEGFR_like First i  98.0 1.1E-05 2.4E-10   36.9   3.2   23   26-48      1-25  (84)
120 PF07654 C1-set:  Immunoglobuli  98.0 2.3E-05   5E-10   35.9   4.0   29   25-54      7-37  (83)
121 cd07697 IgC_TCR_gamma T cell r  97.9 2.2E-05 4.8E-10   37.2   3.2   28   26-54     16-45  (96)
122 cd05861 Ig1_PDGFR-alphabeta Fr  97.9 3.2E-05 6.9E-10   35.6   3.6   23   26-48      1-23  (84)
123 cd05895 Ig_Pro_neuregulin-1 Im  97.9 1.4E-05   3E-10   35.9   2.2   25   29-54      1-26  (76)
124 cd05768 IgC_CH4 CH4 domain (fo  97.8 5.4E-05 1.2E-09   36.2   3.9   29   25-54     15-45  (102)
125 cd05847 IgC_CH2_IgE CH2 domain  97.8 9.6E-05 2.1E-09   34.8   4.6   27   26-53     14-42  (94)
126 cd05753 Ig2_FcgammaR_like Seco  97.7  0.0001 2.2E-09   33.8   4.1   32   22-54     10-42  (83)
127 PF00047 ig:  Immunoglobulin do  97.7 7.4E-05 1.6E-09   32.2   3.5   23   26-48      1-24  (64)
128 smart00409 IG Immunoglobulin.   97.7 0.00036 7.8E-09   30.9   5.9   34   20-53      3-36  (86)
129 smart00410 IG_like Immunoglobu  97.7 0.00036 7.8E-09   30.9   5.9   34   20-53      3-36  (86)
130 cd05757 Ig2_IL1R_like Second i  97.7 3.6E-05 7.8E-10   36.1   2.5   34   21-55      5-43  (92)
131 cd04985 IgC_CH1 CH1 domain (fi  97.7  0.0002 4.3E-09   33.8   5.0   27   25-52     15-43  (95)
132 cd07696 IgC_CH3 CH3 domain (th  97.6 0.00022 4.7E-09   33.8   4.3   29   24-52     12-43  (96)
133 cd05871 Ig_Semaphorin_classIII  97.6 0.00013 2.9E-09   34.1   3.5   28   20-48      5-32  (91)
134 cd05872 Ig_Sema4B_like Immunog  97.6 0.00034 7.3E-09   32.5   4.3   37   18-56      3-39  (85)
135 PF13927 Ig_3:  Immunoglobulin   97.5 0.00016 3.5E-09   31.6   3.1   18   29-46     18-36  (75)
136 cd05881 Ig1_Necl-2 First (N-te  97.5  0.0013 2.8E-08   31.1   6.1   33   18-50      4-36  (95)
137 cd05719 Ig2_PVR_like Second im  97.5 0.00028 6.1E-09   33.3   3.8   24   24-47     13-37  (95)
138 cd05899 IgV_TCR_beta Immunoglo  97.5 0.00047   1E-08   33.0   4.3   30   18-48      5-34  (110)
139 cd04982 IgV_TCR_gamma Immunogl  97.4 0.00087 1.9E-08   32.3   4.6   31   18-48      5-37  (116)
140 cd07703 Ig2_Nectin-2_like Seco  97.3  0.0007 1.5E-08   32.0   4.0   26   23-48     12-38  (95)
141 cd04983 IgV_TCR_alpha_like Imm  97.3 0.00073 1.6E-08   32.1   4.2   31   18-48      5-35  (109)
142 cd04980 IgV_L_kappa Immunoglob  97.3  0.0011 2.4E-08   31.5   4.5   31   18-48      7-38  (106)
143 cd04986 IgC_CH2 CH2 domain (se  97.2 0.00098 2.1E-08   31.8   3.4   26   25-51     18-46  (99)
144 cd05897 Ig2_IL1R2_like Second   97.0  0.0012 2.7E-08   31.2   3.1   35   21-56      5-44  (95)
145 cd00099 IgV Immunoglobulin var  96.8   0.003 6.6E-08   29.6   3.6   27   22-48      2-29  (105)
146 cd05751 Ig1_LILRB1_like First   96.8  0.0053 1.1E-07   28.5   4.3   30   21-52     11-40  (91)
147 cd05862 Ig1_VEGFR First immuno  96.5  0.0091   2E-07   27.5   3.8   24   26-49      1-26  (86)
148 cd05711 Ig_FcalphaRI Immunoglo  96.4   0.017 3.7E-07   27.0   4.4   35   10-48      2-36  (94)
149 cd07704 Ig2_Nectin-3-4_like Se  96.4  0.0099 2.1E-07   28.3   3.6   28   21-48     11-40  (97)
150 PHA02826 IL-1 receptor-like pr  96.3  0.0097 2.1E-07   32.3   3.7   30   19-48     30-70  (227)
151 cd04984 IgV_L_lambda Immunoglo  96.3  0.0072 1.6E-07   28.3   2.8   27   22-48      2-30  (98)
152 cd07706 IgV_TCR_delta Immunogl  96.1   0.025 5.4E-07   27.3   4.3   31   18-48      6-37  (116)
153 PHA02785 IL-beta-binding prote  96.1  0.0062 1.3E-07   34.6   2.4   27   22-48     37-68  (326)
154 PHA03376 BARF1; Provisional     96.0   0.015 3.2E-07   31.2   3.3   25   26-50    139-163 (221)
155 cd07700 IgV_CD8_beta Immunoglo  96.0   0.022 4.9E-07   27.1   3.7   27   22-48      2-29  (107)
156 cd07694 Ig2_CD4 Second immunog  95.9   0.023 5.1E-07   26.6   3.4   32   22-53     10-43  (88)
157 PHA02865 MHC-like TNF binding   95.8   0.029 6.2E-07   32.4   4.3   21   28-48    216-238 (338)
158 cd07689 Ig2_VCAM-1 Second immu  95.7   0.031 6.8E-07   26.8   3.6   29   23-52     12-43  (99)
159 PF07686 V-set:  Immunoglobulin  95.6   0.069 1.5E-06   25.0   4.6   30   18-47      8-38  (114)
160 cd00096 Ig Immunoglobulin doma  95.4   0.025 5.5E-07   23.4   2.6   19   29-47      1-19  (74)
161 cd05720 Ig_CD8_alpha Immunoglo  95.3   0.032   7E-07   26.5   3.0   26   23-48      3-28  (104)
162 cd04981 IgV_H Immunoglobulin (  95.3   0.075 1.6E-06   25.9   4.2   31   18-48      4-36  (117)
163 cd05714 Ig_CSPGs_LP Immunoglob  95.3   0.044 9.6E-07   25.9   3.3   24   25-48      1-30  (106)
164 cd05715 Ig_P0-like Immunoglobu  95.3   0.066 1.4E-06   25.9   4.0   30   18-47      5-38  (116)
165 PHA02987 Ig domain OX-2-like p  95.2   0.054 1.2E-06   28.8   3.7   29   20-48     24-53  (189)
166 cd05880 Ig_EVA1 Immunoglobulin  95.0     0.1 2.2E-06   25.3   4.2   30   18-47      5-38  (115)
167 cd05900 Ig_Aggrecan Immunoglob  94.8   0.073 1.6E-06   25.9   3.3   24   25-48      1-36  (112)
168 cd05877 Ig_LP_like Immunoglobu  94.7   0.076 1.6E-06   25.1   3.3   24   25-48      1-30  (106)
169 cd07692 Ig_CD3_epsilon Immunog  94.5   0.064 1.4E-06   23.8   2.4   27   24-54      5-31  (65)
170 cd05741 Ig_CEACAM_D1_like Firs  94.5   0.044 9.6E-07   25.1   2.1   23   26-48      1-23  (92)
171 cd05716 Ig_pIgR Immunoglobulin  94.3   0.096 2.1E-06   24.4   3.1   27   22-48      3-30  (98)
172 KOG3515|consensus               94.1   0.071 1.5E-06   33.8   2.9   28   22-49     18-46  (741)
173 cd05896 Ig1_IL1RAPL-1_like Fir  93.9     0.2 4.4E-06   24.2   3.7   30   20-50      9-49  (104)
174 cd05712 Ig_Siglec_N Immunoglob  93.1    0.36 7.8E-06   23.4   4.0   31   18-48      6-42  (119)
175 cd05878 Ig_Aggrecan_like Immun  92.9    0.27 5.9E-06   23.7   3.3   24   25-48      1-34  (110)
176 cd05879 Ig_P0 Immunoglobulin (  92.2    0.58 1.3E-05   22.9   4.0   30   18-47      5-38  (116)
177 PHA03052 Hypothetical protein;  92.2    0.55 1.2E-05   21.0   5.3   35   18-53      4-41  (69)
178 cd05721 IgV_CTLA-4 Immunoglobu  92.1    0.53 1.1E-05   23.2   3.8   28   21-48      8-38  (115)
179 cd05775 Ig_SLAM-CD84_like_N N-  91.6    0.14 3.1E-06   24.0   1.5   25   24-48      2-27  (97)
180 cd05890 Ig2_Nectin-1_like Seco  91.2    0.32   7E-06   23.3   2.4   25   27-51     21-47  (98)
181 cd05718 Ig1_PVR_like First imm  91.1    0.31 6.8E-06   22.5   2.4   22   27-48      1-25  (98)
182 smart00406 IGv Immunoglobulin   90.5    0.62 1.3E-05   20.3   3.0   21   28-48      1-23  (81)
183 cd05713 Ig_MOG_like Immunoglob  90.4    0.84 1.8E-05   21.2   3.5   23   26-48      1-26  (100)
184 cd05774 Ig_CEACAM_D1 First imm  90.1    0.45 9.8E-06   22.9   2.5   24   22-47      9-34  (105)
185 cd05902 Ig_Neurocan Immunoglob  89.9    0.81 1.8E-05   22.2   3.2   23   26-48      2-31  (110)
186 PHA03269 envelope glycoprotein  89.8       2 4.3E-05   26.5   5.2   44    6-54    326-372 (566)
187 cd05846 Ig1_MRC-OX-2_like Firs  89.3    0.72 1.6E-05   21.5   2.8   23   26-48      1-24  (97)
188 PF06832 BiPBP_C:  Penicillin-B  88.8     1.5 3.2E-05   20.2   5.4   24   28-53     31-54  (89)
189 PF06328 Lep_receptor_Ig:  Ig-l  84.8     2.9 6.3E-05   19.6   4.5   34   20-54     12-50  (89)
190 KOG3515|consensus               84.6     3.7 8.1E-05   26.6   4.6   46    4-52     92-139 (741)
191 cd05901 Ig_Versican Immunoglob  83.8     3.4 7.3E-05   20.5   3.5   22   26-47      2-34  (117)
192 PHA03273 envelope glycoprotein  80.8      11 0.00023   23.3   5.6   43    7-54    235-280 (486)
193 cd05888 Ig1_Nectin-4_like Frst  80.4     3.1 6.6E-05   19.5   2.6   22   27-48      1-25  (100)
194 cd05889 Ig1_DNAM-1_like First   79.6     2.4 5.3E-05   20.1   2.1   21   28-48      2-23  (96)
195 KOG4597|consensus               78.2     1.3 2.7E-05   27.3   1.0   30   18-47    203-232 (560)
196 PHA03112 IL-18 binding protein  74.1     9.6 0.00021   19.6   3.4   28   22-49     34-63  (141)
197 cd05887 Ig1_Nectin-3_like Firs  73.1     5.2 0.00011   18.9   2.3   22   27-48      1-23  (96)
198 cd07691 Ig_CD3_gamma_delta Imm  69.2     9.1  0.0002   17.3   2.4   22   26-52      6-27  (69)
199 PHA03270 envelope glycoprotein  64.5      31 0.00068   21.3   5.4   42    8-54    220-264 (466)
200 PHA03271 envelope glycoprotein  61.2      37  0.0008   21.0   5.1   32   22-54    256-290 (490)
201 PF07354 Sp38:  Zona-pellucida-  61.1     8.9 0.00019   21.9   1.9   18   39-56     11-28  (271)
202 cd05886 Ig1_Nectin-1_like Firs  57.7      20 0.00044   17.0   3.3   21   28-48      2-26  (99)
203 KOG1480|consensus               53.9     3.2 6.9E-05   27.2  -0.5   37   18-55    136-173 (909)
204 KOG1026|consensus               53.8      10 0.00022   24.9   1.5   27   21-47    202-228 (774)
205 KOG3743|consensus               39.1      54  0.0012   21.0   2.9   26   22-47    379-404 (622)
206 COG3908 Uncharacterized protei  34.4      36 0.00078   15.4   1.4   13   30-42     30-42  (77)
207 PF09270 BTD:  Beta-trefoil DNA  34.3      34 0.00073   18.1   1.4   26   22-47     69-94  (158)
208 PF10738 Lpp-LpqN:  Probable li  32.0      74  0.0016   17.0   2.5   30   36-66    110-141 (175)
209 PF08204 V-set_CD47:  CD47 immu  27.5      83  0.0018   16.1   2.1   30   23-53     24-58  (130)
210 PHA02982 hypothetical protein;  26.7 1.3E+02  0.0028   17.0   2.9   35   20-54     33-68  (251)
211 PF15525 DUF4652:  Domain of un  26.0   1E+02  0.0023   17.0   2.4   28   42-69    116-143 (200)
212 PHA03402 hypothetical protein;  25.5      85  0.0018   14.4   2.1   18   21-38     11-28  (81)
213 PF02124 Marek_A:  Marek's dise  25.0      97  0.0021   17.3   2.2   18   24-41    146-163 (211)
214 PTZ00096 40S ribosomal protein  23.6 1.1E+02  0.0024   16.0   2.2   18   37-55     71-88  (143)
215 PF02440 Adeno_E3_CR1:  Adenovi  22.3      92   0.002   13.7   1.9   20   24-47      3-22  (63)
216 PF09866 DUF2093:  Uncharacteri  21.9      79  0.0017   12.8   1.4   12   30-41      7-18  (42)
217 PHA02840 hypothetical protein;  20.1 1.2E+02  0.0025   14.1   2.1   18   21-38     10-27  (82)

No 1  
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=99.37  E-value=4.3e-12  Score=59.63  Aligned_cols=44  Identities=39%  Similarity=0.843  Sum_probs=37.7

Q ss_pred             CCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606           9 PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus         9 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +|.+...  +....+.+|+.+.|.|.+.|.|.|.+.|+| +|..+..
T Consensus         1 ~P~i~~~--p~~~~v~~G~~~~l~C~~~g~P~p~i~W~k-~g~~l~~   44 (100)
T cd07693           1 PPRIVEH--PSDLIVSKGDPATLNCKAEGRPTPTIQWLK-NGQPLET   44 (100)
T ss_pred             CCeEEec--CceeEEcCCCeEEEEeeCCcCCCCEEEEEE-CCEECcc
Confidence            5777776  677888999999999999999999999999 7776643


No 2  
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=99.32  E-value=2e-11  Score=57.85  Aligned_cols=45  Identities=27%  Similarity=0.486  Sum_probs=37.9

Q ss_pred             CEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecC
Q psy4606          10 PDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKE   57 (69)
Q Consensus        10 p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~   57 (69)
                      |.|...  +....+..|+.+.|.|.+.|.|.|.+.|+| +++.+..+.
T Consensus         1 p~~~~~--p~~~~v~~G~~v~l~C~~~G~p~p~v~W~k-dg~~l~~~~   45 (98)
T cd05762           1 PQIIQF--PEDMKVRAGESVELFCKVTGTQPITCTWMK-FRKQIQEGE   45 (98)
T ss_pred             CceEEC--CcCEEEECCCEEEEEEEEcccCCCceEEEE-CCEEecCCC
Confidence            456665  677888999999999999999999999999 888876444


No 3  
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=99.30  E-value=2.7e-11  Score=57.00  Aligned_cols=43  Identities=33%  Similarity=0.657  Sum_probs=32.2

Q ss_pred             CEEeecCCCceEEe---cCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          10 PDILNEESSSDIMA---PEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        10 p~~~~~~~~~~~~~---~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      |.++..  +.++.+   .+|+.+.|.|.+.|.|.|.++|++ ++..+..
T Consensus         2 P~f~~~--p~~~~~~~~~~g~~v~l~C~~~G~P~P~i~W~k-~g~~l~~   47 (94)
T cd05848           2 PVFVQE--PDDAIFPTDSDEKKVILNCEARGNPVPTYRWLR-NGTEIDT   47 (94)
T ss_pred             CeeEEC--CCcEEccCCCCCCEEEEEEEeeecCCCEEEEEE-CCeECcc
Confidence            555555  333333   247899999999999999999999 7777653


No 4  
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=99.28  E-value=3.8e-11  Score=56.14  Aligned_cols=45  Identities=33%  Similarity=0.778  Sum_probs=38.2

Q ss_pred             cCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606           8 VPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus         8 ~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      .||.+...  +....+..|+.+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         2 ~~~~~~~~--p~~~~~~~G~~~~L~C~~~g~P~p~v~W~k-~g~~l~~   46 (92)
T cd05747           2 LPATILTK--PRSLTVSEGESARFSCDVDGEPAPTVTWMR-EGQIIVS   46 (92)
T ss_pred             CCCccccc--CccEEEeCCCcEEEEEEEeecCCCEEEEEE-CCEECCC
Confidence            47888776  677889999999999999999999999999 6766543


No 5  
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.26  E-value=2e-11  Score=56.77  Aligned_cols=42  Identities=33%  Similarity=0.559  Sum_probs=35.2

Q ss_pred             CCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606           9 PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus         9 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +|.+...  +.+..+.+|+.+.|.|.+.|.|.|.++|++ ++..+
T Consensus         1 ~p~i~~~--~~~~~~~~G~~v~l~C~~~G~P~P~v~W~k-~~~~~   42 (88)
T cd05851           1 PADINVK--FKDTYALKGQNVTLECFALGNPVPVIRWRK-ILEPM   42 (88)
T ss_pred             CCceEEc--cccEEEeCCCcEEEEEEecccCCCEEEEEE-CCcCC
Confidence            4667666  667788899999999999999999999999 55544


No 6  
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=99.23  E-value=1e-10  Score=54.91  Aligned_cols=47  Identities=36%  Similarity=0.772  Sum_probs=35.7

Q ss_pred             CCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606           9 PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus         9 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ||.+...+......+..|+.+.|.|.+.|.|.|.+.|++ ++..+...
T Consensus         1 pp~i~~~~~~~~~~~~~G~~v~L~C~~~g~P~p~v~W~k-~g~~~~~~   47 (95)
T cd05730           1 PPTIRARQSEVNATANLGQSVTLACDADGFPEPTMTWTK-DGEPIESG   47 (95)
T ss_pred             CCccccCCcccceEEeCCCCEEEEEeccEeCCCEEEEEE-CCEECcCC
Confidence            455544332445678899999999999999999999999 77666543


No 7  
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.19  E-value=1.8e-10  Score=54.14  Aligned_cols=42  Identities=31%  Similarity=0.629  Sum_probs=31.5

Q ss_pred             CEEeecCCCceEEecC---CCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          10 PDILNEESSSDIMAPE---GGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        10 p~~~~~~~~~~~~~~~---g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |.+...  +......+   |+.+.|.|.+.|.|.|.++|++ +|..+.
T Consensus         2 P~f~~~--P~~~~~~~~~~g~~v~l~C~a~g~P~p~i~W~~-~g~~l~   46 (94)
T cd05850           2 PVFEEQ--PSSLLFPEGSPEEKVTLGCRARASPPATYRWKM-NGTEIK   46 (94)
T ss_pred             CeeEEC--CCCEEecCCCCCCeEEEEeEceeCCCCEEEEEE-CCEECc
Confidence            455554  44444444   4689999999999999999999 787765


No 8  
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=99.18  E-value=2.8e-10  Score=53.21  Aligned_cols=39  Identities=26%  Similarity=0.650  Sum_probs=33.0

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKE   57 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~   57 (69)
                      +..+.+.+|+.+.|.|.+.|.|.|.+.|++ ++..+....
T Consensus         8 p~~v~v~~G~~v~L~C~v~G~P~p~v~W~k-~g~~l~~~~   46 (92)
T cd05737           8 PDVVTIMEGKTLNLTCTVFGDPDPEVSWLK-NDQALALSD   46 (92)
T ss_pred             CceEEEeCCCcEEEEEEEEecCCCeEEEEE-CCEECccCC
Confidence            556778899999999999999999999999 777665443


No 9  
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.18  E-value=2.3e-10  Score=53.80  Aligned_cols=42  Identities=24%  Similarity=0.602  Sum_probs=30.5

Q ss_pred             CEEeecCCCceEEec---CCCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          10 PDILNEESSSDIMAP---EGGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        10 p~~~~~~~~~~~~~~---~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |.+...  +......   .++.+.|.|.+.|.|.|.++|+| ++..+.
T Consensus         2 P~f~~~--P~~~~~~~~~~~~~v~l~C~a~G~P~P~i~W~k-~~~~i~   46 (93)
T cd05849           2 PVFEEQ--PIDTIYPEESTEGKVSVNCRARANPFPIYKWRK-NNLDID   46 (93)
T ss_pred             CEEEEC--CCCEEecCCccCCeEEEeCcCccCCCCEEEEEE-CCEEcc
Confidence            555555  3333332   24579999999999999999999 676664


No 10 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=99.17  E-value=1.2e-10  Score=56.13  Aligned_cols=49  Identities=24%  Similarity=0.568  Sum_probs=35.7

Q ss_pred             EEcCCEEeecCCCceEEe--cCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606           6 VVVPPDILNEESSSDIMA--PEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus         6 V~~~p~~~~~~~~~~~~~--~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      |.++|.+...+....+..  ..|..+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         1 v~~~P~~~~~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~i~W~k-~g~~l~~   51 (109)
T cd05773           1 VRFAPDLQKGPQLRKVASRGDGSSDANLVCQAQGVPRVQFRWAK-NGVPLDL   51 (109)
T ss_pred             CccccccccCCceEEEEEecCCCCEEEEEEECcccCCCEEEEEE-CCEECCC
Confidence            456787766532223332  356889999999999999999999 7877653


No 11 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=99.16  E-value=1.2e-10  Score=53.56  Aligned_cols=36  Identities=28%  Similarity=0.601  Sum_probs=31.8

Q ss_pred             CceEEecCCCeEEEEeeEeeecCC-eEEEEeCCCcEEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRP-HITWKREDGQEII   54 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P-~~~W~~~~~~~~~   54 (69)
                      +.+..+..|+.+.|.|.+.|.|.| .+.|++ +|..+.
T Consensus         5 P~~~~v~~G~~v~l~C~a~G~P~P~~I~W~k-~g~~l~   41 (81)
T cd05749           5 PEDLSVTANTPFNLTCQAVGPPEPVEILWWQ-GGSPLG   41 (81)
T ss_pred             CCceEEcCCCCEEEEEEeeeecCCeEEEEEE-CCEECC
Confidence            566788899999999999999999 799999 777664


No 12 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=99.15  E-value=6.4e-10  Score=51.41  Aligned_cols=46  Identities=26%  Similarity=0.676  Sum_probs=39.0

Q ss_pred             CEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecCC
Q psy4606          10 PDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKEG   58 (69)
Q Consensus        10 p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~~   58 (69)
                      |.|...  +....+.+|+.+.|.|.+.|.|.|.+.|++ ++..+..+.+
T Consensus         1 P~~~~~--~~~~~v~~G~~~~l~c~~~~~p~~~v~W~~-~~~~l~~~~~   46 (90)
T PF07679_consen    1 PVFTKK--PKDVTVKEGESVTLECEVSGNPPPTVTWYK-NGRPLTSSQR   46 (90)
T ss_dssp             EEEEEE--SSEEEEETTSEEEEEEEEEESSSSEEEEEE-TTEEEESSSS
T ss_pred             CEEEEe--cCCEEEeCCCEEEEEEEEEeCCCCcccccc-cccceeeeee
Confidence            566666  677889999999999999999999999999 7888776443


No 13 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.12  E-value=2.2e-10  Score=51.60  Aligned_cols=31  Identities=39%  Similarity=1.070  Sum_probs=26.8

Q ss_pred             CCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          25 EGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        25 ~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      +|+.+.|.|.+.|.|.|.+.|+| ++..+..+
T Consensus         1 eG~~v~l~C~~~g~P~p~i~W~k-~g~~~~~~   31 (74)
T cd05745           1 EGQTVDFLCEAQGYPQPVIAWTK-GGSQLSVD   31 (74)
T ss_pred             CCCeEEEEeECCEecCCEEEEEE-CCEECCCC
Confidence            58899999999999999999999 77766543


No 14 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=99.11  E-value=7.2e-10  Score=51.38  Aligned_cols=35  Identities=26%  Similarity=0.558  Sum_probs=30.7

Q ss_pred             eEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          20 DIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      .+.+..|+.+.|.|.+.|.|.|.+.|++ +++.+..
T Consensus         4 ~~~v~~G~~v~l~c~~~G~P~P~v~W~k-~~~~i~~   38 (86)
T cd05894           4 TIVVVAGNKLRLDVPISGEPAPTVTWSR-GDKAFTE   38 (86)
T ss_pred             EEEEEcCCEEEEEeeEeecCCCeEEEEE-CCEECcc
Confidence            4667889999999999999999999999 7777754


No 15 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.10  E-value=5.1e-10  Score=52.54  Aligned_cols=37  Identities=46%  Similarity=0.884  Sum_probs=31.6

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +......+|+.+.|.|.+.|.|.|.+.|+| ++..+..
T Consensus         6 P~~~~~~~g~~v~l~C~v~g~P~p~i~W~k-~g~~l~~   42 (95)
T cd05722           6 PSDIVAVRGGPVVLNCSAEGEPPPKIEWKK-DGVLLNL   42 (95)
T ss_pred             CCCeEEcCCCCEEEeeecccCCCCEEEEEE-CCeECcc
Confidence            555667789999999999999999999999 7777653


No 16 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.09  E-value=4.5e-10  Score=50.91  Aligned_cols=28  Identities=39%  Similarity=0.884  Sum_probs=25.3

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |+.+.|.|.+.|.|.|.++|++ +|+.+.
T Consensus         1 g~~~~l~C~a~G~P~P~i~W~k-~g~~i~   28 (76)
T cd05868           1 GEDGTLICRANGNPKPSISWLT-NGVPIE   28 (76)
T ss_pred             CCCEEEEEEeeEeCCCeEEEEE-CCEEcc
Confidence            5789999999999999999999 787764


No 17 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=99.08  E-value=6.1e-10  Score=51.42  Aligned_cols=37  Identities=38%  Similarity=0.716  Sum_probs=32.2

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.+..+..|+.+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         6 p~~~~~~~G~~~~l~C~~~g~p~p~v~W~k-~g~~~~~   42 (85)
T cd05728           6 ISDTEADIGSSLRWECKASGNPRPAYRWLK-NGQPLAS   42 (85)
T ss_pred             CCccEEcCCCcEEEEEEeeEeCCCEEEEEE-CCEECCC
Confidence            666788899999999999999999999999 7776643


No 18 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=99.07  E-value=8.4e-10  Score=52.63  Aligned_cols=39  Identities=28%  Similarity=0.558  Sum_probs=33.3

Q ss_pred             CceEEecCCCeEEEEeeEee-ecCCeEEEEeCCCcEEEecC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKG-YPRPHITWKREDGQEIIIKE   57 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g-~P~P~~~W~~~~~~~~~~~~   57 (69)
                      ...+.+..|+.+.|.|.+.| .|.|.+.|+| ||..+....
T Consensus        10 ~~~~~v~~G~~v~L~c~v~g~~P~p~v~W~K-dg~~i~~~~   49 (101)
T cd04975          10 NTTIFVNLGENLNLVVEVEAYPPPPHINWTY-DNRTLTNKL   49 (101)
T ss_pred             CceEEEECCCCEEEEEEEEecCCCCccEEEe-CCeeCCCCc
Confidence            44677889999999999999 9999999999 888876443


No 19 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=99.07  E-value=4.6e-10  Score=50.90  Aligned_cols=30  Identities=30%  Similarity=0.702  Sum_probs=24.4

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEecCCc
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIIIKEGN   59 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~~~~~   59 (69)
                      +.|.|.+.|.|.|.+.|+| +++.+....++
T Consensus         1 v~l~C~v~G~P~P~i~W~k-~~~~i~~~~~r   30 (75)
T cd05892           1 VKLECQISAIPPPKIFWKR-NNEMVQYNTDR   30 (75)
T ss_pred             CEEEEEEEecCCCeEEEEE-CCEECcCCCCe
Confidence            4799999999999999999 78777644333


No 20 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=99.06  E-value=1e-09  Score=51.74  Aligned_cols=42  Identities=31%  Similarity=0.562  Sum_probs=32.5

Q ss_pred             CCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606           9 PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus         9 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      .|.+...  +.......|+.+.|.|.+.|.|.|.++|++ ++..+
T Consensus         2 ~p~i~~~--~~~~~~~~g~~v~l~C~~~G~P~P~v~W~~-~~~~~   43 (97)
T cd05869           2 KPKITYV--ENQTAMELEEQITLTCEASGDPIPSITWRT-STRNI   43 (97)
T ss_pred             CceEEEc--cCceEEEcCCCEEEEEEeeEeCCCEEEEEE-CCccc
Confidence            5777654  444455568999999999999999999999 55544


No 21 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.05  E-value=1.3e-09  Score=50.45  Aligned_cols=40  Identities=30%  Similarity=0.514  Sum_probs=32.2

Q ss_pred             CEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcE
Q psy4606          10 PDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQE   52 (69)
Q Consensus        10 p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~   52 (69)
                      |.+...  +....+.+|+.+.|.|.+.|.|.|.+.|++ ++..
T Consensus         2 ~~~~~~--p~~~~~~~g~~v~l~C~~~g~P~p~v~W~k-~~~~   41 (88)
T cd04968           2 SIIVVF--PKDTYALKGQNVTLECFALGNPVPQIKWRK-VDGS   41 (88)
T ss_pred             CcEEEC--CCceEEeCCCcEEEEEEeeEeCCCEEEEEE-CCCc
Confidence            444444  666778899999999999999999999999 4443


No 22 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=99.04  E-value=6e-10  Score=49.73  Aligned_cols=28  Identities=39%  Similarity=0.972  Sum_probs=24.4

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |+.+.|.|.+.|.|.|.+.|+| +++.+.
T Consensus         1 G~~v~L~C~a~G~P~P~v~W~k-~g~~l~   28 (69)
T cd05739           1 GGSVNLTCVAVGAPMPYVKWMK-GGEELT   28 (69)
T ss_pred             CCeEEEEEEeeecCCCEEEEEE-CCEECC
Confidence            5789999999999999999999 666553


No 23 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=99.01  E-value=1.1e-09  Score=49.59  Aligned_cols=27  Identities=30%  Similarity=0.895  Sum_probs=22.7

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      +.|.|.+.|.|.|.+.|+| ++..+...
T Consensus         1 v~l~C~v~G~P~P~v~W~k-~~~~l~~~   27 (75)
T cd05893           1 VRLECRVSGVPHPQIFWKK-ENESLTHN   27 (75)
T ss_pred             CEEEEEEeEecCCEEEEEE-CCEECCCC
Confidence            4799999999999999999 67666543


No 24 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=99.01  E-value=1.6e-09  Score=50.39  Aligned_cols=36  Identities=33%  Similarity=0.683  Sum_probs=30.3

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      +....+.+|+.+.|.|.+.|.|.|.+.|++ ++..+.
T Consensus         7 p~~~~v~~G~~v~l~C~~~G~P~p~v~W~~-~g~~~~   42 (90)
T cd04972           7 PNATVVYEGGTATIRCTAEGSPLPKVEWII-AGLIVI   42 (90)
T ss_pred             CcCEEEcCCCcEEEEEEEEEcCCCeEEEEE-CCEEcc
Confidence            445558899999999999999999999999 666553


No 25 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.01  E-value=1.3e-09  Score=49.08  Aligned_cols=30  Identities=27%  Similarity=0.791  Sum_probs=25.4

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      |+.+.|.|.+.|.|.|.+.|+| ++..+...
T Consensus         1 G~~~~l~C~~~g~P~p~v~W~k-~~~~l~~~   30 (73)
T cd05852           1 GGRVIIECKPKAAPKPKFSWSK-GTELLVNN   30 (73)
T ss_pred             CCeEEEEEecceeCCCEEEEEe-CCEecccC
Confidence            6789999999999999999999 67665433


No 26 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.01  E-value=1.6e-09  Score=48.97  Aligned_cols=28  Identities=43%  Similarity=0.898  Sum_probs=25.0

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |+.+.|.|.+.|.|.|.++|++ +|..+.
T Consensus         1 G~~v~l~C~~~G~P~p~i~W~k-~g~~i~   28 (76)
T cd05867           1 GETARLDCQVEGIPTPNITWSI-NGAPIE   28 (76)
T ss_pred             CCeEEEEEEeeEeCCCeEEEEE-CCEECC
Confidence            6789999999999999999999 787664


No 27 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.00  E-value=1.5e-09  Score=51.29  Aligned_cols=38  Identities=45%  Similarity=0.806  Sum_probs=32.6

Q ss_pred             cCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeC
Q psy4606           8 VPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus         8 ~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      ++|++..   +.+..+.+|+.++|.|.+.|.|.|.+.|++.
T Consensus         1 ~~p~i~~---~~~~~~~~G~~v~l~C~~~G~P~p~i~W~k~   38 (98)
T cd05870           1 VQPHIIQ---LKNETTVENGAATLSCKAEGEPIPEITWKRA   38 (98)
T ss_pred             CCCEEEe---eccEEEcCCCcEEEEEecccCCCCeEEEEEC
Confidence            4677764   4567888999999999999999999999984


No 28 
>KOG3513|consensus
Probab=99.00  E-value=1.7e-09  Score=67.14  Aligned_cols=52  Identities=33%  Similarity=0.668  Sum_probs=46.5

Q ss_pred             eeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606           2 GYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus         2 ~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ++|.|+++|.++..  +.+.....|+++.+.|.|.|.|.|.++|++ +|.++...
T Consensus       324 ~~v~v~a~P~w~~~--~~d~~~~~gs~v~~eC~a~g~P~p~v~Wlk-Ng~pl~~~  375 (1051)
T KOG3513|consen  324 GHVTVYAPPYWLQK--PQDTEADTGSNVTLECKASGKPNPTVKWLK-NGEPLEPA  375 (1051)
T ss_pred             EEEEEecCchhhcc--cceeEecCCCCeEEEEEecCCCCCceEEee-CCeecCcc
Confidence            57889999999886  888888999999999999999999999999 88877643


No 29 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.99  E-value=6e-09  Score=48.79  Aligned_cols=37  Identities=30%  Similarity=0.661  Sum_probs=31.5

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +..+.+.+|+.+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         8 p~~v~v~eG~~v~L~C~v~g~P~p~i~W~k-~~~~~~~   44 (92)
T cd05891           8 PDVVTIMEGKTLNLTCTVFGNPDPEVIWFK-NDQDIEL   44 (92)
T ss_pred             CCcEEEcCCCEEEEEEEEEEeCCCeEEEEE-CCEECCC
Confidence            556788899999999999999999999999 6655543


No 30 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.99  E-value=2.5e-09  Score=47.84  Aligned_cols=27  Identities=26%  Similarity=0.788  Sum_probs=22.8

Q ss_pred             eEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          28 TIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        28 ~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      ++.|.|.+.|.|.|.++|+| ++..+..
T Consensus         1 ~v~l~C~~~G~P~p~v~W~k-~g~~~~~   27 (71)
T cd05723           1 DVIFECEVTGKPTPTVKWVK-NGDMVIP   27 (71)
T ss_pred             CEEEEEEEEEeCCCEEEEEE-CCeECCC
Confidence            47899999999999999999 6666543


No 31 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.99  E-value=4.5e-09  Score=49.62  Aligned_cols=43  Identities=26%  Similarity=0.409  Sum_probs=34.0

Q ss_pred             CCEEeecCCCceEEecCCCeEEEEeeEeeecCC-eEEEEeCCCcEEEe
Q psy4606           9 PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRP-HITWKREDGQEIII   55 (69)
Q Consensus         9 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P-~~~W~~~~~~~~~~   55 (69)
                      ||.+..   +....+..|+.+.|.|.+.|.|.| .+.|++ ++..+..
T Consensus         2 pp~i~~---~~~~~~~~G~~v~L~C~~~g~P~P~~v~W~~-~~~~i~~   45 (98)
T cd05758           2 PPIITS---EATQYAILGDKGRVECFIFSTPPPDRIVWTW-KENELES   45 (98)
T ss_pred             CCeEcC---CCcEEEeCCCcEEEEEEEcccCCCCEeEEEE-CCEEccC
Confidence            566643   345567889999999999999999 699999 7766654


No 32 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=98.97  E-value=3.8e-09  Score=47.98  Aligned_cols=28  Identities=32%  Similarity=0.744  Sum_probs=24.1

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |+.+.|.|.+.|.|.|.+.|++ ++..+.
T Consensus         1 G~~v~l~C~~~g~P~p~v~W~~-~~~~~~   28 (78)
T cd05743           1 GETVEFTCVATGVPTPIINWRL-NWGHVP   28 (78)
T ss_pred             CCEEEEEEEEEEecCCEEEEEE-CCeECC
Confidence            6789999999999999999999 655544


No 33 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=98.96  E-value=7.2e-09  Score=48.98  Aligned_cols=38  Identities=18%  Similarity=0.412  Sum_probs=30.4

Q ss_pred             CceEEecCCCeEEEEeeEeeecC-CeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPR-PHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~-P~~~W~~~~~~~~~~   55 (69)
                      +....+..|+.+.|.|.+.|.|. |.+.|+++++..+..
T Consensus         7 p~~~~v~~G~~v~l~C~v~G~P~~p~i~W~~~~g~~l~~   45 (96)
T cd05865           7 PSQGEISVGESKFFLCQVAGEAKDKDISWFSPNGEKLTP   45 (96)
T ss_pred             CCccEECCCCeEEEEEEEeCCCCCCEEEEECCCCcCccc
Confidence            44456778999999999999995 799999856665543


No 34 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=98.95  E-value=6e-09  Score=48.57  Aligned_cols=41  Identities=32%  Similarity=0.720  Sum_probs=30.2

Q ss_pred             CEEeecCCCceEEe---cCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          10 PDILNEESSSDIMA---PEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        10 p~~~~~~~~~~~~~---~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      |.+...  +.....   ..++.+.|.|.+.|.|.|.++|++ +++.+
T Consensus         2 P~f~~~--p~~~~~~~~~~~~~~~l~C~~~g~p~p~i~W~k-~~~~l   45 (91)
T cd04967           2 PVFEEQ--PDDTIFPEESDEGKVSLNCRARGSPPPTYRWLM-NGTEI   45 (91)
T ss_pred             CeeEeC--CCCEEccCCCCCCEEEEEEeeeEcCCCEEEEEE-CCEEC
Confidence            455555  333332   344679999999999999999999 77766


No 35 
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.94  E-value=2.6e-09  Score=50.47  Aligned_cols=51  Identities=18%  Similarity=0.336  Sum_probs=36.0

Q ss_pred             CceEEecCCCeEEEEee-EeeecCCeEEEEeCCCcEEEecCCcEEEeCCCCCC
Q psy4606          18 SSDIMAPEGGTIKLVCK-AKGYPRPHITWKREDGQEIIIKEGNTMVPKSKDIF   69 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~-~~g~P~P~~~W~~~~~~~~~~~~~~~~~~~~~~l~   69 (69)
                      .+.+.+.+|..+.|.|. +.|.|.|.+.|++++...+.. .++..+..+|.||
T Consensus        10 ~~~v~V~eG~~~~L~C~pP~g~P~P~i~W~~~~~~~i~~-~~Ri~~~~~GnL~   61 (95)
T cd05845          10 IRPVEVEEGDSVVLPCNPPKSAVPLRIYWMNSDLLHITQ-DERVSMGQNGNLY   61 (95)
T ss_pred             cceeEEecCCCEEEEecCCCCCCCCEEEEECCCCccccc-cccEEECCCceEE
Confidence            45678899999999997 689999999999843333443 3344444445543


No 36 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=98.94  E-value=3.5e-09  Score=49.63  Aligned_cols=41  Identities=37%  Similarity=0.631  Sum_probs=32.9

Q ss_pred             CCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606           9 PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus         9 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +|.+..   ..+..+.+|+.+.|.|.+.|.|.|.+.|++ ++..+
T Consensus         2 ~P~i~~---~~~~~~~~g~~v~l~C~~~g~p~p~v~W~~-~~~~~   42 (96)
T cd05732           2 QPKITY---LENQTAVELEQITLTCEAEGDPIPEITWRR-ATRNF   42 (96)
T ss_pred             Ccccee---cCceeEecCCcEEEEEEEeEcCCCcEEEEE-CCccc
Confidence            567653   445677899999999999999999999999 55443


No 37 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=98.93  E-value=2.8e-09  Score=48.17  Aligned_cols=27  Identities=26%  Similarity=0.791  Sum_probs=23.1

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      +.|.|.+.|.|.|.+.|+| ++..+..+
T Consensus         1 v~L~C~v~G~P~P~v~W~k-~~~~i~~~   27 (75)
T cd05744           1 VRLECRVSAIPPPQIFWKK-NNEMLTYN   27 (75)
T ss_pred             CEEEEEEeecCCCeEEEEE-CCEECCCC
Confidence            4799999999999999999 77776543


No 38 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.93  E-value=4.6e-09  Score=48.22  Aligned_cols=37  Identities=32%  Similarity=0.755  Sum_probs=31.1

Q ss_pred             CceEEecCCCeEEEEeeE-eeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKA-KGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~-~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +....+.+|+.+.|.|.+ .|.|.|.+.|++ ++..+..
T Consensus         3 p~~~~~~~G~~v~l~C~~~~g~p~p~i~W~k-~g~~~~~   40 (86)
T cd05724           3 PSDTQVAVGEMAVLECSPPRGHPEPTVSWRK-DGQPLNL   40 (86)
T ss_pred             CccEEEeCCCCEEEEEECCCCCCCCEEEEEE-CCEECCC
Confidence            456677899999999998 799999999999 7766554


No 39 
>KOG4194|consensus
Probab=98.92  E-value=1.2e-09  Score=65.24  Aligned_cols=52  Identities=29%  Similarity=0.617  Sum_probs=45.1

Q ss_pred             eeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606           2 GYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus         2 ~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|+|...|.+...  +.+.....|....|.|.|+|.|.|++.|-|++|..++.
T Consensus       605 ~KltV~~~PsFtkt--P~dltl~tg~mArl~CaAtG~P~PeIawqkdggtdFPA  656 (873)
T KOG4194|consen  605 AKLTVNQAPSFTKT--PEDLTLRTGQMARLECAATGHPRPEIAWQKDGGTDFPA  656 (873)
T ss_pred             eEEEeeccCccccC--cccceeecccceeeeeeccCCCCcceeehhcCCCCCch
Confidence            57899999999887  88899999999999999999999999999955554543


No 40 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.91  E-value=4.3e-09  Score=47.74  Aligned_cols=27  Identities=37%  Similarity=0.775  Sum_probs=22.8

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ++|.|.+.|.|.|.+.|+| +|..+...
T Consensus         1 v~L~C~~~g~P~p~v~W~k-~g~~l~~~   27 (77)
T cd05760           1 VTLRCHIDGHPRPTYQWFR-DGTPLSDG   27 (77)
T ss_pred             CEEEEEeeecCCCcEEEEE-CCEECCCC
Confidence            4799999999999999999 77776443


No 41 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=98.89  E-value=9.2e-09  Score=49.02  Aligned_cols=36  Identities=25%  Similarity=0.484  Sum_probs=30.8

Q ss_pred             eEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          20 DIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ...+..+..+.|.|.+.|+|.|.+.|+| ++..+..+
T Consensus        12 ~~~~~~~~~~~l~~~v~g~P~P~v~W~k-dg~~l~~~   47 (101)
T cd05859          12 LEFANLHEVKEFVVEVEAYPPPQIRWLK-DNRTLIEN   47 (101)
T ss_pred             eEEEecCCcEEEEEEEEEeCCCceEEEE-CCEECcCC
Confidence            4566778999999999999999999999 88887643


No 42 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.88  E-value=9.1e-09  Score=46.26  Aligned_cols=29  Identities=45%  Similarity=0.836  Sum_probs=25.1

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      |+.+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         1 G~~~~l~C~~~g~P~p~i~W~~-~g~~~~~   29 (76)
T cd04978           1 GETGRLDCEAEGIPQPTITWRL-NGVPIEE   29 (76)
T ss_pred             CCeEEEEEEceeeCCCEEEEEE-CCEECCC
Confidence            6789999999999999999999 7766643


No 43 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.88  E-value=8.9e-09  Score=46.16  Aligned_cols=29  Identities=31%  Similarity=0.793  Sum_probs=25.0

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      |+.+.|.|.+.|.|.|.++|++ ++..+..
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k-~~~~~~~   29 (73)
T cd04969           1 GGDVIIECKPKAAPKPTISWSK-GTELLTN   29 (73)
T ss_pred             CCeEEEEEeeeEcCCCEEEEEE-CCEEccc
Confidence            6789999999999999999999 6766543


No 44 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=98.88  E-value=1e-08  Score=47.95  Aligned_cols=42  Identities=24%  Similarity=0.461  Sum_probs=33.6

Q ss_pred             CEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          10 PDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        10 p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      |.+...+.+..+.+.+|+.++|.|.+.|. .|.+.|++ ++..+
T Consensus         2 p~~~~~~~~~~~~v~~g~~v~l~C~a~g~-~p~i~W~k-ng~~l   43 (91)
T cd05740           2 PVINSNNSVGNQPPEDNQPVTLTCEAEGQ-ATYIWWVN-NGSLL   43 (91)
T ss_pred             CEeecccccCccccccCCcEEEEEEeCCC-CCEEEEEE-CCEEC
Confidence            55544434556788899999999999999 99999999 66654


No 45 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=98.87  E-value=3.5e-09  Score=48.03  Aligned_cols=25  Identities=40%  Similarity=0.917  Sum_probs=21.8

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.|.|.|.++|+| ++..+.
T Consensus         1 i~l~C~~~G~P~P~v~W~k-~g~~l~   25 (77)
T cd05733           1 IVIKCEAKGNPPPTFSWTR-NGTHFD   25 (77)
T ss_pred             CEEEeeCcccCCCeEEEEE-CCeECC
Confidence            4789999999999999999 777664


No 46 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=98.87  E-value=5e-09  Score=47.63  Aligned_cols=24  Identities=42%  Similarity=0.924  Sum_probs=21.1

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +.|.|.+.|.|.|.++|++ ++..+
T Consensus         1 ~~l~C~~~G~P~P~v~W~k-~g~~~   24 (77)
T cd05875           1 IIIECEAKGNPVPTFQWTR-NGKFF   24 (77)
T ss_pred             CEEEEeccccCCCEEEEEE-CCEEc
Confidence            4689999999999999999 77654


No 47 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.86  E-value=8.7e-09  Score=46.39  Aligned_cols=25  Identities=36%  Similarity=0.731  Sum_probs=21.5

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      ++|.|.+.|.|.|.+.|++ ++..+.
T Consensus         1 a~l~C~~~G~P~p~v~W~k-~~~~~~   25 (74)
T cd05738           1 ATMLCAASGNPDPEITWFK-DFLPVD   25 (74)
T ss_pred             CEEEEEEeEecCCEEEEEE-CCEECc
Confidence            4789999999999999999 676654


No 48 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=98.86  E-value=5.9e-09  Score=47.84  Aligned_cols=34  Identities=32%  Similarity=0.738  Sum_probs=29.1

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      ..+..|..+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         4 ~~v~~G~~~~L~C~~~g~P~p~i~W~k-~g~~l~~   37 (85)
T cd05857           4 HAVPAANTVKFRCPAAGNPTPTMRWLK-NGKEFKQ   37 (85)
T ss_pred             EEcCCCCEEEEEEEcCCCCCCEEEEEE-CCEECCC
Confidence            456789999999999999999999999 7766543


No 49 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.85  E-value=5.2e-09  Score=47.57  Aligned_cols=24  Identities=42%  Similarity=1.002  Sum_probs=21.2

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +.|.|.+.|.|.|+++|++ ++..+
T Consensus         1 ~~l~C~a~G~P~P~i~W~k-~g~~l   24 (77)
T cd05874           1 IVIQCEAKGKPPPSFSWTR-NGTHF   24 (77)
T ss_pred             CEEEeeCcccCCCeEEEEE-CCeEC
Confidence            4789999999999999999 77665


No 50 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=98.85  E-value=9.2e-09  Score=45.74  Aligned_cols=25  Identities=40%  Similarity=0.832  Sum_probs=22.4

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.|.|.|.+.|+| +|+.+.
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~   25 (67)
T cd05863           1 VKLPVKVAAYPPPEFQWYK-DGKLIS   25 (67)
T ss_pred             CEEEEEEEEeCCCEEEEEE-CCEECc
Confidence            4789999999999999999 888775


No 51 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=98.83  E-value=1.7e-08  Score=45.31  Aligned_cols=27  Identities=30%  Similarity=0.815  Sum_probs=22.9

Q ss_pred             eEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          28 TIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        28 ~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      .+.|.|.+.|.|.|.+.|++ ++..+..
T Consensus         1 ~~~l~c~~~G~P~p~v~W~k-~g~~l~~   27 (74)
T cd05748           1 SVRLEVPISGRPTPTVTWSK-DGKPLKL   27 (74)
T ss_pred             CEEEEeeEeeeCCCeEEEEE-CCEEcCC
Confidence            36899999999999999999 7776643


No 52 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.81  E-value=4.9e-08  Score=44.53  Aligned_cols=39  Identities=15%  Similarity=0.337  Sum_probs=31.0

Q ss_pred             CceEEecCCCeEEEEeeEeeecCC-eEEEEeCCCcEEEecC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRP-HITWKREDGQEIIIKE   57 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P-~~~W~~~~~~~~~~~~   57 (69)
                      +....+.+|+.++|.|.+.|.|.+ .+.|++ ++..+....
T Consensus         7 P~~~~v~~G~~V~L~C~~~~~p~~~~~~W~k-ng~~l~~~~   46 (78)
T cd05752           7 PPWTTIFQGEKVTLTCNGFNSPEQNSTQWYH-NGKLLETTT   46 (78)
T ss_pred             CCCeEeeCCCCEEEEEeCCCCCCCccEEEEE-CCEEeeccC
Confidence            555667799999999999998864 699999 787774333


No 53 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.81  E-value=7.9e-08  Score=45.14  Aligned_cols=37  Identities=27%  Similarity=0.524  Sum_probs=30.4

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.+..+..|+.+.|.|.+.|.|. .+.|+++++..+..
T Consensus         7 ~~~~~v~~G~~v~l~C~~~G~P~-~v~W~k~~g~~~~~   43 (92)
T cd05866           7 LSKVELSVGESKFFTCTAIGEPE-SIDWYNPQGEKIVS   43 (92)
T ss_pred             ecceEEcCCCeEEEEEEEEEeCC-eEEEEeCCCeEecC
Confidence            45567889999999999999998 89999866666543


No 54 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.79  E-value=2.4e-08  Score=46.39  Aligned_cols=30  Identities=20%  Similarity=0.459  Sum_probs=25.6

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      |+.+.|.|.+.|.|.|.+.|++ ++..+...
T Consensus         1 g~~~~l~C~~~g~p~~~i~W~k-~~~~i~~~   30 (88)
T cd05735           1 GQKKEMSCTAHGEKPIIVRWEK-EDRIINPE   30 (88)
T ss_pred             CCeEEEEEEEECCCCCEEEEee-CCEECCCC
Confidence            6789999999999999999999 77666443


No 55 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.78  E-value=1.1e-08  Score=45.45  Aligned_cols=26  Identities=38%  Similarity=0.970  Sum_probs=22.1

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.|.|.|.+.|+| ++..+..
T Consensus         1 v~L~C~~~g~P~p~i~W~k-~g~~~~~   26 (69)
T cd05746           1 VQIPCSAQGDPEPTITWNK-DGVQVTE   26 (69)
T ss_pred             CEeEecceEeCCCEEEEEE-CCEECCC
Confidence            4799999999999999999 7766543


No 56 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.78  E-value=1.8e-07  Score=43.79  Aligned_cols=37  Identities=22%  Similarity=0.500  Sum_probs=29.8

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +....+..|+.+.|.|.+.|.| |.+.|++++++.+..
T Consensus         7 p~~~~v~~G~~~~l~C~~~G~p-~~i~W~~~~~~~~~~   43 (92)
T cd04977           7 PSQGEISVGESKFFLCQVIGEP-KDISWFSPNGEKLVT   43 (92)
T ss_pred             cCcEEECCCCeEEEEEEeEeeC-CeEEEECCCCCEecc
Confidence            4456778899999999999997 599999866666544


No 57 
>KOG4221|consensus
Probab=98.78  E-value=2e-08  Score=63.27  Aligned_cols=61  Identities=23%  Similarity=0.492  Sum_probs=49.5

Q ss_pred             CeeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecCCcEEEeCC
Q psy4606           1 MGYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKEGNTMVPKS   65 (69)
Q Consensus         1 ~~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~~~~~~~~~   65 (69)
                      .|.|+|+++|.+...  +..+...++.++.|.|.+.|.|.|.+.|+| +|..+.. ++++.+..+
T Consensus       320 saev~V~a~P~~~~~--p~~l~A~e~~die~ec~~~g~p~p~v~w~k-Ngd~~ip-sdy~ki~~~  380 (1381)
T KOG4221|consen  320 SAEVTVLAPPGFTKA--PTTLVAHESMDIEFECPVSGKPIPTVRWYK-NGDRIIP-SDYFKIVGG  380 (1381)
T ss_pred             ceEEEEEcCCCCCCC--CcceeeeeccceeEeCCCCCCCcceEEEEe-cCcccCc-ccceEecCC
Confidence            378999999999877  777888889999999999999999999999 7766654 444444433


No 58 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.76  E-value=1.8e-08  Score=45.41  Aligned_cols=26  Identities=31%  Similarity=0.669  Sum_probs=22.2

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.|.|.|.+.|+| ++..+..
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~~   26 (72)
T cd07702           1 YRLTPKVKAFPAPEVIWLK-DGLPAAE   26 (72)
T ss_pred             CeEEeeEEEcCCCeEEEEE-CCEECCC
Confidence            3689999999999999999 7777654


No 59 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.76  E-value=1.9e-08  Score=45.67  Aligned_cols=32  Identities=44%  Similarity=0.968  Sum_probs=27.2

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +....|+.+.|.|.+.|.|.|.+.|++ ++..+
T Consensus         4 ~~~~~G~~v~L~C~~~g~p~p~i~W~k-~~~~~   35 (82)
T cd05856           4 IARPVGSSVRLKCVASGNPRPDITWLK-DNKPL   35 (82)
T ss_pred             eeccCCCeEEEEEEeeEeCCCcEEEEE-CCcCC
Confidence            445679999999999999999999999 66554


No 60 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=98.72  E-value=7.9e-08  Score=44.76  Aligned_cols=42  Identities=19%  Similarity=0.377  Sum_probs=32.8

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecCCcEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKEGNTM   61 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~~~~~   61 (69)
                      +....+..|+.+.|.|.+.+ |.|.+.|++ +|+.+..+..++.
T Consensus         3 P~~~~v~~G~~v~L~C~~~~-~~~~i~W~~-ng~~i~~~~~r~~   44 (87)
T cd05873           3 PRQRTFKLGNNAELKCSPKS-NLARVVWKF-DGKVLTPESAKYL   44 (87)
T ss_pred             cceEEEECCCCEEEEEECCC-CCCeEEEEE-CCEECCCCCceEE
Confidence            55677889999999999865 789999999 8888765533333


No 61 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.71  E-value=7.9e-08  Score=43.05  Aligned_cols=29  Identities=45%  Similarity=0.832  Sum_probs=24.6

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      |+.+.|.|.+.|.|.|.+.|++.++..+.
T Consensus         1 G~~~~l~C~~~g~P~p~v~W~~~~~~~~~   29 (74)
T cd05764           1 GQRATLRCKARGDPEPAIHWISPDGKLIS   29 (74)
T ss_pred             CCeEEEEEEccCcCCCEEEEEeCCCEEec
Confidence            67899999999999999999975666554


No 62 
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=98.71  E-value=1.3e-07  Score=47.21  Aligned_cols=46  Identities=24%  Similarity=0.492  Sum_probs=34.8

Q ss_pred             eeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEee-ecC-CeEEEEeCCC
Q psy4606           2 GYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKG-YPR-PHITWKREDG   50 (69)
Q Consensus         2 ~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g-~P~-P~~~W~~~~~   50 (69)
                      .+|.|..+|.+...  +.......|..+.|.|.+.| +|. +.+.|++ ++
T Consensus        31 ~~l~v~~~P~v~~~--~~~~~~~~~~~~~L~C~a~g~~P~~~~i~W~~-~g   78 (139)
T cd05771          31 IQLSVSEPPRVRLS--LEKLVSMIEEPQTLICHIAGYYPLDVQVEWTR-EP   78 (139)
T ss_pred             EEEEEecCCceEEe--CCCceeecCCcEEEEEEECCCCCCCeEEEEEE-CC
Confidence            36788899988665  43444447889999999999 575 4899999 54


No 63 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.70  E-value=2.7e-08  Score=44.56  Aligned_cols=26  Identities=38%  Similarity=0.921  Sum_probs=22.4

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.|.|.|.+.|+| +++.+..
T Consensus         1 ~~~~c~v~G~P~P~v~W~k-~g~~l~~   26 (70)
T cd05864           1 VKIPVKYYGYPPPEVKWYK-NGQLIVL   26 (70)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCC
Confidence            3689999999999999999 7877653


No 64 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.67  E-value=6.3e-08  Score=45.84  Aligned_cols=50  Identities=14%  Similarity=0.297  Sum_probs=34.4

Q ss_pred             ceEEecCCCeEEEEeeE-eeecCCeEEEEeCCCcEE--EecCCcEEEeCCCCCC
Q psy4606          19 SDIMAPEGGTIKLVCKA-KGYPRPHITWKREDGQEI--IIKEGNTMVPKSKDIF   69 (69)
Q Consensus        19 ~~~~~~~g~~~~l~C~~-~g~P~P~~~W~~~~~~~~--~~~~~~~~~~~~~~l~   69 (69)
                      ....+.+|..+.|.|.. .|.|.|.+.|++ ++..+  ..+.++.+...+|.||
T Consensus        11 ~~~~v~eG~~~~L~C~pP~g~P~p~~~W~k-~~~~~~~~~d~r~~~~~~~G~L~   63 (96)
T cd05727          11 DEVKVKEGWGVVLFCDPPPHYPDLSYRWLL-NEFPNFIPEDGRRFVSQTNGNLY   63 (96)
T ss_pred             CceeeeeCCcEEEeeCCCCCCCCCEEEEEE-CCcccccccCCCeEEeCCCCcEE
Confidence            34567889999999977 579999999999 66543  2233334444456553


No 65 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=98.66  E-value=2.6e-07  Score=43.60  Aligned_cols=33  Identities=24%  Similarity=0.499  Sum_probs=28.8

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDG   50 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~   50 (69)
                      ..+..+..|+.+.|.|.+.|.|.|.+.|+++++
T Consensus         4 ~~~~tv~~G~tv~L~C~v~g~~~~~v~W~k~~~   36 (95)
T cd05882           4 TQDETVAVGGTVTLKCGVKEHDNSSLQWSNTAQ   36 (95)
T ss_pred             cccEEEecCCcEEEEEEEeCCCCCeEEEeccCc
Confidence            456788899999999999999999999998443


No 66 
>KOG3513|consensus
Probab=98.66  E-value=1.1e-07  Score=59.43  Aligned_cols=65  Identities=23%  Similarity=0.549  Sum_probs=47.9

Q ss_pred             eeEEEEc-CCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecCCcEEEeCCCCC
Q psy4606           2 GYLDVVV-PPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKEGNTMVPKSKDI   68 (69)
Q Consensus         2 ~~l~V~~-~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~~~~~~~~~~~l   68 (69)
                      |+|.|+. +|.+...+......+..|+.+.+.|.+.|.|+|.+.|.| +++.+. .++++.+..+++|
T Consensus       416 A~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~k-~~~~~~-~~~r~~i~edGtL  481 (1051)
T KOG3513|consen  416 AELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWLK-GGEKLL-QSGRIRILEDGTL  481 (1051)
T ss_pred             eEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEEc-CCcccc-cCceEEECCCCcE
Confidence            7899984 477766644455678889999999999999999999999 666433 3445555555543


No 67 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=98.65  E-value=4e-08  Score=43.93  Aligned_cols=26  Identities=38%  Similarity=0.811  Sum_probs=22.4

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.|.|.|.+.|+| +|+.+..
T Consensus         1 ~~l~c~v~g~P~p~v~W~k-~g~~l~~   26 (71)
T cd04976           1 VRLPVKVKAYPPPEIQWYK-NGKLISE   26 (71)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCC
Confidence            4689999999999999999 7877643


No 68 
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=98.63  E-value=1.9e-07  Score=43.21  Aligned_cols=27  Identities=44%  Similarity=1.047  Sum_probs=22.1

Q ss_pred             CCeEEEEeeEee-ecCCeEEEEeCCCcEE
Q psy4606          26 GGTIKLVCKAKG-YPRPHITWKREDGQEI   53 (69)
Q Consensus        26 g~~~~l~C~~~g-~P~P~~~W~~~~~~~~   53 (69)
                      +..+.+.|.+.| +|.|.++|+. ++..+
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~-~~~~~   41 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYL-DGGPV   41 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEE-TTCEE
T ss_pred             ceEEEEEEEeCCeECCeEEEEEE-CCCce
Confidence            789999998876 9999999999 56555


No 69 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.62  E-value=1e-07  Score=43.77  Aligned_cols=26  Identities=23%  Similarity=0.580  Sum_probs=22.4

Q ss_pred             EEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          30 KLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        30 ~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      .+.|.+.|.|.|.++|+| +|+.+...
T Consensus         2 ~i~~~v~G~P~P~v~W~k-~g~~i~~~   27 (81)
T cd04971           2 CIPFTVRGNPKPTLTWYH-NGAVLNES   27 (81)
T ss_pred             eEEEEeEeeCCCcEEEEE-CCEECcCC
Confidence            478999999999999999 88877544


No 70 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=98.62  E-value=1.2e-07  Score=43.13  Aligned_cols=35  Identities=23%  Similarity=0.486  Sum_probs=28.5

Q ss_pred             eEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          20 DIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ...+.+|+.+.|.|.+.|. .|.+.|+| +|..+..+
T Consensus         3 ~~~~~~G~~v~l~C~~~~~-~~~v~W~k-~g~~l~~~   37 (79)
T cd04973           3 SYSAHPGDLLQLRCRLRDD-VQSINWTK-DGVQLGEN   37 (79)
T ss_pred             cEEecCCCCEEEEEEecCC-CceEEEee-CCcCCCCC
Confidence            4567789999999999996 67899999 78776543


No 71 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.61  E-value=5e-08  Score=43.54  Aligned_cols=24  Identities=33%  Similarity=0.805  Sum_probs=20.2

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +.|.|.+.|.|.|.+.|++ ++..+
T Consensus         1 ~~L~C~~~G~P~P~v~W~k-~~~~~   24 (71)
T cd05876           1 LVLECIAEGLPTPEVHWDR-IDGPL   24 (71)
T ss_pred             CEEEEEeeEecCCeEEEEE-CCcCC
Confidence            4689999999999999999 55444


No 72 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.61  E-value=6.8e-08  Score=43.44  Aligned_cols=22  Identities=45%  Similarity=1.082  Sum_probs=19.1

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCc
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQ   51 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~   51 (69)
                      +.|.|.+.|.|.|.++|+| ++.
T Consensus         1 a~l~C~~~G~P~P~v~W~k-~~~   22 (75)
T cd05763           1 ARLECAATGHPTPQIAWQK-DGG   22 (75)
T ss_pred             CEeEeecccccCCEEEEEe-CCC
Confidence            3689999999999999999 443


No 73 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.60  E-value=2e-07  Score=43.89  Aligned_cols=32  Identities=22%  Similarity=0.589  Sum_probs=28.6

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKRED   49 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~   49 (69)
                      ..++.+.+|+.+.|.|.+.|.|.|.+.|++++
T Consensus         4 ~~~v~v~eG~~v~L~C~~~~~p~~~v~W~~~~   35 (95)
T cd07701           4 TQNVTVVEGGTANLTCRVDQNDNTSLQWSNPA   35 (95)
T ss_pred             cceEEEecCCcEEEEEEEecCCceEEEEeCCC
Confidence            56788999999999999999999999998743


No 74 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=98.60  E-value=7.7e-08  Score=44.80  Aligned_cols=23  Identities=30%  Similarity=0.814  Sum_probs=21.2

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      |+.++|.|.+.|.|.|.++|+|.
T Consensus         1 G~~v~l~C~v~g~P~P~i~W~k~   23 (90)
T cd04974           1 GSDVEFHCKVYSDAQPHIQWLKH   23 (90)
T ss_pred             CCcEEEEEEEeCCCCCeEEEEEe
Confidence            57899999999999999999983


No 75 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.59  E-value=1.4e-07  Score=43.81  Aligned_cols=23  Identities=43%  Similarity=1.041  Sum_probs=21.3

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      |+.+.|.|.+.|.|.|.+.|+++
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k~   23 (90)
T cd05726           1 GRTVTFQCEATGNPQPAIFWQKE   23 (90)
T ss_pred             CCEEEEEEECCccCCCEEEEEeC
Confidence            67899999999999999999994


No 76 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.59  E-value=9.2e-08  Score=43.80  Aligned_cols=25  Identities=24%  Similarity=0.555  Sum_probs=21.8

Q ss_pred             EEEeeEeeecCCeEEEEeCCCcEEEe
Q psy4606          30 KLVCKAKGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        30 ~l~C~~~g~P~P~~~W~~~~~~~~~~   55 (69)
                      .+.|.+.|+|.|.++|+| +|+.+..
T Consensus         2 ~i~~~v~G~P~Pti~W~k-ng~~l~~   26 (79)
T cd05855           2 CIPFTVKGNPKPTLQWFH-EGAILNE   26 (79)
T ss_pred             eEEEEEeEeCCCceEEEE-CCEECCC
Confidence            478999999999999999 8887753


No 77 
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.56  E-value=1.7e-07  Score=42.57  Aligned_cols=22  Identities=50%  Similarity=1.179  Sum_probs=19.1

Q ss_pred             EEEEeeEeeecCCeEEEEeCCC
Q psy4606          29 IKLVCKAKGYPRPHITWKREDG   50 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~   50 (69)
                      ++|.|.+.|.|.|.+.|++.++
T Consensus         1 v~l~C~~~G~P~P~v~W~~~~~   22 (79)
T cd05734           1 VTLNCSAEGYPPPTIVWKHSKG   22 (79)
T ss_pred             CEeEeeCeEeCCCEEEEEECCC
Confidence            4799999999999999999433


No 78 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=98.56  E-value=1.8e-07  Score=42.12  Aligned_cols=25  Identities=40%  Similarity=0.939  Sum_probs=21.2

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.|.|.|.+.|+| ++..+.
T Consensus         1 ~~L~C~v~g~P~p~v~W~k-~~~~l~   25 (76)
T cd05736           1 ASLRCHAEGIPLPRLTWLK-NGMDIT   25 (76)
T ss_pred             CEeEeEeeecCCCEEEEEE-CCEECC
Confidence            3689999999999999999 666654


No 79 
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.52  E-value=3.3e-07  Score=41.85  Aligned_cols=25  Identities=40%  Similarity=0.862  Sum_probs=21.5

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.| .|.|.++|++ +++.+.
T Consensus         2 ~~L~C~v~g~~P~~~v~W~~-~g~~l~   27 (82)
T cd05759           2 YNLTCRARGAKPAAEIIWFR-DGEVLD   27 (82)
T ss_pred             EEEEEEEeCccCCCEEEEEE-CCEEcc
Confidence            579999998 7999999999 787654


No 80 
>KOG4221|consensus
Probab=98.51  E-value=7.5e-07  Score=56.63  Aligned_cols=39  Identities=31%  Similarity=0.757  Sum_probs=35.2

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEecC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIKE   57 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~~   57 (69)
                      +....+.+|+.+.|.|.+.|.|+|++.|.+ +|+.+..++
T Consensus       244 p~~~~v~~g~~v~leCvvs~~p~p~v~Wlr-ng~~i~~ds  282 (1381)
T KOG4221|consen  244 PSNAVVVEGDDVVLECVVSGVPKPSVKWLR-NGEKISVDS  282 (1381)
T ss_pred             CCccccccCCcEEEEEEecCCCCCceEEee-CCeeeeecc
Confidence            666778899999999999999999999999 899888776


No 81 
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=98.50  E-value=6.4e-07  Score=43.45  Aligned_cols=31  Identities=32%  Similarity=0.804  Sum_probs=25.4

Q ss_pred             ecCCCeEEEEeeEee-ecC-CeEEEEeCCCcEEE
Q psy4606          23 APEGGTIKLVCKAKG-YPR-PHITWKREDGQEII   54 (69)
Q Consensus        23 ~~~g~~~~l~C~~~g-~P~-P~~~W~~~~~~~~~   54 (69)
                      ...|+.++|.|.+.| +|. -.++|++ ||+.+.
T Consensus        18 ~~~g~~~tL~C~a~gF~P~~i~v~W~k-ng~~~~   50 (111)
T cd05772          18 ANPGQSVNFTCSAHGFSPRDITVKWLK-NGNELS   50 (111)
T ss_pred             cCCCCCEEEEEEEeeEeCCCCEEEEEE-CCEECc
Confidence            346778999999999 886 5899999 887764


No 82 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=98.50  E-value=2.4e-07  Score=43.07  Aligned_cols=22  Identities=41%  Similarity=0.964  Sum_probs=20.8

Q ss_pred             CCeEEEEeeEeeecCCeEEEEe
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      |+.+.|.|.+.|.|.|.+.|++
T Consensus         1 G~~v~L~C~~~g~P~P~i~W~k   22 (90)
T cd05858           1 GSTVEFVCKVYSDAQPHIQWLK   22 (90)
T ss_pred             CCeEEEEEEEecCCCCEEEEEE
Confidence            6789999999999999999998


No 83 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.49  E-value=2.1e-07  Score=41.16  Aligned_cols=24  Identities=42%  Similarity=0.920  Sum_probs=20.2

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +.|.|.+.|.|.|.+.|++ ++..+
T Consensus         1 v~l~C~~~g~P~p~v~W~k-~~~~~   24 (71)
T cd05731           1 LLLECIAEGLPTPEISWIK-IGGEL   24 (71)
T ss_pred             CEEEEEeeEecCCeEEEEE-CCeEC
Confidence            4789999999999999999 55443


No 84 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.46  E-value=2.2e-07  Score=42.10  Aligned_cols=23  Identities=39%  Similarity=0.950  Sum_probs=21.2

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      |+.+.|.|.+.|.|.|.+.|+|.
T Consensus         1 G~~v~l~C~~~g~P~p~v~W~k~   23 (81)
T cd05765           1 GETASFHCDVTGRPPPEITWEKQ   23 (81)
T ss_pred             CCcEEEEeeccccCCCcEEEEec
Confidence            67899999999999999999984


No 85 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=98.46  E-value=1.2e-06  Score=40.56  Aligned_cols=34  Identities=21%  Similarity=0.447  Sum_probs=27.9

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +..+.+..|+.+.|.|.+.+ |.|.+.|++ ++..+
T Consensus         3 ~~~~~v~~g~~v~L~C~~~~-p~~~i~W~k-~~~~~   36 (89)
T cd04979           3 EKVVTVVEGNSVFLECSPKS-NLASVVWLF-QGGPL   36 (89)
T ss_pred             ceEEEEECCCcEEEEEeCCC-CCceEEEEE-CCccc
Confidence            45567788999999999988 889999999 55444


No 86 
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=98.45  E-value=4.3e-07  Score=41.83  Aligned_cols=26  Identities=35%  Similarity=0.718  Sum_probs=21.9

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.| +|.+.++|++ +|+.+..
T Consensus         2 ~~LtC~a~g~~P~~~ItW~k-~g~~l~~   28 (83)
T cd07705           2 AKLRCTSSGSKPAANIKWRK-GDQELEG   28 (83)
T ss_pred             EEEEEEecCccCCCEeEEEE-CCEECCC
Confidence            679999998 7999999999 7776543


No 87 
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=98.45  E-value=4e-07  Score=41.98  Aligned_cols=25  Identities=36%  Similarity=0.830  Sum_probs=21.6

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.| +|...++|++ +|+.+.
T Consensus         2 ~~LtC~a~gf~P~~~itW~k-ng~~l~   27 (83)
T cd05884           2 MQLTCKTSGSKPAADIRWFK-NDKEIK   27 (83)
T ss_pred             EEEEEEeCCccCCCEEEEEE-CCEECc
Confidence            679999998 9999999999 777754


No 88 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=98.44  E-value=1.4e-06  Score=39.62  Aligned_cols=33  Identities=45%  Similarity=0.940  Sum_probs=27.7

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      ..+..|..+.|.|.+.|.|.|.+.|++ ++..+.
T Consensus         4 ~~~~~G~~~~l~C~~~~~p~~~v~W~k-~~~~~~   36 (85)
T cd05729           4 HAVPAGSTVRLKCPASGNPRPTITWLK-DGKPFK   36 (85)
T ss_pred             eEecCCCcEEEEEEcCCCCCCeEEEEE-CCEECc
Confidence            456679999999999999999999999 665543


No 89 
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=98.42  E-value=6.3e-07  Score=41.10  Aligned_cols=25  Identities=28%  Similarity=0.747  Sum_probs=21.4

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.| +|.+.++|++ +++.+.
T Consensus         2 ~~L~C~~~~~~P~~~v~W~~-~~~~l~   27 (82)
T cd05761           2 VELTCTSSGSKPAATIRWFK-GDKELK   27 (82)
T ss_pred             EEEEEEecCcCcCCeEEEEE-CCEEcc
Confidence            689999987 7999999999 777764


No 90 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.42  E-value=2.8e-07  Score=41.17  Aligned_cols=26  Identities=35%  Similarity=0.784  Sum_probs=22.1

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.| .|.|.+.|++ +++.+..
T Consensus         1 ~~l~C~~~g~~P~p~~~W~k-~g~~l~~   27 (75)
T cd05750           1 LVLKCEATSEYPSLRFKWFK-DGKELNR   27 (75)
T ss_pred             CEEEEEccCCCCCceEEEEc-CCeeccc
Confidence            468999999 9999999999 7776654


No 91 
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=98.41  E-value=2.6e-06  Score=39.93  Aligned_cols=25  Identities=52%  Similarity=1.205  Sum_probs=21.2

Q ss_pred             CCeEEEEeeEee-ecCC-eEEEEeCCCc
Q psy4606          26 GGTIKLVCKAKG-YPRP-HITWKREDGQ   51 (69)
Q Consensus        26 g~~~~l~C~~~g-~P~P-~~~W~~~~~~   51 (69)
                      ++.+.|.|.+.| +|.+ .++|.+ +++
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~-~g~   40 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLR-DGE   40 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEE-CCE
Confidence            678999999999 6776 899999 664


No 92 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.40  E-value=7.9e-07  Score=41.05  Aligned_cols=28  Identities=29%  Similarity=0.483  Sum_probs=23.0

Q ss_pred             CeEEEEeeEeeecCC--eEEEEeCCCcEEEe
Q psy4606          27 GTIKLVCKAKGYPRP--HITWKREDGQEIII   55 (69)
Q Consensus        27 ~~~~l~C~~~g~P~P--~~~W~~~~~~~~~~   55 (69)
                      +++.|.|.+.|.|.|  .+.|++ +++.+..
T Consensus         1 ~~~~L~C~a~g~P~p~~~v~W~~-~g~~i~~   30 (85)
T cd05854           1 ENLTLQCHASHDPTMDLTFTWSL-DDFPIDL   30 (85)
T ss_pred             CcEEEEEEEecCCCCCeEEEEEE-CCeEccc
Confidence            368999999999988  579999 7877643


No 93 
>KOG4222|consensus
Probab=98.40  E-value=5.3e-07  Score=56.95  Aligned_cols=50  Identities=30%  Similarity=0.634  Sum_probs=43.6

Q ss_pred             eeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606           2 GYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus         2 ~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      |.|+|+++|.+...  +....+..|..++|.|++.|.|.|.+.|.+.++..+
T Consensus       308 a~ltV~apP~f~kk--p~dq~v~lg~~vt~pc~~~gnP~PavfW~keg~q~l  357 (1281)
T KOG4222|consen  308 ATLTVQAPPSFGKK--PRDQKVALGGTVTFPCETLGNPPPAVFWLKEGSQDL  357 (1281)
T ss_pred             cceEEecCcccccc--cCccccccCceEEeeeecCCCCCcceEEeccCccee
Confidence            67999999999887  666778889999999999999999999999655554


No 94 
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=98.39  E-value=9.9e-07  Score=41.10  Aligned_cols=31  Identities=35%  Similarity=0.848  Sum_probs=25.1

Q ss_pred             cCCCeEEEEeeEeee-cC-CeEEEEeCCCcEEEe
Q psy4606          24 PEGGTIKLVCKAKGY-PR-PHITWKREDGQEIII   55 (69)
Q Consensus        24 ~~g~~~~l~C~~~g~-P~-P~~~W~~~~~~~~~~   55 (69)
                      ..|+.+.|.|.+.|. |. ..++|++ +|..+..
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~i~W~~-~g~~~~~   43 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDITVTWLK-NGKELTS   43 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcEEEEEE-CCEECCC
Confidence            358899999999995 74 6899999 7777643


No 95 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.35  E-value=4.2e-07  Score=40.19  Aligned_cols=24  Identities=25%  Similarity=0.872  Sum_probs=20.0

Q ss_pred             EEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          29 IKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      +.|.|.+.|.|.|.+.|++ ++..+
T Consensus         1 v~l~C~~~g~P~p~v~W~k-~~~~~   24 (69)
T cd05725           1 VEFQCEVGGDPVPTVLWRK-EDGEL   24 (69)
T ss_pred             CEEEEECccCCCCEEEEEE-CCccC
Confidence            4789999999999999999 44433


No 96 
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=98.34  E-value=4.7e-06  Score=39.62  Aligned_cols=44  Identities=25%  Similarity=0.341  Sum_probs=32.4

Q ss_pred             cCCEEeecCCCceEEecCCCeEEEEeeEeeecCCe-EEEEeCCCcEEEe
Q psy4606           8 VPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPH-ITWKREDGQEIII   55 (69)
Q Consensus         8 ~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~-~~W~~~~~~~~~~   55 (69)
                      .||.+..   .....+.+|+.+.|.|.+.+.|.|. +.|.. ++..+..
T Consensus         1 gpP~i~~---~~s~~~~~G~~~~L~C~~~s~P~P~~i~W~w-~~~~i~~   45 (98)
T cd05898           1 GPPIISS---EQVQYAVRGERGKVKCFIGSTPPPDRIAWAW-KENVLES   45 (98)
T ss_pred             CCCEEec---CceEEEeCCCcEEEEEEEccCCCCcEEEEEE-ccccccC
Confidence            3676643   4556788999999999999999985 57877 4555543


No 97 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.32  E-value=2e-06  Score=39.49  Aligned_cols=28  Identities=32%  Similarity=0.538  Sum_probs=23.0

Q ss_pred             CeEEEEeeEeeecCC--eEEEEeCCCcEEEe
Q psy4606          27 GTIKLVCKAKGYPRP--HITWKREDGQEIII   55 (69)
Q Consensus        27 ~~~~l~C~~~g~P~P--~~~W~~~~~~~~~~   55 (69)
                      +.+.|.|.+.|.|.|  .+.|++ +|..+..
T Consensus         1 e~~~L~C~~~g~P~p~i~~~W~~-~g~~i~~   30 (85)
T cd04970           1 ESITLQCHASHDPTLDLTFTWSF-NGVPIDF   30 (85)
T ss_pred             CcEEEEEEEecCCCCCeEEEEEE-CCeEeec
Confidence            368999999999998  568999 7877653


No 98 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=98.31  E-value=3.1e-06  Score=39.61  Aligned_cols=33  Identities=27%  Similarity=0.632  Sum_probs=28.4

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDG   50 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~   50 (69)
                      ...+.+.+|+.+.|.|.+.+.|.|.+.|+++++
T Consensus         4 ~~~~~v~~G~~v~L~C~~~~~~~~~v~W~~p~~   36 (95)
T cd05717           4 TQDVTVVEGGTATLKCRVKNNDNSSLQWSNPNQ   36 (95)
T ss_pred             CCcEEEcCCCCEEEEEEECCCCCceEEEeCCCC
Confidence            556788899999999999999999999987444


No 99 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.31  E-value=1.6e-06  Score=40.82  Aligned_cols=32  Identities=19%  Similarity=0.368  Sum_probs=26.9

Q ss_pred             eEEecCCCeEEEEeeEee-----ecCCeEEEEeCCCcE
Q psy4606          20 DIMAPEGGTIKLVCKAKG-----YPRPHITWKREDGQE   52 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g-----~P~P~~~W~~~~~~~   52 (69)
                      ...+.+|+.+.|.|.+.|     .|.|.+.|+| ++..
T Consensus         8 ~~~v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk-~~~~   44 (94)
T cd05756           8 KSYVLEGEPVVIKCPLFYSYIAQSPGLNLTWYK-SDGK   44 (94)
T ss_pred             EEEEecCCCeEEECCCCCcccccCCCceEEEEE-cCCC
Confidence            455678999999999999     6999999999 5544


No 100
>PHA02785 IL-beta-binding protein; Provisional
Probab=98.30  E-value=5.7e-06  Score=46.61  Aligned_cols=36  Identities=14%  Similarity=0.437  Sum_probs=29.8

Q ss_pred             CceEEecCCCeEEEEeeEeeecC---CeEEEEeCCCcEEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPR---PHITWKREDGQEII   54 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~---P~~~W~~~~~~~~~   54 (69)
                      +....+..|+.+.|.|.|.|.|.   |.+.|++ +|..+.
T Consensus       227 p~~~~~~~G~~v~L~C~a~g~P~~~~~~v~W~k-ng~~i~  265 (326)
T PHA02785        227 PEGVVTSIGSNLTIACRVSLRPPTTDADVFWIS-NGMYYE  265 (326)
T ss_pred             CCcEEecCCCcEEEEEEEECCCCCCCceEEEEE-CCEECC
Confidence            45667778999999999999887   4899999 787664


No 101
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=98.30  E-value=4.3e-06  Score=39.38  Aligned_cols=29  Identities=28%  Similarity=0.436  Sum_probs=23.2

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~   54 (69)
                      .|...+|.|.|.| +|.. .++|.+ ||+.+.
T Consensus        14 ~g~~~~L~C~a~gFyP~~i~v~W~~-dg~~~~   44 (93)
T cd05770          14 NGKPNVLNCYVTGFHPPDIEIRLLK-NGVKIP   44 (93)
T ss_pred             CCCceEEEEEEEEEeCCCCEEEEEE-CCEECC
Confidence            4666799999999 7765 689999 887765


No 102
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=98.30  E-value=7.8e-06  Score=36.52  Aligned_cols=35  Identities=29%  Similarity=0.702  Sum_probs=29.7

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ..+..|+.+.|.|.+.|.|.+.+.|++ ++..+...
T Consensus         9 ~~v~~g~~~~l~C~~~~~p~~~~~w~~-~~~~~~~~   43 (80)
T PF13895_consen    9 QSVEEGDSVTLTCSVSGNPPPQVQWYK-NGSPINSS   43 (80)
T ss_dssp             SEEETTSEEEEEEEEESSSSSEEEEEE-TTEEEEEE
T ss_pred             eEEeCCCcEEEEEEEEcccceeeeeee-eeeeeeee
Confidence            446789999999999999999999999 77777643


No 103
>KOG4222|consensus
Probab=98.28  E-value=8.5e-07  Score=56.08  Aligned_cols=49  Identities=24%  Similarity=0.551  Sum_probs=43.1

Q ss_pred             eeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606           2 GYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus         2 ~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      |.|.|+++|.+...  +....+..|..+.+.|.+.|.|.|.+.|.+ ++..+
T Consensus       218 A~lsv~e~P~f~~r--p~~~~v~~g~~~~f~c~v~GdP~P~Vrwkk-~~~~~  266 (1281)
T KOG4222|consen  218 ARLSVQEKPWFWKR--PKDLAVLVGAAAEFDCRVGGDPQPTVRWKK-DDPSL  266 (1281)
T ss_pred             ceeeeccCCccccc--cccceeecccccccccccCCCCCCceeeec-cCCCC
Confidence            78999999999887  778888889999999999999999999998 44444


No 104
>KOG4194|consensus
Probab=98.27  E-value=1.7e-06  Score=52.37  Aligned_cols=52  Identities=29%  Similarity=0.547  Sum_probs=42.7

Q ss_pred             eeEEEEcCCEEeecCCCceEEecCCCeEEEEeeEeeecC-CeEEEEeCCCcEEEec
Q psy4606           2 GYLDVVVPPDILNEESSSDIMAPEGGTIKLVCKAKGYPR-PHITWKREDGQEIIIK   56 (69)
Q Consensus         2 ~~l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~-P~~~W~~~~~~~~~~~   56 (69)
                      |.|.|...|.+...  ..+..+..|..+.|.|.+.|.|. |.+.|+| +.+++...
T Consensus       699 AtL~V~e~p~f~~P--L~~~~V~~get~vlqC~a~~~~a~pr~~W~k-~d~pil~t  751 (873)
T KOG4194|consen  699 ATLTVLETPSFSIP--LEDQLVVVGETLVLQCLAEGAPADPRLEWFK-EDKPILIT  751 (873)
T ss_pred             eEEEEecCCccccc--ccceEEEecceEEEEEecCCCCCCccccccC-CCCceEEe
Confidence            78999999988765  56677788999999999999887 9999999 55565433


No 105
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=98.25  E-value=5.4e-06  Score=44.70  Aligned_cols=35  Identities=20%  Similarity=0.440  Sum_probs=28.0

Q ss_pred             EEecCCCeEEEEeeEe-----eecCCeEEEEeCCCcEEEec
Q psy4606          21 IMAPEGGTIKLVCKAK-----GYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~-----g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ....+|+.+.|.|.+.     |.|.|.++|+| +++.+..+
T Consensus       139 ~~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyK-ng~~l~~~  178 (227)
T PHA02826        139 YQFNSGKDSKLHCYGTDGISSTFKDYTLTWYK-NGNIVLYT  178 (227)
T ss_pred             ceEecCCCEEEEeeCCCCccccCCCceEEEEE-CCEECCCC
Confidence            4566899999999986     34689999999 88877543


No 106
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=98.24  E-value=1.5e-06  Score=39.94  Aligned_cols=26  Identities=27%  Similarity=0.653  Sum_probs=22.3

Q ss_pred             eEEEEeeEee-ecCCeEEEEeCCCcEEE
Q psy4606          28 TIKLVCKAKG-YPRPHITWKREDGQEII   54 (69)
Q Consensus        28 ~~~l~C~~~g-~P~P~~~W~~~~~~~~~   54 (69)
                      .+.|.|.+.| +|.|.++|++ +++.+.
T Consensus         1 ~~~L~C~s~~skP~a~i~W~k-~~~~l~   27 (80)
T cd05885           1 EVELTCLSPRSKPAATLRWYR-DRKELK   27 (80)
T ss_pred             CEEEEEeCCCccCCCeEEEEE-CCEECC
Confidence            3689999976 9999999999 788774


No 107
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=98.22  E-value=1.1e-05  Score=38.06  Aligned_cols=29  Identities=24%  Similarity=0.662  Sum_probs=23.0

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~   54 (69)
                      .+...+|.|.|.| +|.. .++|.+ +|+.+.
T Consensus        14 ~~~~~tL~C~a~gFyP~~I~v~W~~-~g~~~~   44 (94)
T cd05767          14 LGEPNTLICFVDNFFPPVLNVTWLK-NGVPVT   44 (94)
T ss_pred             CCCCeEEEEEEEEEECCcCEEEEEE-CCeEcc
Confidence            3556799999999 8865 689999 787754


No 108
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=98.22  E-value=6.1e-06  Score=38.88  Aligned_cols=30  Identities=33%  Similarity=0.604  Sum_probs=24.8

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcEEEe
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQEIII   55 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~~   55 (69)
                      .+..++|.|.+.| +|.. .++|++ +|+.+..
T Consensus        13 ~~~~~~L~C~~~gFyP~~i~v~W~~-~g~~~~~   44 (94)
T cd05766          13 LSHPHLLVCHVWGFYPPEITVKWFK-NGQEETE   44 (94)
T ss_pred             CCCCeEEEEEEeeecCCCCEEEEEE-CCeecCC
Confidence            5788999999999 8877 789999 7776543


No 109
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.17  E-value=6.8e-06  Score=37.66  Aligned_cols=33  Identities=24%  Similarity=0.579  Sum_probs=27.5

Q ss_pred             CceEEecCCCeEEEEeeEee-ecCCeEEEEeCCCc
Q psy4606          18 SSDIMAPEGGTIKLVCKAKG-YPRPHITWKREDGQ   51 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g-~P~P~~~W~~~~~~   51 (69)
                      +....+..|+.++|.|.+.+ .|.|.+.|++ ++.
T Consensus         8 p~~~~v~~G~~v~L~C~~~~~~~~~~i~W~~-~~~   41 (85)
T cd05754           8 PRSQEVRPGADVSFICRAKSKSPAYTLVWTR-VGG   41 (85)
T ss_pred             CCceEEcCCCCEEEEEEcCCCCCCcEEEEEE-CCC
Confidence            55567788999999999975 8999999999 443


No 110
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=98.14  E-value=7.7e-06  Score=34.57  Aligned_cols=29  Identities=45%  Similarity=0.969  Sum_probs=24.1

Q ss_pred             CCCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      +|+.+.|.|.+.+.|.+.+.|++ ++..+.
T Consensus         1 ~g~~~~l~C~~~~~~~~~v~W~~-~~~~~~   29 (63)
T smart00408        1 EGQSVTLTCPAEGDPVPNITWLK-DGKPLP   29 (63)
T ss_pred             CCceEEEEeeCccCCCCeEEEEE-CCEECC
Confidence            47889999999999999999999 565443


No 111
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=98.11  E-value=8.1e-06  Score=36.79  Aligned_cols=24  Identities=50%  Similarity=1.042  Sum_probs=19.8

Q ss_pred             EEEEeeEee-ecC-CeEEEEeCCCcEE
Q psy4606          29 IKLVCKAKG-YPR-PHITWKREDGQEI   53 (69)
Q Consensus        29 ~~l~C~~~g-~P~-P~~~W~~~~~~~~   53 (69)
                      ++|.|.|.| +|. ..++|++ +|+.+
T Consensus         2 ~~L~C~a~gf~P~~i~v~W~k-~g~~~   27 (75)
T smart00407        2 ATLVCLVSGFYPPDITVTWLR-NGQEV   27 (75)
T ss_pred             eEEEEEEEeEeCCCCEEEEEE-CCEEC
Confidence            679999999 677 5899999 77753


No 112
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=98.09  E-value=1.1e-05  Score=39.35  Aligned_cols=29  Identities=38%  Similarity=0.850  Sum_probs=23.8

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~   54 (69)
                      .++.++|.|.+.| +|.. .++|++ +++.+.
T Consensus        17 ~~~~~tL~Cla~gFyP~~I~V~W~k-ng~~l~   47 (115)
T cd05769          17 NKRKATLVCLATGFYPDHVSLSWKV-NGKEVT   47 (115)
T ss_pred             cCCCcEEEEEEEeEeCCCcEEEEEE-CCEECC
Confidence            4567999999999 8876 789999 776654


No 113
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=98.08  E-value=6.5e-06  Score=37.98  Aligned_cols=26  Identities=31%  Similarity=0.586  Sum_probs=22.3

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEEe
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEIII   55 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~~   55 (69)
                      +.|.|.+.| .|.+.++|++ +++.+..
T Consensus         2 ~~L~C~s~gSkP~A~I~W~k-~~~~l~~   28 (82)
T cd05883           2 IELNCTAMASKPAATIRWFK-GNKELTG   28 (82)
T ss_pred             EEEEEEecCCCCCCEEEEEE-CCEECcC
Confidence            689999998 9999999999 7777653


No 114
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=98.05  E-value=2e-05  Score=36.59  Aligned_cols=27  Identities=26%  Similarity=0.393  Sum_probs=22.5

Q ss_pred             eEEEEeeEee--ecCCeEEEEeCCCcEEEe
Q psy4606          28 TIKLVCKAKG--YPRPHITWKREDGQEIII   55 (69)
Q Consensus        28 ~~~l~C~~~g--~P~P~~~W~~~~~~~~~~   55 (69)
                      .+.|.|.+.+  .+.+.+.|++ +|+.+..
T Consensus         2 ~~~l~C~v~~d~~l~~~~~W~~-dg~~i~~   30 (85)
T cd05853           2 SIVLPCQVSHDHSLDIVFTWSF-NGHLIDF   30 (85)
T ss_pred             cEEEEEEeccCCCCCcEEEEEE-CCEECcc
Confidence            6889999987  5578899999 8888863


No 115
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.05  E-value=8.5e-06  Score=38.75  Aligned_cols=29  Identities=34%  Similarity=0.776  Sum_probs=23.5

Q ss_pred             CCCeEEEEeeEee-ec-CCeEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKG-YP-RPHITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P-~P~~~W~~~~~~~~~   54 (69)
                      .++.+.|.|.+.| +| .-.+.|++ +|+.+.
T Consensus        16 ~~~~~~L~C~~~gfyP~~i~v~W~~-~g~~~~   46 (100)
T cd07699          16 KSGKATLVCLINDFYPGFATVQWKV-DGATVS   46 (100)
T ss_pred             cCCCcEEEEEEEeEECCCCEEEEEE-CCEECc
Confidence            4677999999999 88 45789999 777653


No 116
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=98.03  E-value=2e-05  Score=37.63  Aligned_cols=32  Identities=25%  Similarity=0.519  Sum_probs=26.5

Q ss_pred             EecCCCeEEEEeeEee-ecCCe--EEEEeCCCcEEE
Q psy4606          22 MAPEGGTIKLVCKAKG-YPRPH--ITWKREDGQEII   54 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g-~P~P~--~~W~~~~~~~~~   54 (69)
                      .+.+|..++|.|.+.| .|.+.  +.|++ +++.+.
T Consensus        12 ~~~eG~~~tL~C~v~g~~P~a~L~i~W~r-G~~~l~   46 (100)
T cd05755          12 WQPVGKNYTLQCDVPGVAPRQNLTVVLLR-GNETLS   46 (100)
T ss_pred             cccCCCcEEEEEEEcCcCCCCcEEEEEee-CCEEcc
Confidence            3568999999999988 99997  69999 666653


No 117
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=98.02  E-value=8.7e-05  Score=35.53  Aligned_cols=35  Identities=20%  Similarity=0.579  Sum_probs=29.8

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCe-EEEEeCCCcEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPH-ITWKREDGQEI   53 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~-~~W~~~~~~~~   53 (69)
                      ...+.+.+|.++.|.|...++|+|+ +.|.+ ++..+
T Consensus        10 ~~~~~v~~gE~~~L~V~ieAYP~p~~~~W~~-~~~~l   45 (101)
T cd05860          10 NTTIFVNAGENLDLIVEYEAYPKPEHQQWIY-MNRTL   45 (101)
T ss_pred             CceEEEECCCCEEEEEEEEeCCCCeeeEEEc-CCccc
Confidence            4456789999999999999999998 99998 55544


No 118
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=98.01  E-value=4.2e-05  Score=36.08  Aligned_cols=27  Identities=26%  Similarity=0.569  Sum_probs=24.3

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEe
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      +.+..|+.++|.|.+.+.|.+.+.|++
T Consensus         2 v~~~~G~~VtL~C~~s~~~~~~i~W~~   28 (94)
T cd07690           2 VLGKKGDTAELPCTASQKKSIQFHWKN   28 (94)
T ss_pred             eEeeCCCCEEEEEEeCCCCCcEEEEEE
Confidence            356789999999999999999999997


No 119
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=98.01  E-value=1.1e-05  Score=36.91  Aligned_cols=23  Identities=22%  Similarity=0.394  Sum_probs=20.6

Q ss_pred             CCeEEEEeeEeee--cCCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGY--PRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~--P~P~~~W~~~   48 (69)
                      |+.+.|.|.+.|.  |.|.+.|.++
T Consensus         1 Ge~~~L~C~~~g~~~~~~~i~W~~~   25 (84)
T cd05742           1 GETLVLNCTVLTELNEGVDFQWTYP   25 (84)
T ss_pred             CCeEEEEEEEEeCCCccEEEEEecC
Confidence            6789999999998  8899999873


No 120
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=97.97  E-value=2.3e-05  Score=35.87  Aligned_cols=29  Identities=38%  Similarity=1.024  Sum_probs=24.1

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~   54 (69)
                      .+..+.|.|.+.| +|.. .+.|++ ++..+.
T Consensus         7 ~~~~~~L~C~v~~f~P~~i~v~W~~-~~~~~~   37 (83)
T PF07654_consen    7 LGGSVTLTCLVSGFYPKDITVTWLK-NGKEVT   37 (83)
T ss_dssp             STSEEEEEEEEEEEBSSTEEEEEEE-TTEEET
T ss_pred             CCCCEEEEEEEEEEECCCcEEEEEe-ccceee
Confidence            3789999999999 8877 689999 777654


No 121
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=97.90  E-value=2.2e-05  Score=37.21  Aligned_cols=28  Identities=18%  Similarity=0.535  Sum_probs=22.3

Q ss_pred             CCeEEEEeeEee-ecCC-eEEEEeCCCcEEE
Q psy4606          26 GGTIKLVCKAKG-YPRP-HITWKREDGQEII   54 (69)
Q Consensus        26 g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~   54 (69)
                      +..++|.|.|.| +|.. .++|.+ +|+.+.
T Consensus        16 ~~~~tL~C~a~gFyP~~I~v~W~k-ng~~~~   45 (96)
T cd07697          16 QGQGIYLCLLENFFPDVIQVHWRE-GNSPSI   45 (96)
T ss_pred             CCCEEEEEEEEEEeCCCeEEEEEE-CCEECc
Confidence            466899999999 7865 579999 777654


No 122
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=97.88  E-value=3.2e-05  Score=35.56  Aligned_cols=23  Identities=26%  Similarity=0.563  Sum_probs=21.0

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      |+.+.|.|.+.|.|.|.+.|.++
T Consensus         1 Ge~~~l~C~~~~~~~~~~~W~~~   23 (84)
T cd05861           1 GETITVNCIVQGNEVVDFSWTYP   23 (84)
T ss_pred             CCcEEEEEEEECCCccEEEEEEC
Confidence            67899999999999999999973


No 123
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=97.87  E-value=1.4e-05  Score=35.88  Aligned_cols=25  Identities=32%  Similarity=0.756  Sum_probs=20.7

Q ss_pred             EEEEeeEee-ecCCeEEEEeCCCcEEE
Q psy4606          29 IKLVCKAKG-YPRPHITWKREDGQEII   54 (69)
Q Consensus        29 ~~l~C~~~g-~P~P~~~W~~~~~~~~~   54 (69)
                      +.|.|.+.+ .|.|.+.|++ +++.+.
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~-~g~~i~   26 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFK-NGKEIG   26 (76)
T ss_pred             CEEEEecccCCCCCceEEEE-CCcccc
Confidence            468999975 7899999999 777764


No 124
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.82  E-value=5.4e-05  Score=36.19  Aligned_cols=29  Identities=31%  Similarity=0.621  Sum_probs=23.2

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcEEE
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQEII   54 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~~~   54 (69)
                      .+..++|.|.|.| +|.. .++|++ +|+.+.
T Consensus        15 ~~~~~tL~C~a~gFyP~~i~v~W~k-~g~~~~   45 (102)
T cd05768          15 LQETATLTCLVKGFSPSDIFVKWLQ-NGQPLS   45 (102)
T ss_pred             cCCceEEEEEEeeEeCCCCEEEEEE-CCEECC
Confidence            3578999999999 7766 579999 776653


No 125
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=97.81  E-value=9.6e-05  Score=34.84  Aligned_cols=27  Identities=37%  Similarity=0.687  Sum_probs=22.1

Q ss_pred             CCeEEEEeeEee-ecC-CeEEEEeCCCcEE
Q psy4606          26 GGTIKLVCKAKG-YPR-PHITWKREDGQEI   53 (69)
Q Consensus        26 g~~~~l~C~~~g-~P~-P~~~W~~~~~~~~   53 (69)
                      ...+.|.|.+.| +|. -.++|.+ +|..+
T Consensus        14 ~~~~~L~C~a~gFyP~~I~vtW~~-dg~~~   42 (94)
T cd05847          14 SETIQLLCLISGYTPGTIEVEWLV-DGQVA   42 (94)
T ss_pred             CCCEEEEEEEEeEECCCCEEEEEE-CCEEC
Confidence            456899999999 887 4689999 77765


No 126
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.74  E-value=0.0001  Score=33.82  Aligned_cols=32  Identities=28%  Similarity=0.422  Sum_probs=26.0

Q ss_pred             EecCCCeEEEEeeEee-ecCCeEEEEeCCCcEEE
Q psy4606          22 MAPEGGTIKLVCKAKG-YPRPHITWKREDGQEII   54 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g-~P~P~~~W~~~~~~~~~   54 (69)
                      .+.+|+.++|.|.+.+ .+.+.+.|+| ++..+.
T Consensus        10 ~V~~G~~vtL~C~~~~~~~~~~~~w~k-~g~~~~   42 (83)
T cd05753          10 VVFEGEPLVLRCHGWKNKPVYKVTYYR-DGKAKK   42 (83)
T ss_pred             eecCCCCEEEEeeCCCCCcceEEEEEE-CCeEcc
Confidence            4678999999999864 7788999999 676553


No 127
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=97.74  E-value=7.4e-05  Score=32.22  Aligned_cols=23  Identities=30%  Similarity=0.884  Sum_probs=20.3

Q ss_pred             CCeEEEEeeE-eeecCCeEEEEeC
Q psy4606          26 GGTIKLVCKA-KGYPRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~-~g~P~P~~~W~~~   48 (69)
                      |+.+.|.|.+ .+.|.+.+.|.++
T Consensus         1 G~~v~L~C~~~~~~~~~~~~W~~~   24 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTTVTWSKN   24 (64)
T ss_dssp             TSEEEEEEEEEESSSTSEEEEEET
T ss_pred             CCeEEEEeecCCCCCCcEEEEEEC
Confidence            6789999999 6688899999994


No 128
>smart00409 IG Immunoglobulin.
Probab=97.74  E-value=0.00036  Score=30.86  Aligned_cols=34  Identities=29%  Similarity=0.806  Sum_probs=27.1

Q ss_pred             eEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          20 DIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      ...+..|+.+.|.|.+.+.+.+.+.|++.+++.+
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~~~W~~~~~~~v   36 (86)
T smart00409        3 SVTVKEGESVTLSCEVSGSPPPEVTWYKQGGKLL   36 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCeEEEEECCCEEc
Confidence            3456789999999999999899999999424444


No 129
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=97.74  E-value=0.00036  Score=30.86  Aligned_cols=34  Identities=29%  Similarity=0.806  Sum_probs=27.1

Q ss_pred             eEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          20 DIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      ...+..|+.+.|.|.+.+.+.+.+.|++.+++.+
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~~~W~~~~~~~v   36 (86)
T smart00410        3 SVTVKEGESVTLSCEVSGSPPPEVTWYKQGGKLL   36 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCeEEEEECCCEEc
Confidence            3456789999999999999899999999424444


No 130
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.74  E-value=3.6e-05  Score=36.11  Aligned_cols=34  Identities=18%  Similarity=0.300  Sum_probs=27.0

Q ss_pred             EEecCCCeEEEEeeEee-e----cCCeEEEEeCCCcEEEe
Q psy4606          21 IMAPEGGTIKLVCKAKG-Y----PRPHITWKREDGQEIII   55 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g-~----P~P~~~W~~~~~~~~~~   55 (69)
                      ..+..|+...|.|...+ .    |.|.+.|+| +++.+..
T Consensus         5 ~~~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk-~~~~i~~   43 (92)
T cd05757           5 QILFSTKGGKIVCPDLDDFKNENTLPPVQWYK-DCKLLEG   43 (92)
T ss_pred             EEEeeccCCEEECCChHHccCCCCCCcEEEeE-CCEECCC
Confidence            45678999999998865 2    678999999 7877654


No 131
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.73  E-value=0.0002  Score=33.84  Aligned_cols=27  Identities=30%  Similarity=0.736  Sum_probs=21.8

Q ss_pred             CCCeEEEEeeEee-ecCC-eEEEEeCCCcE
Q psy4606          25 EGGTIKLVCKAKG-YPRP-HITWKREDGQE   52 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~P~P-~~~W~~~~~~~   52 (69)
                      .++.++|.|.|.| +|.. .++|.+ +|+.
T Consensus        15 ~~~~~~L~C~a~gFyP~~i~vtW~k-~g~~   43 (95)
T cd04985          15 SSDSVTLGCLATGFLPEPVTFTWNS-GSNS   43 (95)
T ss_pred             CCCcEEEEEEEeeEECCCcEEEEeE-CCEE
Confidence            3567999999999 7865 578999 7775


No 132
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.63  E-value=0.00022  Score=33.76  Aligned_cols=29  Identities=28%  Similarity=0.623  Sum_probs=21.4

Q ss_pred             cCCCeEEEEeeEeee--cCC-eEEEEeCCCcE
Q psy4606          24 PEGGTIKLVCKAKGY--PRP-HITWKREDGQE   52 (69)
Q Consensus        24 ~~g~~~~l~C~~~g~--P~P-~~~W~~~~~~~   52 (69)
                      ..++.++|.|.+.|.  |.. .++|.++++..
T Consensus        12 ~~~~~~tLtC~v~gf~yP~~i~v~W~r~~~~~   43 (96)
T cd07696          12 LLTKSVKLTCLVTNLTSPEGVNVTWTRGSGEP   43 (96)
T ss_pred             ccCCCeEEEEEEeCCCCCCCcEEEEEECCeEe
Confidence            347889999999998  543 57999933333


No 133
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.62  E-value=0.00013  Score=34.07  Aligned_cols=28  Identities=18%  Similarity=0.388  Sum_probs=23.6

Q ss_pred             eEEecCCCeEEEEeeEeeecCCeEEEEeC
Q psy4606          20 DIMAPEGGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      .+...+|+.+.|.|.. +.|.|.+.|++.
T Consensus         5 ~~~~~eG~~v~L~C~~-~~p~p~v~Wykq   32 (91)
T cd05871           5 VVYGVENNSTFLECLP-KSPQASVKWLFQ   32 (91)
T ss_pred             EEEEecCCcEEEEEEC-CCCCceEEEEEE
Confidence            3457789999999996 589999999983


No 134
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=97.55  E-value=0.00034  Score=32.50  Aligned_cols=37  Identities=14%  Similarity=0.322  Sum_probs=29.3

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCCcEEEec
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~~~   56 (69)
                      ...+.+..|+.+.|.|...+. .+.+.|++ ++..+..+
T Consensus         3 ~~~~tv~~g~~v~L~C~~~s~-~A~v~W~~-ng~~l~~~   39 (85)
T cd05872           3 VKNRTVAPGADVVLPCQLRSN-LASPVWLF-NGTPLNAQ   39 (85)
T ss_pred             ceEEEEecCCCEEEECCCCCC-CccEEEEE-CCcccCCC
Confidence            345678899999999998774 66999999 77766543


No 135
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=97.54  E-value=0.00016  Score=31.65  Aligned_cols=18  Identities=44%  Similarity=1.049  Sum_probs=16.8

Q ss_pred             EEEEeeEeeec-CCeEEEE
Q psy4606          29 IKLVCKAKGYP-RPHITWK   46 (69)
Q Consensus        29 ~~l~C~~~g~P-~P~~~W~   46 (69)
                      +.|.|.+.+.| .+.+.|+
T Consensus        18 ~~l~C~~~~~~~~~~~~W~   36 (75)
T PF13927_consen   18 VTLTCSAEGGPPPPSISWY   36 (75)
T ss_dssp             EEEEEEESSEESSEEEEEE
T ss_pred             EEEEEEEccccCCeEEEEE
Confidence            99999999977 8899999


No 136
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=97.51  E-value=0.0013  Score=31.12  Aligned_cols=33  Identities=18%  Similarity=0.321  Sum_probs=27.4

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeCCC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKREDG   50 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~   50 (69)
                      .+++.+.+|+.+.|.|.+.+.....+.|++.+.
T Consensus         4 ~~nvtv~~G~ta~L~C~v~~~~~~~v~w~~~~~   36 (95)
T cd05881           4 TEDVTVVEGEVAIISCRVKNNDDSVIQLLNPNR   36 (95)
T ss_pred             cCceEEcCCCcEEEEEEEccCCccEEEEEecCC
Confidence            456788999999999999998778888987543


No 137
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=97.51  E-value=0.00028  Score=33.34  Aligned_cols=24  Identities=21%  Similarity=0.475  Sum_probs=19.9

Q ss_pred             cCCCeEEEEeeEe-eecCCeEEEEe
Q psy4606          24 PEGGTIKLVCKAK-GYPRPHITWKR   47 (69)
Q Consensus        24 ~~g~~~~l~C~~~-g~P~P~~~W~~   47 (69)
                      .......+.|.+. |+|.+.|+|++
T Consensus        13 ~~~~~~va~C~s~~gkP~a~ItW~~   37 (95)
T cd05719          13 GGEPVTVATCVSANGKPPATISWET   37 (95)
T ss_pred             CCCccEEEEEECCCCcCCCEEEEEe
Confidence            3455678999995 59999999998


No 138
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.46  E-value=0.00047  Score=33.01  Aligned_cols=30  Identities=17%  Similarity=0.489  Sum_probs=26.2

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      +..+.+.+|+.++|.|...+ +.+.+.|++.
T Consensus         5 p~~~~v~~G~~v~l~C~~~~-~~~~v~Wykq   34 (110)
T cd05899           5 PRYLIKGRGQSVTLRCSQTS-GHDNMYWYRQ   34 (110)
T ss_pred             CCceEEcCCCcEEEEEEECC-CCCEEEEEEE
Confidence            55678889999999999988 7889999984


No 139
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=97.35  E-value=0.00087  Score=32.32  Aligned_cols=31  Identities=26%  Similarity=0.615  Sum_probs=26.6

Q ss_pred             CceEEecCCCeEEEEeeEee--ecCCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKG--YPRPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g--~P~P~~~W~~~   48 (69)
                      +..+.+.+|+.++|.|...+  .+.+.+.|++.
T Consensus         5 p~~~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq   37 (116)
T cd04982           5 QLSITREESKSVTISCKVSGIDFSTTYIHWYRQ   37 (116)
T ss_pred             CCeEEeCCCCCEEEEEEEeCCCccccEEEEEEE
Confidence            55677889999999999987  78889999984


No 140
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=97.34  E-value=0.0007  Score=32.04  Aligned_cols=26  Identities=19%  Similarity=0.304  Sum_probs=20.8

Q ss_pred             ecCCCeEEEEeeEee-ecCCeEEEEeC
Q psy4606          23 APEGGTIKLVCKAKG-YPRPHITWKRE   48 (69)
Q Consensus        23 ~~~g~~~~l~C~~~g-~P~P~~~W~~~   48 (69)
                      ........+.|.+.| +|.+.++|++.
T Consensus        12 ~~~~~~~va~C~s~~gkPaa~IsW~~~   38 (95)
T cd07703          12 AGTIPVPVAKCVSANGRPPARISWSST   38 (95)
T ss_pred             cCCCccEEEEEEcCCCCCCcEEEEEcC
Confidence            344556899998874 99999999983


No 141
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.34  E-value=0.00073  Score=32.12  Aligned_cols=31  Identities=19%  Similarity=0.380  Sum_probs=27.0

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      +..+.+.+|+.+.|.|...+.+.+.+.|++.
T Consensus         5 ~~~v~~~~G~~v~L~C~~~~~~~~~v~W~k~   35 (109)
T cd04983           5 PQSLSVQEGENVTLNCNYSTSTFYYLFWYRQ   35 (109)
T ss_pred             CCceEEcCCCCEEEEEEECCCCccEEEEEEE
Confidence            5567788999999999999888889999983


No 142
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.29  E-value=0.0011  Score=31.51  Aligned_cols=31  Identities=16%  Similarity=0.423  Sum_probs=25.6

Q ss_pred             CceEEecCCCeEEEEeeEeeec-CCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYP-RPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P-~P~~~W~~~   48 (69)
                      +..+.+.+|+.++|.|.+.+.. ...+.|++.
T Consensus         7 p~~~~v~~G~~v~L~C~~~~~~~~~~~~Wyrq   38 (106)
T cd04980           7 PATLSVSPGESATISCKASQSVSSNYLAWYQQ   38 (106)
T ss_pred             CCcEEECCCCCEEEEEEECCCCCCCcEEEEEE
Confidence            5566788999999999998765 678999973


No 143
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.15  E-value=0.00098  Score=31.83  Aligned_cols=26  Identities=31%  Similarity=0.663  Sum_probs=20.9

Q ss_pred             CCCeEEEEeeEee-e-cCC-eEEEEeCCCc
Q psy4606          25 EGGTIKLVCKAKG-Y-PRP-HITWKREDGQ   51 (69)
Q Consensus        25 ~g~~~~l~C~~~g-~-P~P-~~~W~~~~~~   51 (69)
                      .+..++|.|.+.| + |.. .++|.+ +|.
T Consensus        18 ~~~~atLtClV~~f~~P~~i~V~W~~-~g~   46 (99)
T cd04986          18 LGSSASLTCTLSGLRDPEGAVFTWTP-SGG   46 (99)
T ss_pred             cCCccEEEEEEeccCCCCCeEEEEEE-CCc
Confidence            5778999999999 6 754 688998 554


No 144
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.03  E-value=0.0012  Score=31.20  Aligned_cols=35  Identities=17%  Similarity=0.246  Sum_probs=25.7

Q ss_pred             EEecCCCeEEEEeeE-ee----ecCCeEEEEeCCCcEEEec
Q psy4606          21 IMAPEGGTIKLVCKA-KG----YPRPHITWKREDGQEIIIK   56 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~-~g----~P~P~~~W~~~~~~~~~~~   56 (69)
                      ..+..+....|.|.- .+    .+.|.++|+| |++.+..+
T Consensus         5 ~~~~~~~~~~l~Cp~~~~f~~~~~~~~v~WYK-d~~~l~~~   44 (95)
T cd05897           5 QILFTSTSGKLVCPDLSDFTINRTDVELQWYK-DSVLLDKD   44 (95)
T ss_pred             eEeccccCcEEECCCHHHcccCCCCCcEEEcc-CCEECcCC
Confidence            345678899999973 33    3678999999 78776533


No 145
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.83  E-value=0.003  Score=29.65  Aligned_cols=27  Identities=30%  Similarity=0.564  Sum_probs=23.0

Q ss_pred             EecCCCeEEEEeeEeee-cCCeEEEEeC
Q psy4606          22 MAPEGGTIKLVCKAKGY-PRPHITWKRE   48 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g~-P~P~~~W~~~   48 (69)
                      .+.+|+.++|.|...+. +...+.|++.
T Consensus         2 ~v~~G~~v~L~C~~~~~~~~~~v~W~k~   29 (105)
T cd00099           2 SVSEGESVTLSCTYSGSFSSYYIFWYRQ   29 (105)
T ss_pred             eecCCCCEEEEEEEeCCcCcceEEEEEE
Confidence            45689999999999986 7788999983


No 146
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=96.82  E-value=0.0053  Score=28.51  Aligned_cols=30  Identities=23%  Similarity=0.479  Sum_probs=24.1

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEeCCCcE
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKREDGQE   52 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~~~~~~   52 (69)
                      ..+..|++++|.|.+. .+...+.|++ +|..
T Consensus        11 ~vV~~G~~VtL~C~~~-~~~~~f~l~k-~g~~   40 (91)
T cd05751          11 SVVPLGKPVTLRCQGP-YGAVEYRLYR-EGST   40 (91)
T ss_pred             CccCCCCcEEEEEecC-CCCCEEEEEE-CCCC
Confidence            3567899999999875 6788899998 5543


No 147
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=96.50  E-value=0.0091  Score=27.49  Aligned_cols=24  Identities=21%  Similarity=0.443  Sum_probs=19.0

Q ss_pred             CCeEEEEeeEeeecCC--eEEEEeCC
Q psy4606          26 GGTIKLVCKAKGYPRP--HITWKRED   49 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P--~~~W~~~~   49 (69)
                      |+.+.|.|.+.|.|.+  .+.|..++
T Consensus         1 Ge~~~L~C~~~~~~~~~~~~~W~~p~   26 (86)
T cd05862           1 GEKLVLNCTARTELNVGIDFQWDYPG   26 (86)
T ss_pred             CCcEEEEEEEEeCCCCcEEEEEEcCC
Confidence            6789999999986654  67998744


No 148
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=96.39  E-value=0.017  Score=27.04  Aligned_cols=35  Identities=17%  Similarity=0.312  Sum_probs=24.7

Q ss_pred             CEEeecCCCceEEecCCCeEEEEeeEeeecCCeEEEEeC
Q psy4606          10 PDILNEESSSDIMAPEGGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        10 p~~~~~~~~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      |.+...  + ...+..|++++|.|...- +.-.+.|+|+
T Consensus         2 P~l~a~--p-~~vV~~G~~VTL~C~~~~-~~~~f~l~k~   36 (94)
T cd05711           2 PFLSAH--P-SPVVPSGENVTLQCHSDI-RFDRFILYKE   36 (94)
T ss_pred             CEEEec--C-CCccCCCCeEEEEEecCC-CCCEEEEEEC
Confidence            444443  2 345678999999998754 5567899994


No 149
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=96.39  E-value=0.0099  Score=28.33  Aligned_cols=28  Identities=29%  Similarity=0.687  Sum_probs=21.9

Q ss_pred             EEecCCCeEEE-EeeEe-eecCCeEEEEeC
Q psy4606          21 IMAPEGGTIKL-VCKAK-GYPRPHITWKRE   48 (69)
Q Consensus        21 ~~~~~g~~~~l-~C~~~-g~P~P~~~W~~~   48 (69)
                      ..+.+|..+.+ .|.+. |+|.+.++|+.+
T Consensus        11 ~~~~~g~~~~vA~C~sa~gkPaa~IsW~~~   40 (97)
T cd07704          11 LLIDGGNGTTLAACCAAEGRPAADVTWETN   40 (97)
T ss_pred             eEeecCcceeEEEEEccCCccCCEeEEeCC
Confidence            44566777777 88885 599999999983


No 150
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=96.30  E-value=0.0097  Score=32.34  Aligned_cols=30  Identities=27%  Similarity=0.660  Sum_probs=24.6

Q ss_pred             ceEEecCCCeEEEEeeEeeecC-----------CeEEEEeC
Q psy4606          19 SDIMAPEGGTIKLVCKAKGYPR-----------PHITWKRE   48 (69)
Q Consensus        19 ~~~~~~~g~~~~l~C~~~g~P~-----------P~~~W~~~   48 (69)
                      ....+.+|+.+.|.|.+.+.|+           +.+.|+|.
T Consensus        30 ~~~~v~eGe~v~L~C~~~~~~~~~~~~~~~~~~~~V~W~k~   70 (227)
T PHA02826         30 TPVYAKFGDPMVLLCTGKHYKKSIFFDKTFITSYNVTWSKT   70 (227)
T ss_pred             ceEEecCCCCEEEEccccccccccccccccCCCccEEEEeC
Confidence            3467789999999999988664           48999994


No 151
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=96.27  E-value=0.0072  Score=28.29  Aligned_cols=27  Identities=15%  Similarity=0.454  Sum_probs=21.9

Q ss_pred             EecCCCeEEEEeeEeee--cCCeEEEEeC
Q psy4606          22 MAPEGGTIKLVCKAKGY--PRPHITWKRE   48 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g~--P~P~~~W~~~   48 (69)
                      .+.+|++++|.|...+.  ....+.|++.
T Consensus         2 ~v~~G~~v~l~C~~~~~~~~~~~i~Wy~q   30 (98)
T cd04984           2 SVSPGETVTITCTGSSGNISGNYVNWYQQ   30 (98)
T ss_pred             ccCCCCCEEEEEEEcCCCcCCCCEEEEEE
Confidence            45689999999998775  5678999984


No 152
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.10  E-value=0.025  Score=27.28  Aligned_cols=31  Identities=19%  Similarity=0.488  Sum_probs=24.6

Q ss_pred             CceEEecCCCeEEEEeeEee-ecCCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKG-YPRPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g-~P~P~~~W~~~   48 (69)
                      +..+.+..|..+.|.|.... .....+.|++.
T Consensus         6 ~~~v~~~~G~~v~L~C~~~~~~~~~~v~Wyrq   37 (116)
T cd07706           6 QPDVSVQVGEEVTLNCRYETSWTNYYIFWYKQ   37 (116)
T ss_pred             CCceEEcCCCCEEEEEEEeCCCCceEEEEEEE
Confidence            55677889999999999875 35567899983


No 153
>PHA02785 IL-beta-binding protein; Provisional
Probab=96.10  E-value=0.0062  Score=34.60  Aligned_cols=27  Identities=30%  Similarity=0.614  Sum_probs=23.3

Q ss_pred             EecCCCeEEEEeeE-----eeecCCeEEEEeC
Q psy4606          22 MAPEGGTIKLVCKA-----KGYPRPHITWKRE   48 (69)
Q Consensus        22 ~~~~g~~~~l~C~~-----~g~P~P~~~W~~~   48 (69)
                      ...+|..+.+.|.+     .|.|.|.++|+|.
T Consensus        37 ~~~~ge~~~l~C~~~~~~~~g~p~~~i~W~K~   68 (326)
T PHA02785         37 MELENEPVILPCPQINTLSSGYNILDILWEKR   68 (326)
T ss_pred             hhhcCCCEEEECCCccccccCCCCceEEEEEC
Confidence            35579999999997     6899999999993


No 154
>PHA03376 BARF1; Provisional
Probab=95.96  E-value=0.015  Score=31.17  Aligned_cols=25  Identities=24%  Similarity=0.828  Sum_probs=20.7

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCC
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDG   50 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~   50 (69)
                      -+...+.|.+.|+|.|.++|..+.|
T Consensus       139 ~~~~~i~C~sggfP~P~~~Wle~~~  163 (221)
T PHA03376        139 FSVLTVTCTVNAFPHPHVQWLMPEG  163 (221)
T ss_pred             CCeeEEEEecCCcCCchheeccccC
Confidence            5667899998889999999987444


No 155
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=95.95  E-value=0.022  Score=27.14  Aligned_cols=27  Identities=37%  Similarity=0.673  Sum_probs=21.5

Q ss_pred             EecCCCeEEEEeeEeee-cCCeEEEEeC
Q psy4606          22 MAPEGGTIKLVCKAKGY-PRPHITWKRE   48 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g~-P~P~~~W~~~   48 (69)
                      .+..|+.++|.|...+. ....+.|++.
T Consensus         2 ~v~~G~~vtL~C~~~~~~~~~~~~Wyrq   29 (107)
T cd07700           2 LVQTNNTVKLSCEAKGISENTRIYWLRW   29 (107)
T ss_pred             EEcCCCCEEEEEEEecCCCCCeEEEEEE
Confidence            46789999999998774 3457999984


No 156
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=95.87  E-value=0.023  Score=26.63  Aligned_cols=32  Identities=13%  Similarity=0.335  Sum_probs=24.1

Q ss_pred             EecCCCeEEEEeeEee--ecCCeEEEEeCCCcEE
Q psy4606          22 MAPEGGTIKLVCKAKG--YPRPHITWKREDGQEI   53 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g--~P~P~~~W~~~~~~~~   53 (69)
                      ....|++++|.|++..  .|.+.+.|..+.++.+
T Consensus        10 ~lL~G~sLtLtl~~~s~s~p~~~i~w~~P~n~~~   43 (88)
T cd07694          10 HVLSGTNLTLTLHGSSNSLPAFKVEWRGPGNKSK   43 (88)
T ss_pred             eeecCCcEEEEEecCCCCCCCccEEEeCCCCccc
Confidence            4567999999999965  4555999998655433


No 157
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=95.85  E-value=0.029  Score=32.36  Aligned_cols=21  Identities=24%  Similarity=0.651  Sum_probs=17.7

Q ss_pred             eEEEEeeEee-ecCC-eEEEEeC
Q psy4606          28 TIKLVCKAKG-YPRP-HITWKRE   48 (69)
Q Consensus        28 ~~~l~C~~~g-~P~P-~~~W~~~   48 (69)
                      .++|.|.|.| +|.. .+.|.++
T Consensus       216 ~~tL~C~A~GFYP~~I~v~W~kd  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVAAKWYNS  238 (338)
T ss_pred             CceEEEEEEeEeCCccEEEEEec
Confidence            6899999999 8875 5789993


No 158
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=95.75  E-value=0.031  Score=26.77  Aligned_cols=29  Identities=21%  Similarity=0.389  Sum_probs=22.7

Q ss_pred             ecCCCeEEEEeeEee-ecC--CeEEEEeCCCcE
Q psy4606          23 APEGGTIKLVCKAKG-YPR--PHITWKREDGQE   52 (69)
Q Consensus        23 ~~~g~~~~l~C~~~g-~P~--P~~~W~~~~~~~   52 (69)
                      ...|..+++.|.+.+ +|.  ..+.|++ +...
T Consensus        12 l~~G~~vtv~C~v~~v~P~~~l~v~Llk-G~~~   43 (99)
T cd07689          12 LEEGKPVTVKCEVPDVYPFDRLEIELLK-GETL   43 (99)
T ss_pred             ccCCceEEEEEEecCcccCCceEEEEec-Ccce
Confidence            357999999999987 877  6788987 4433


No 159
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=95.57  E-value=0.069  Score=24.99  Aligned_cols=30  Identities=23%  Similarity=0.527  Sum_probs=24.7

Q ss_pred             CceEEecCCCeEEEEeeEe-eecCCeEEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAK-GYPRPHITWKR   47 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~-g~P~P~~~W~~   47 (69)
                      +..+.+..|+.+.|.|... ......+.|++
T Consensus         8 ~~~v~~~~G~~v~L~C~~~~~~~~~~v~W~~   38 (114)
T PF07686_consen    8 PSPVTVQEGESVTLPCSYSSSSNQSSVYWYR   38 (114)
T ss_dssp             ESEEEEETTSEEEEEEEEESSSSGSEEEEEE
T ss_pred             CCeEEEecCCCEEEEEEEeCCCCcceEEEEE
Confidence            4556788999999999998 45667899998


No 160
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=95.41  E-value=0.025  Score=23.37  Aligned_cols=19  Identities=47%  Similarity=1.015  Sum_probs=16.5

Q ss_pred             EEEEeeEeeecCCeEEEEe
Q psy4606          29 IKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        29 ~~l~C~~~g~P~P~~~W~~   47 (69)
                      +.|.|.+.+.+.+.+.|++
T Consensus         1 ~~l~C~~~~~~~~~~~W~~   19 (74)
T cd00096           1 VTLTCLASGPPPPTITWLK   19 (74)
T ss_pred             CEEEEEecCCCCCcEEEEE
Confidence            3689999998888999998


No 161
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=95.35  E-value=0.032  Score=26.54  Aligned_cols=26  Identities=19%  Similarity=0.383  Sum_probs=20.7

Q ss_pred             ecCCCeEEEEeeEeeecCCeEEEEeC
Q psy4606          23 APEGGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        23 ~~~g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      +..|+.++|.|.....-...+.|++.
T Consensus         3 v~~G~~vtL~C~~~~~~~~~v~Wyrq   28 (104)
T cd05720           3 AELGQKVELKCEVLNSSPTGCSWLFQ   28 (104)
T ss_pred             ccCCCeEEEEEEecCCCCCcEEEEEe
Confidence            56799999999886654567899984


No 162
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=95.30  E-value=0.075  Score=25.87  Aligned_cols=31  Identities=32%  Similarity=0.668  Sum_probs=23.8

Q ss_pred             CceEEecCCCeEEEEeeEeeec--CCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYP--RPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P--~P~~~W~~~   48 (69)
                      +....+..|+.++|.|...+.-  ...+.|++.
T Consensus         4 ~~~~~v~~G~~vtL~C~~~~~~~~~~~~~WYkQ   36 (117)
T cd04981           4 SGPGLVKPGQSLKLSCKASGFTFTSYGVNWVRQ   36 (117)
T ss_pred             CCCeEEcCCCCEEEEEEEeCCCcccceEEEEEE
Confidence            4556788999999999876533  466899984


No 163
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=95.27  E-value=0.044  Score=25.92  Aligned_cols=24  Identities=33%  Similarity=0.761  Sum_probs=19.4

Q ss_pred             CCCeEEEEeeEeeec------CCeEEEEeC
Q psy4606          25 EGGTIKLVCKAKGYP------RPHITWKRE   48 (69)
Q Consensus        25 ~g~~~~l~C~~~g~P------~P~~~W~~~   48 (69)
                      .|++++|.|.....+      .+.+.|++.
T Consensus         1 ~G~~V~L~C~~~~~~~~~~~~~~~i~W~k~   30 (106)
T cd05714           1 LGGNVTLPCRFHLEPALSAPHGPRIKWTKL   30 (106)
T ss_pred             CCCCEEEeEEeECCcccCCCCCcEEEEEEe
Confidence            378999999987753      568999984


No 164
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=95.26  E-value=0.066  Score=25.87  Aligned_cols=30  Identities=20%  Similarity=0.483  Sum_probs=22.2

Q ss_pred             CceEEecCCCeEEEEeeEeeec----CCeEEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYP----RPHITWKR   47 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P----~P~~~W~~   47 (69)
                      +..+.+..|+.++|.|......    ...+.|++
T Consensus         5 p~~v~v~~G~~vtL~C~~s~~~~~~~~~~v~W~~   38 (116)
T cd05715           5 PREVYAVNGSDVRLKCTFSSSEPISDDISVTWSF   38 (116)
T ss_pred             CCeEEEEcCCCeEEEeEEeCCCCcCCceEEEEEE
Confidence            4456677899999999886532    25689986


No 165
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=95.22  E-value=0.054  Score=28.85  Aligned_cols=29  Identities=28%  Similarity=0.590  Sum_probs=24.6

Q ss_pred             eEEecCCCeEEEEeeEe-eecCCeEEEEeC
Q psy4606          20 DIMAPEGGTIKLVCKAK-GYPRPHITWKRE   48 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~-g~P~P~~~W~~~   48 (69)
                      ...+.+|+++.|.|.-. +...++++|.|.
T Consensus        24 ~v~V~ege~VtLsCs~t~s~~~~qVtWkK~   53 (189)
T PHA02987         24 KITVSEHVNVKISCNKTSSFNSILITWKKN   53 (189)
T ss_pred             EEEEcCCCCEEEEEecCCCCccceEEEEEc
Confidence            46788999999999984 667889999984


No 166
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=95.01  E-value=0.1  Score=25.32  Aligned_cols=30  Identities=27%  Similarity=0.481  Sum_probs=22.7

Q ss_pred             CceEEecCCCeEEEEeeEeeec----CCeEEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYP----RPHITWKR   47 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P----~P~~~W~~   47 (69)
                      +..+.+.+|+.+.|.|.....+    ...+.|++
T Consensus         5 ~~~v~~~~G~~v~L~C~~s~~~~~~~~~~i~W~~   38 (115)
T cd05880           5 SKEVEAVNGTDVRLKCTFSSSAPIGDTLVITWNF   38 (115)
T ss_pred             CceEEEEcCCCEEEEEEEEeCCCCCCcEEEEEEE
Confidence            5567788999999999876533    24699974


No 167
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=94.77  E-value=0.073  Score=25.90  Aligned_cols=24  Identities=21%  Similarity=0.430  Sum_probs=18.6

Q ss_pred             CCCeEEEEeeEeeec------------CCeEEEEeC
Q psy4606          25 EGGTIKLVCKAKGYP------------RPHITWKRE   48 (69)
Q Consensus        25 ~g~~~~l~C~~~g~P------------~P~~~W~~~   48 (69)
                      .|++++|.|.-....            .+.+.|+|.
T Consensus         1 ~G~~VtLpC~~~~~~~~~~~~~~~~~~~~~I~W~k~   36 (112)
T cd05900           1 LGSSLLIPCYFQDPIAKDPGAPTVAPLSPRIKWSFI   36 (112)
T ss_pred             CCCcEEEeeEEeCCcCccccccccCCCCCEEEEEEe
Confidence            378999999987532            468999984


No 168
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=94.70  E-value=0.076  Score=25.08  Aligned_cols=24  Identities=25%  Similarity=0.710  Sum_probs=18.7

Q ss_pred             CCCeEEEEeeEeeec------CCeEEEEeC
Q psy4606          25 EGGTIKLVCKAKGYP------RPHITWKRE   48 (69)
Q Consensus        25 ~g~~~~l~C~~~g~P------~P~~~W~~~   48 (69)
                      .|++++|.|.....|      ...+.|+|.
T Consensus         1 ~G~~vtL~C~~~~~~~~~~~~~~~v~W~k~   30 (106)
T cd05877           1 RGGNVTLPCRYHYEPELSAPRKIRVKWTKL   30 (106)
T ss_pred             CCCcEEEEeEeECCCcCCCCccceEEEEEe
Confidence            478999999887653      357999984


No 169
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=94.47  E-value=0.064  Score=23.79  Aligned_cols=27  Identities=30%  Similarity=0.622  Sum_probs=18.5

Q ss_pred             cCCCeEEEEeeEeeecCCeEEEEeCCCcEEE
Q psy4606          24 PEGGTIKLVCKAKGYPRPHITWKREDGQEII   54 (69)
Q Consensus        24 ~~g~~~~l~C~~~g~P~P~~~W~~~~~~~~~   54 (69)
                      ..|..|+|.|...+   ..+.|.+ ++..+.
T Consensus         5 isGTtVtlTCP~~~---~~i~W~~-n~~~~~   31 (65)
T cd07692           5 ISGTTVTVTCPLSG---DDIKWKK-NDQVSQ   31 (65)
T ss_pred             EeccEEEEECCCCC---CCceEEe-CCccCC
Confidence            35889999996542   2289999 554444


No 170
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=94.46  E-value=0.044  Score=25.05  Aligned_cols=23  Identities=22%  Similarity=0.345  Sum_probs=19.2

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~   48 (69)
                      |++++|.|.....+...+.|++.
T Consensus         1 G~~VtL~c~~~~~~~~~i~W~~~   23 (92)
T cd05741           1 GESVTLPVSNLPENLQEITWYKG   23 (92)
T ss_pred             CCcEEEEcccCCCCCEEEEEECC
Confidence            67899999987766678999984


No 171
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=94.33  E-value=0.096  Score=24.36  Aligned_cols=27  Identities=15%  Similarity=0.281  Sum_probs=21.8

Q ss_pred             EecCCCeEEEEeeEee-ecCCeEEEEeC
Q psy4606          22 MAPEGGTIKLVCKAKG-YPRPHITWKRE   48 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g-~P~P~~~W~~~   48 (69)
                      .+.+|++++|.|.... .....+.|++.
T Consensus         3 ~~~~G~~vtl~C~~~~~~~~~~~~W~r~   30 (98)
T cd05716           3 TGELGGSVTIPCPYPPKNRSYEKYWCKW   30 (98)
T ss_pred             EEEeCCeEEEEeeCCCCCCCcEeEeECC
Confidence            5678999999998765 45678899984


No 172
>KOG3515|consensus
Probab=94.11  E-value=0.071  Score=33.77  Aligned_cols=28  Identities=18%  Similarity=0.432  Sum_probs=24.1

Q ss_pred             EecCCCeEEEEeeEee-ecCCeEEEEeCC
Q psy4606          22 MAPEGGTIKLVCKAKG-YPRPHITWKRED   49 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g-~P~P~~~W~~~~   49 (69)
                      .+..|+.+.|.|.+.| .|.+.+.|++.+
T Consensus        18 ~~~~g~~v~l~C~v~~~pp~~~~eW~h~~   46 (741)
T KOG3515|consen   18 GLRLGEDVPLPCRVNSNPPEIDVEWYHST   46 (741)
T ss_pred             hhccCCcceeeeecCCCCCCcceEEEecC
Confidence            7788999999999998 567899999943


No 173
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=93.87  E-value=0.2  Score=24.23  Aligned_cols=30  Identities=13%  Similarity=0.369  Sum_probs=21.4

Q ss_pred             eEEecCCCeEEEEeeEe-----------eecCCeEEEEeCCC
Q psy4606          20 DIMAPEGGTIKLVCKAK-----------GYPRPHITWKREDG   50 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~-----------g~P~P~~~W~~~~~   50 (69)
                      ...+.+|+.+.|.|...           ......+.|+| ++
T Consensus         9 ~~~~~~GE~v~l~C~~~~~~~~~~~~~~~~~~~~v~WyK-~~   49 (104)
T cd05896           9 KYMVLAGEPVRIKCALFYGYIRTNYSMAQSAGLSLMWYK-SS   49 (104)
T ss_pred             eEEEcCCCeEEEECCCccccccccccccccCCceEEEEE-CC
Confidence            35677899999999861           12234789999 54


No 174
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=93.11  E-value=0.36  Score=23.44  Aligned_cols=31  Identities=16%  Similarity=0.266  Sum_probs=22.1

Q ss_pred             CceEEecCCCeEEEEeeEeeec------CCeEEEEeC
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYP------RPHITWKRE   48 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P------~P~~~W~~~   48 (69)
                      +..+.+.+|+.++|.|.-....      .-.+.|++.
T Consensus         6 P~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~~~Wykq   42 (119)
T cd05712           6 PKSVSVQEGLCVLIPCSFSYPADWPVSNGVHGIWYKG   42 (119)
T ss_pred             CCEEEEeccccEEEEEEeeCcccccCCCceEEEEEeC
Confidence            5556778999999999754211      245889984


No 175
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=92.88  E-value=0.27  Score=23.66  Aligned_cols=24  Identities=25%  Similarity=0.505  Sum_probs=18.6

Q ss_pred             CCCeEEEEeeEeeec----------CCeEEEEeC
Q psy4606          25 EGGTIKLVCKAKGYP----------RPHITWKRE   48 (69)
Q Consensus        25 ~g~~~~l~C~~~g~P----------~P~~~W~~~   48 (69)
                      .|++++|.|.....+          ...+.|+|.
T Consensus         1 ~G~~V~LpC~~~~~~~~~~~~~~~~~~~i~W~k~   34 (110)
T cd05878           1 LSSSVLLPCYFTLPPALPPPSNAPESPRIKWTKL   34 (110)
T ss_pred             CCCCEEEeeEeeCCccccccccCCCCCEEEEEEe
Confidence            378999999997644          256899984


No 176
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=92.23  E-value=0.58  Score=22.90  Aligned_cols=30  Identities=17%  Similarity=0.388  Sum_probs=22.2

Q ss_pred             CceEEecCCCeEEEEeeEeee----cCCeEEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGY----PRPHITWKR   47 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~----P~P~~~W~~   47 (69)
                      +..+.+..|+.+.|.|.....    +...+.|.+
T Consensus         5 ~~ev~a~~G~~v~L~C~f~~~~~~~~~~~v~W~~   38 (116)
T cd05879           5 DREVYGTVGSDVTLSCSFWSSEWISDDISFTWHY   38 (116)
T ss_pred             cceEEEEcCCcEEEEEEEecCCCCCCcEEEEEEE
Confidence            344566789999999999763    346899954


No 177
>PHA03052 Hypothetical protein; Provisional
Probab=92.22  E-value=0.55  Score=21.02  Aligned_cols=35  Identities=20%  Similarity=0.512  Sum_probs=25.9

Q ss_pred             CceEEecCCCeEEEEeeEe-eec--CCeEEEEeCCCcEE
Q psy4606          18 SSDIMAPEGGTIKLVCKAK-GYP--RPHITWKREDGQEI   53 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~-g~P--~P~~~W~~~~~~~~   53 (69)
                      |..+.+..|+.+++.|++. |.|  .+.+.|.- ++..+
T Consensus         4 P~~i~~slGs~ltI~Ckv~lg~g~~~a~V~W~~-N~~~~   41 (69)
T PHA03052          4 PEGIVTSLGSNLTITCKVSLRPPTTDADVFWIS-NGMYY   41 (69)
T ss_pred             CccEEEEccCCceEeEEEEecCCCcceEEEEEe-CCcEE
Confidence            3456677899999999994 444  46788987 66666


No 178
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=92.14  E-value=0.53  Score=23.24  Aligned_cols=28  Identities=18%  Similarity=0.292  Sum_probs=20.6

Q ss_pred             EEecCCCeEEEEeeEeeecCC---eEEEEeC
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRP---HITWKRE   48 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P---~~~W~~~   48 (69)
                      ..+..++.++|.|.+.|.-..   .+.|.|.
T Consensus         8 ~lv~p~~sv~LsC~~sg~~~s~e~~~~wvRq   38 (115)
T cd05721           8 VLASSNGAASLVCEYTYNGFSKEFRASLLKG   38 (115)
T ss_pred             eEEcCCCCEEEEEEecCCccccEEEEEEEEe
Confidence            445567889999999884433   5789884


No 179
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=91.62  E-value=0.14  Score=23.99  Aligned_cols=25  Identities=24%  Similarity=0.344  Sum_probs=19.3

Q ss_pred             cCCCeEEEEeeEee-ecCCeEEEEeC
Q psy4606          24 PEGGTIKLVCKAKG-YPRPHITWKRE   48 (69)
Q Consensus        24 ~~g~~~~l~C~~~g-~P~P~~~W~~~   48 (69)
                      ..|+.++|.|.... .....+.|++.
T Consensus         2 ~~G~sVtL~c~~~~~~~~~~v~W~~~   27 (97)
T cd05775           2 ILGGSVTLPLNIPDGTEIESITWSFN   27 (97)
T ss_pred             ccCCeEEEeCCCCCCcEEEEEEEecC
Confidence            36899999998754 55567899983


No 180
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=91.21  E-value=0.32  Score=23.27  Aligned_cols=25  Identities=20%  Similarity=0.615  Sum_probs=19.0

Q ss_pred             CeEEEEeeE-eeecCCeEEEEeC-CCc
Q psy4606          27 GTIKLVCKA-KGYPRPHITWKRE-DGQ   51 (69)
Q Consensus        27 ~~~~l~C~~-~g~P~P~~~W~~~-~~~   51 (69)
                      ..+...|.+ .|+|.+.++|... +|+
T Consensus        21 ~v~VA~CiSa~GrPpa~ItW~t~l~G~   47 (98)
T cd05890          21 KMLVATCVSANGKPPSVVRWDTRLKGE   47 (98)
T ss_pred             eEEEEEEEcCCCcCCcEeEEEccCCCc
Confidence            456788995 6799999999863 343


No 181
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=91.09  E-value=0.31  Score=22.47  Aligned_cols=22  Identities=18%  Similarity=0.365  Sum_probs=16.6

Q ss_pred             CeEEEEeeEeeec---CCeEEEEeC
Q psy4606          27 GTIKLVCKAKGYP---RPHITWKRE   48 (69)
Q Consensus        27 ~~~~l~C~~~g~P---~P~~~W~~~   48 (69)
                      +++.|.|.....+   ...+.|+|.
T Consensus         1 ~~v~L~C~~~~~~~~~~~~v~W~k~   25 (98)
T cd05718           1 ESVTLECSFPVPGPVQITQVTWMKI   25 (98)
T ss_pred             CCEEEEeEeeCCCCceEEEEEEeeE
Confidence            3689999987744   447899984


No 182
>smart00406 IGv Immunoglobulin V-Type.
Probab=90.53  E-value=0.62  Score=20.33  Aligned_cols=21  Identities=33%  Similarity=0.876  Sum_probs=15.4

Q ss_pred             eEEEEeeEeeecCC--eEEEEeC
Q psy4606          28 TIKLVCKAKGYPRP--HITWKRE   48 (69)
Q Consensus        28 ~~~l~C~~~g~P~P--~~~W~~~   48 (69)
                      .+.|.|.......+  .+.|++.
T Consensus         1 ~v~l~C~~~~~~~~~~~v~W~~~   23 (81)
T smart00406        1 SVTLSCKASGFTFSSYYVSWVRQ   23 (81)
T ss_pred             CEEEEEEEeccccceeEEEEEEe
Confidence            36899988775544  7889883


No 183
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=90.38  E-value=0.84  Score=21.18  Aligned_cols=23  Identities=22%  Similarity=0.433  Sum_probs=15.3

Q ss_pred             CCeEEEEeeEeeecC---CeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPR---PHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~---P~~~W~~~   48 (69)
                      |+++.|.|...+...   ..+.|++.
T Consensus         1 G~~v~L~C~~~~~~~~~~~~v~W~k~   26 (100)
T cd05713           1 GEDAELPCHLSPKMSAEHMEVRWFRS   26 (100)
T ss_pred             CCcEEEEeEEcCCCCCCeeEEEEEEC
Confidence            578899998753211   35778874


No 184
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=90.14  E-value=0.45  Score=22.88  Aligned_cols=24  Identities=21%  Similarity=0.520  Sum_probs=19.0

Q ss_pred             EecCCCeEEEEeeEeeecCC--eEEEEe
Q psy4606          22 MAPEGGTIKLVCKAKGYPRP--HITWKR   47 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g~P~P--~~~W~~   47 (69)
                      .+.+|+++.|.|..  .|..  .+.|+|
T Consensus         9 ~~~~G~~V~L~v~~--~p~~~~~~~W~k   34 (105)
T cd05774           9 QVAEGENVLLLVHN--LPENLLAYAWYK   34 (105)
T ss_pred             cccCCCCEEEEecC--CCCCceEEEEEc
Confidence            45679999999864  5655  899999


No 185
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=89.85  E-value=0.81  Score=22.21  Aligned_cols=23  Identities=26%  Similarity=0.561  Sum_probs=17.0

Q ss_pred             CCeEEEEeeEeeec-------CCeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYP-------RPHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P-------~P~~~W~~~   48 (69)
                      |+++.|.|.-.-.|       .+.+.|.+.
T Consensus         2 ~~~v~LpC~~~~~p~~~~~~~~~~I~W~k~   31 (110)
T cd05902           2 SSSVLLPCVFTLPPSASSPPEGPRIKWTKL   31 (110)
T ss_pred             CCcEEEeeEEEcCccccCCCCCCEEEEEEe
Confidence            68899999955322       478999973


No 186
>PHA03269 envelope glycoprotein C; Provisional
Probab=89.78  E-value=2  Score=26.54  Aligned_cols=44  Identities=20%  Similarity=0.261  Sum_probs=30.3

Q ss_pred             EEcCCEEeecCCCceEEecCCCeEEEEeeEee-ecC--CeEEEEeCCCcEEE
Q psy4606           6 VVVPPDILNEESSSDIMAPEGGTIKLVCKAKG-YPR--PHITWKREDGQEII   54 (69)
Q Consensus         6 V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g-~P~--P~~~W~~~~~~~~~   54 (69)
                      +..+|.+...    ...+.+|+.....|.+.. +|.  -.+.|+. |+..+.
T Consensus       326 ~yr~PsVsV~----p~PVL~Ge~YkAtC~vA~YYPp~SvrlrWf~-ng~~V~  372 (566)
T PHA03269        326 SYKRPNITVI----GDPVLLGNPYAAYCKVNKYYPPHSVIVKWTS-NFGNIG  372 (566)
T ss_pred             EecCCCcccc----CCccccCCCceEEEEeeeecCCCceEEEEEe-CCcccC
Confidence            3356655433    234668999999999998 664  3578999 666654


No 187
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=89.26  E-value=0.72  Score=21.47  Aligned_cols=23  Identities=26%  Similarity=0.634  Sum_probs=16.1

Q ss_pred             CCeEEEEeeEeeecC-CeEEEEeC
Q psy4606          26 GGTIKLVCKAKGYPR-PHITWKRE   48 (69)
Q Consensus        26 g~~~~l~C~~~g~P~-P~~~W~~~   48 (69)
                      |++++|.|.-..... -.+.|+|.
T Consensus         1 G~~vtL~C~~~~~~~~~~v~W~k~   24 (97)
T cd05846           1 GGNVTLSCNLTLPEEVLQVTWQKI   24 (97)
T ss_pred             CCcEEEEEEeCCCCeeEEEEEEEc
Confidence            678999998544322 26899984


No 188
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=88.78  E-value=1.5  Score=20.23  Aligned_cols=24  Identities=38%  Similarity=0.534  Sum_probs=19.1

Q ss_pred             eEEEEeeEeeecCCeEEEEeCCCcEE
Q psy4606          28 TIKLVCKAKGYPRPHITWKREDGQEI   53 (69)
Q Consensus        28 ~~~l~C~~~g~P~P~~~W~~~~~~~~   53 (69)
                      ...|.+++.|. .+.+.|+- ||+.+
T Consensus        31 ~~~l~l~a~~~-~~~~~W~v-dg~~~   54 (89)
T PF06832_consen   31 RQPLVLKAAGG-RGPVYWFV-DGEPL   54 (89)
T ss_pred             cceEEEEEeCC-CCcEEEEE-CCEEc
Confidence            66777777776 56999999 88887


No 189
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=84.77  E-value=2.9  Score=19.59  Aligned_cols=34  Identities=24%  Similarity=0.462  Sum_probs=23.0

Q ss_pred             eEEecCCCeEEEEeeEee--e---cCCeEEEEeCCCcEEE
Q psy4606          20 DIMAPEGGTIKLVCKAKG--Y---PRPHITWKREDGQEII   54 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~g--~---P~P~~~W~~~~~~~~~   54 (69)
                      ...+..|+.++..|...-  .   ....+.|.. +++.++
T Consensus        12 ~pvv~lGS~vtasC~l~~~c~~~~~a~~I~Wkl-n~~~iP   50 (89)
T PF06328_consen   12 SPVVSLGSNVTASCVLKQNCSHSVNASQIVWKL-NGEKIP   50 (89)
T ss_dssp             SSEEETTS-EEEEEEE-CCCHCT-STTCEEEEC-SSCEST
T ss_pred             CCEEeCCCCEEEEEEEECCCCCCcccceEEEEE-CCEECC
Confidence            345668999999999853  2   567899998 666443


No 190
>KOG3515|consensus
Probab=84.61  E-value=3.7  Score=26.62  Aligned_cols=46  Identities=35%  Similarity=0.777  Sum_probs=30.9

Q ss_pred             EEEEcCCEEeecCCCceEEecCCCeEEEEeeEe--eecCCeEEEEeCCCcE
Q psy4606           4 LDVVVPPDILNEESSSDIMAPEGGTIKLVCKAK--GYPRPHITWKREDGQE   52 (69)
Q Consensus         4 l~V~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~--g~P~P~~~W~~~~~~~   52 (69)
                      +.|.++|.....  ........+..+.+.|.+.  +.|.+.+.|.. +...
T Consensus        92 l~v~~~pa~~~~--~~e~~~~~~~vvqi~c~~~~~~~P~~nlrW~~-n~r~  139 (741)
T KOG3515|consen   92 LDVDYPPACLPE--LGEIFQVDKGVVQIICSAKVAGRPNPNLRWGF-NNRA  139 (741)
T ss_pred             eccccCcccccc--ccchhhhcCCeEEEEEeecCCCCCCcceeeee-ccEE
Confidence            445566654433  3344566788999999554  48889999998 5543


No 191
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=83.83  E-value=3.4  Score=20.47  Aligned_cols=22  Identities=27%  Similarity=0.754  Sum_probs=17.0

Q ss_pred             CCeEEEEeeEeeecC-----------CeEEEEe
Q psy4606          26 GGTIKLVCKAKGYPR-----------PHITWKR   47 (69)
Q Consensus        26 g~~~~l~C~~~g~P~-----------P~~~W~~   47 (69)
                      +++++|.|...-.|.           +.+.|.+
T Consensus         2 ~g~v~LPC~f~~~p~~p~~~~~~~~~~rIkW~~   34 (117)
T cd05901           2 SGSVVLPCRFSTLPTLPPSVITTSEFLRIKWTK   34 (117)
T ss_pred             CCCEEEeeEEEecCCCCCcccCCCCCcEEEEEE
Confidence            678999999985542           3889987


No 192
>PHA03273 envelope glycoprotein C; Provisional
Probab=80.82  E-value=11  Score=23.33  Aligned_cols=43  Identities=16%  Similarity=0.361  Sum_probs=30.5

Q ss_pred             EcCCEEeecCCCceEEecCCCeEEEEeeEee-ecC--CeEEEEeCCCcEEE
Q psy4606           7 VVPPDILNEESSSDIMAPEGGTIKLVCKAKG-YPR--PHITWKREDGQEII   54 (69)
Q Consensus         7 ~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g-~P~--P~~~W~~~~~~~~~   54 (69)
                      ..+|.+...    ...+.+|+.....|.+.. +|.  -.+.|++ |+..+.
T Consensus       235 yr~Psvsv~----~~PvL~Ge~y~A~C~aa~YYPp~Sv~~rWf~-dg~~V~  280 (486)
T PHA03273        235 YNAPLVDLS----VHPSLKGENYRAVCVVASYFPHSSVKLRWYK-NAKEVD  280 (486)
T ss_pred             ecCCccccc----CCccccCCCceEEEEeeeecCCCceEEEEEe-CCeecc
Confidence            356665443    224568999999999998 664  3678999 777665


No 193
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=80.36  E-value=3.1  Score=19.55  Aligned_cols=22  Identities=27%  Similarity=0.567  Sum_probs=15.3

Q ss_pred             CeEEEEeeEeeec---CCeEEEEeC
Q psy4606          27 GTIKLVCKAKGYP---RPHITWKRE   48 (69)
Q Consensus        27 ~~~~l~C~~~g~P---~P~~~W~~~   48 (69)
                      .++.|.|.-...+   ...+.|+|.
T Consensus         1 ~~v~L~C~~~~~~~~~~~~v~W~k~   25 (100)
T cd05888           1 GDTRLPCRYNVSDGETVVQVLWIRE   25 (100)
T ss_pred             CCEEEEeEEecCCCCcEEEEEEEEc
Confidence            3688999876433   347889984


No 194
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=79.59  E-value=2.4  Score=20.05  Aligned_cols=21  Identities=19%  Similarity=0.420  Sum_probs=15.3

Q ss_pred             eEEEEeeEee-ecCCeEEEEeC
Q psy4606          28 TIKLVCKAKG-YPRPHITWKRE   48 (69)
Q Consensus        28 ~~~l~C~~~g-~P~P~~~W~~~   48 (69)
                      ++.|.|.-.. ....+++|.|.
T Consensus         2 ~vtL~C~~~~~~~~~qV~W~k~   23 (96)
T cd05889           2 KMKLECVYPKTGVLIQVSWTKH   23 (96)
T ss_pred             CEEEEeEcCCCCcEEEEEEEEc
Confidence            5788998754 34578889984


No 195
>KOG4597|consensus
Probab=78.17  E-value=1.3  Score=27.26  Aligned_cols=30  Identities=13%  Similarity=0.213  Sum_probs=26.1

Q ss_pred             CceEEecCCCeEEEEeeEeeecCCeEEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      +....+..++...+.|-+.|.|.|.|+|.+
T Consensus       203 pa~w~vg~wetcS~tCg~~G~q~r~V~c~q  232 (560)
T KOG4597|consen  203 PAEWFVGDWETCSSTCGVQGRQYRVVTCEQ  232 (560)
T ss_pred             cchhhcccchhhcccccccCCcCceeeeeh
Confidence            444567789999999999999999999986


No 196
>PHA03112 IL-18 binding protein; Provisional
Probab=74.11  E-value=9.6  Score=19.65  Aligned_cols=28  Identities=18%  Similarity=0.490  Sum_probs=21.5

Q ss_pred             EecCCCeEEEEeeEee-ecC-CeEEEEeCC
Q psy4606          22 MAPEGGTIKLVCKAKG-YPR-PHITWKRED   49 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g-~P~-P~~~W~~~~   49 (69)
                      ...+++.+.|.|.+-+ .|. ..+.|...+
T Consensus        34 p~k~~~~vvL~C~gcs~fp~fS~lYWl~gn   63 (141)
T PHA03112         34 PTKETEKVVLECRGCSYFPKFSYVYWLIGN   63 (141)
T ss_pred             ccCCCCEEEEEEECccCCCCceEEEEEcCC
Confidence            3456889999999987 575 678899633


No 197
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=73.13  E-value=5.2  Score=18.94  Aligned_cols=22  Identities=14%  Similarity=0.424  Sum_probs=15.5

Q ss_pred             CeEEEEeeEee-ecCCeEEEEeC
Q psy4606          27 GTIKLVCKAKG-YPRPHITWKRE   48 (69)
Q Consensus        27 ~~~~l~C~~~g-~P~P~~~W~~~   48 (69)
                      +++.|.|.-.. ....+++|.|.
T Consensus         1 ~~vtL~C~~~~~~~~~qV~W~k~   23 (96)
T cd05887           1 KNVTLKCRIQVNETITQSSWEKI   23 (96)
T ss_pred             CCEEEEEEecCCCcEEEEEEEEc
Confidence            36889998764 23357899883


No 198
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=69.20  E-value=9.1  Score=17.26  Aligned_cols=22  Identities=32%  Similarity=0.699  Sum_probs=15.5

Q ss_pred             CCeEEEEeeEeeecCCeEEEEeCCCcE
Q psy4606          26 GGTIKLVCKAKGYPRPHITWKREDGQE   52 (69)
Q Consensus        26 g~~~~l~C~~~g~P~P~~~W~~~~~~~   52 (69)
                      .+.+.|.|.+    .-.++|++ +...
T Consensus         6 ~~~V~L~C~~----~tsi~W~k-G~~~   27 (69)
T cd07691           6 EGKVFLKCNG----ATNITWKK-GKEI   27 (69)
T ss_pred             CceEEEEecC----CCcEEEec-Cccc
Confidence            4578999976    24599998 5533


No 199
>PHA03270 envelope glycoprotein C; Provisional
Probab=64.53  E-value=31  Score=21.34  Aligned_cols=42  Identities=24%  Similarity=0.474  Sum_probs=29.4

Q ss_pred             cCCEEeecCCCceEEecCCCeEEEEeeEee-ecC--CeEEEEeCCCcEEE
Q psy4606           8 VPPDILNEESSSDIMAPEGGTIKLVCKAKG-YPR--PHITWKREDGQEII   54 (69)
Q Consensus         8 ~~p~~~~~~~~~~~~~~~g~~~~l~C~~~g-~P~--P~~~W~~~~~~~~~   54 (69)
                      .+|.+...+    ..+.+|+.....|.+.. +|.  -.+.|++ |+..+.
T Consensus       220 r~Psvsv~~----~PvL~Ge~Y~AtC~va~YYPp~Sv~lrWf~-ng~~V~  264 (466)
T PHA03270        220 RRPSLSIRP----HAVLEGEPFGATCVAANYYPGDRAAFRWFE-GGDEVF  264 (466)
T ss_pred             cCCcccccC----CccccCCCceEEEEeeeecCCCceEEEEEe-CCcccc
Confidence            566654431    24568999999999998 664  3678999 676653


No 200
>PHA03271 envelope glycoprotein C; Provisional
Probab=61.20  E-value=37  Score=21.05  Aligned_cols=32  Identities=22%  Similarity=0.541  Sum_probs=25.1

Q ss_pred             EecCCCeEEEEeeEee-ecC--CeEEEEeCCCcEEE
Q psy4606          22 MAPEGGTIKLVCKAKG-YPR--PHITWKREDGQEII   54 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g-~P~--P~~~W~~~~~~~~~   54 (69)
                      .+..|+.....|.+.. +|.  -.+.|+. ||..+.
T Consensus       256 PVL~Ge~YkAtC~vAnYYPP~SvrlrWf~-nG~~V~  290 (490)
T PHA03271        256 PVLSGENYKASCIVRHFYPPGSVYVSWRQ-NGNIAT  290 (490)
T ss_pred             ccccCCCceEEEEeeeecCCCceEEEEEe-CCcccc
Confidence            4568999999999998 664  3578999 777654


No 201
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=61.15  E-value=8.9  Score=21.91  Aligned_cols=18  Identities=17%  Similarity=0.414  Sum_probs=13.5

Q ss_pred             cCCeEEEEeCCCcEEEec
Q psy4606          39 PRPHITWKREDGQEIIIK   56 (69)
Q Consensus        39 P~P~~~W~~~~~~~~~~~   56 (69)
                      ..|.+.|..++|+.+...
T Consensus        11 iDP~y~W~GP~g~~l~gn   28 (271)
T PF07354_consen   11 IDPTYLWTGPNGKPLSGN   28 (271)
T ss_pred             CCCceEEECCCCcccCCC
Confidence            568999998777776543


No 202
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=57.75  E-value=20  Score=16.96  Aligned_cols=21  Identities=24%  Similarity=0.608  Sum_probs=14.2

Q ss_pred             eEEEEeeEee-ecCC---eEEEEeC
Q psy4606          28 TIKLVCKAKG-YPRP---HITWKRE   48 (69)
Q Consensus        28 ~~~l~C~~~g-~P~P---~~~W~~~   48 (69)
                      .+.|.|.-.. .|..   ++.|.+.
T Consensus         2 ~v~L~C~f~~~~~~~~~~~V~W~k~   26 (99)
T cd05886           2 DVVLHCSFINPLPPVKITQVTWQKL   26 (99)
T ss_pred             cEEEEeEeecCCCCCCeEEEEEEEC
Confidence            5789998864 2221   6899873


No 203
>KOG1480|consensus
Probab=53.88  E-value=3.2  Score=27.16  Aligned_cols=37  Identities=22%  Similarity=0.452  Sum_probs=28.0

Q ss_pred             CceEEecCCCeEEEEeeE-eeecCCeEEEEeCCCcEEEe
Q psy4606          18 SSDIMAPEGGTIKLVCKA-KGYPRPHITWKREDGQEIII   55 (69)
Q Consensus        18 ~~~~~~~~g~~~~l~C~~-~g~P~P~~~W~~~~~~~~~~   55 (69)
                      +....+..++.+.+.|.. .|.|...+.|++ ++..+..
T Consensus       136 p~~q~V~~~s~~~l~cr~pe~~paae~~w~k-~e~~~~p  173 (909)
T KOG1480|consen  136 PVGQEVQEETTLQLPCRPPEGDPKAEVEWLK-NEVVIDP  173 (909)
T ss_pred             hhhheecccccccccccCcccchhhhhhccc-cCCCCCc
Confidence            444556677888888877 689999999999 6766655


No 204
>KOG1026|consensus
Probab=53.81  E-value=10  Score=24.95  Aligned_cols=27  Identities=33%  Similarity=0.679  Sum_probs=24.3

Q ss_pred             EEecCCCeEEEEeeEeeecCCeEEEEe
Q psy4606          21 IMAPEGGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      ..+..+..+++.|.+.|.|.|.+.|+.
T Consensus       202 ~~v~~~~~~~~~c~~~~~~vp~~~~~~  228 (774)
T KOG1026|consen  202 LTVEEGSSITLKCSQAGIPVPCHYWFP  228 (774)
T ss_pred             hhhcccchheeeeecccCCCcceeeec
Confidence            456778999999999999999999987


No 205
>KOG3743|consensus
Probab=39.07  E-value=54  Score=21.02  Aligned_cols=26  Identities=27%  Similarity=0.569  Sum_probs=19.7

Q ss_pred             EecCCCeEEEEeeEeeecCCeEEEEe
Q psy4606          22 MAPEGGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      .+.-|..+.|.|.++|.-.|.+.-.|
T Consensus       379 ~i~ygsvV~LV~~vTG~~lppLIIRK  404 (622)
T KOG3743|consen  379 YIKYGSVVKLVCSVTGITLPPLIIRK  404 (622)
T ss_pred             ceeeccEEEEEeecccccCCcceeee
Confidence            35568899999999997666655544


No 206
>COG3908 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.44  E-value=36  Score=15.37  Aligned_cols=13  Identities=31%  Similarity=0.692  Sum_probs=10.0

Q ss_pred             EEEeeEeeecCCe
Q psy4606          30 KLVCKAKGYPRPH   42 (69)
Q Consensus        30 ~l~C~~~g~P~P~   42 (69)
                      ...|.++|.|.|-
T Consensus        30 fV~CAVtgk~IPl   42 (77)
T COG3908          30 FVLCAVTGKPIPL   42 (77)
T ss_pred             EEEEEecCCcccH
Confidence            4579999988873


No 207
>PF09270 BTD:  Beta-trefoil DNA-binding domain;  InterPro: IPR015350 This DNA-binding domain adopt a beta-trefoil fold, that is, a capped beta-barrel with internal pseudo threefold symmetry. In the DNA-binding protein LAG-1, it also is the site of mutually exclusive interactions with NotchIC (and the viral protein EBNA2) and corepressors (SMRT/N-Cor and CIR) []. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2FO1_A 3NBN_A 2F8X_C 3V79_C 3IAG_C 3BRG_C.
Probab=34.28  E-value=34  Score=18.08  Aligned_cols=26  Identities=27%  Similarity=0.556  Sum_probs=18.4

Q ss_pred             EecCCCeEEEEeeEeeecCCeEEEEe
Q psy4606          22 MAPEGGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        22 ~~~~g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      ...-|+.+.|.|..+|.-.|.+.-.|
T Consensus        69 ~I~YGs~V~Lv~~~TGv~sppliIRK   94 (158)
T PF09270_consen   69 YIHYGSTVVLVCSVTGVSSPPLIIRK   94 (158)
T ss_dssp             B-BTTSEEEEEETTT-EBEEEEEEEE
T ss_pred             ceecCCEEEEEECCCCcccCceEEEE
Confidence            34569999999999997766665544


No 208
>PF10738 Lpp-LpqN:  Probable lipoprotein LpqN;  InterPro: IPR019674  This protein is conserved in Mycobacteriaceae and is likely to be a lipoprotein []. 
Probab=31.97  E-value=74  Score=17.02  Aligned_cols=30  Identities=20%  Similarity=0.625  Sum_probs=16.8

Q ss_pred             eeecCCeEE--EEeCCCcEEEecCCcEEEeCCC
Q psy4606          36 KGYPRPHIT--WKREDGQEIIIKEGNTMVPKSK   66 (69)
Q Consensus        36 ~g~P~P~~~--W~~~~~~~~~~~~~~~~~~~~~   66 (69)
                      .|+|.-.+.  |.+ ++..+....+..+....+
T Consensus       110 ~GfpS~~i~GtY~~-~g~~~~~~~r~VV~~~~~  141 (175)
T PF10738_consen  110 SGFPSSQIEGTYDK-DGMRLHTSQRTVVIPGDD  141 (175)
T ss_pred             CCCceeEEEEEEee-CCEEeEeEEEEEEEeCCC
Confidence            467777664  777 676655444334444333


No 209
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=27.51  E-value=83  Score=16.06  Aligned_cols=30  Identities=17%  Similarity=0.370  Sum_probs=16.9

Q ss_pred             ecCCCeEEEEeeEeee-cC----CeEEEEeCCCcEE
Q psy4606          23 APEGGTIKLVCKAKGY-PR----PHITWKREDGQEI   53 (69)
Q Consensus        23 ~~~g~~~~l~C~~~g~-P~----P~~~W~~~~~~~~   53 (69)
                      ..-.+.+.|.|.+... ..    =.+.|.. ++..+
T Consensus        24 t~CN~tV~IPC~v~n~~~~ni~~m~VkWk~-~~~~I   58 (130)
T PF08204_consen   24 TVCNDTVVIPCFVNNLEANNISEMYVKWKF-KNKDI   58 (130)
T ss_dssp             -TT-SEEEE--BBSS---SSGGGEEEEEEE-TTEEE
T ss_pred             EecCCCEEEEeEeccccccccceEEEEEEE-CCeEE
Confidence            3457889999999752 22    2478998 66554


No 210
>PHA02982 hypothetical protein; Provisional
Probab=26.69  E-value=1.3e+02  Score=17.05  Aligned_cols=35  Identities=26%  Similarity=0.397  Sum_probs=23.5

Q ss_pred             eEEecCCCeEEEEeeEe-eecCCeEEEEeCCCcEEE
Q psy4606          20 DIMAPEGGTIKLVCKAK-GYPRPHITWKREDGQEII   54 (69)
Q Consensus        20 ~~~~~~g~~~~l~C~~~-g~P~P~~~W~~~~~~~~~   54 (69)
                      ++.+..++.+.|.|.-. +.-..+..|.++++..+.
T Consensus        33 dv~a~vd~~V~L~C~~~~~~~i~~~~W~~~~~~~la   68 (251)
T PHA02982         33 DVNATVDQEVKLQCLFKDADEISRAMWKGDAGFMLA   68 (251)
T ss_pred             hhhccCCCcEEEEecCCCcchhhhheeeCCCCeEEE
Confidence            34455689999999843 244467789986665443


No 211
>PF15525 DUF4652:  Domain of unknown function (DUF4652)
Probab=26.03  E-value=1e+02  Score=16.99  Aligned_cols=28  Identities=21%  Similarity=0.488  Sum_probs=15.3

Q ss_pred             eEEEEeCCCcEEEecCCcEEEeCCCCCC
Q psy4606          42 HITWKREDGQEIIIKEGNTMVPKSKDIF   69 (69)
Q Consensus        42 ~~~W~~~~~~~~~~~~~~~~~~~~~~l~   69 (69)
                      .+.|..+..-.+..+..+-.+..+|.||
T Consensus       116 ~i~WiDD~~L~vIIG~a~GTvS~GGnLy  143 (200)
T PF15525_consen  116 YIEWIDDNNLAVIIGYAHGTVSKGGNLY  143 (200)
T ss_pred             eeEEecCCcEEEEEccccceEccCCeEE
Confidence            6779873233334444555666666554


No 212
>PHA03402 hypothetical protein; Provisional
Probab=25.45  E-value=85  Score=14.45  Aligned_cols=18  Identities=33%  Similarity=0.658  Sum_probs=14.1

Q ss_pred             EEecCCCeEEEEeeEeee
Q psy4606          21 IMAPEGGTIKLVCKAKGY   38 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~   38 (69)
                      +....|+.+.+.|+....
T Consensus        11 ITS~~GsTISi~CEskS~   28 (81)
T PHA03402         11 ITSENGSTISIYCESKSK   28 (81)
T ss_pred             EecCCCCEEEEEEcccCc
Confidence            556779999999997653


No 213
>PF02124 Marek_A:  Marek's disease glycoprotein A;  InterPro: IPR001038  Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites []. EHV-1 gp13 is the structural homologue of the gC-like glycoproteins of the Human herpesvirus 1 (HHV-1) and Human herpesvirus 2 (HHV-2) (gC-1 and gC-2 respectively), Pseudorabies virus (strain Indiana-Funkhauser/Becker) (PRV) (gIII) and Human herpesvirus 3 (HHV-3) (gp66).  Secretory glycoprotein GP57-65 precursor (glycoprotein A - GA) is similar to Herpesvirus glycoprotein C, and belongs to the immunoglobulin gene superfamily [, ]. GA is thought to play an immunoevasive role in the pathogenesis of Marek's disease. It is a candidate for causing the early-stage immunosuppression that occurs after MDHV infection.
Probab=24.96  E-value=97  Score=17.27  Aligned_cols=18  Identities=33%  Similarity=0.815  Sum_probs=14.8

Q ss_pred             cCCCeEEEEeeEeeecCC
Q psy4606          24 PEGGTIKLVCKAKGYPRP   41 (69)
Q Consensus        24 ~~g~~~~l~C~~~g~P~P   41 (69)
                      ...+.+...|...|+|..
T Consensus       146 ~~~~~~~YtC~l~GYP~~  163 (211)
T PF02124_consen  146 DEDGPVEYTCRLIGYPDI  163 (211)
T ss_pred             ccCCceeEEEEEeeCCCC
Confidence            456778999999999875


No 214
>PTZ00096 40S ribosomal protein S15; Provisional
Probab=23.57  E-value=1.1e+02  Score=15.97  Aligned_cols=18  Identities=22%  Similarity=0.045  Sum_probs=11.2

Q ss_pred             eecCCeEEEEeCCCcEEEe
Q psy4606          37 GYPRPHITWKREDGQEIII   55 (69)
Q Consensus        37 g~P~P~~~W~~~~~~~~~~   55 (69)
                      ..|.+..+|.+ +...++.
T Consensus        71 ~k~~~ikT~~R-~~~IlP~   88 (143)
T PTZ00096         71 EKPKAVKTHLR-DMIIVPE   88 (143)
T ss_pred             cCCcceeEecc-cCeeCcc
Confidence            35677778887 5544443


No 215
>PF02440 Adeno_E3_CR1:  Adenovirus E3 region protein CR1;  InterPro: IPR003471 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=22.27  E-value=92  Score=13.73  Aligned_cols=20  Identities=30%  Similarity=0.662  Sum_probs=12.4

Q ss_pred             cCCCeEEEEeeEeeecCCeEEEEe
Q psy4606          24 PEGGTIKLVCKAKGYPRPHITWKR   47 (69)
Q Consensus        24 ~~g~~~~l~C~~~g~P~P~~~W~~   47 (69)
                      ..|++++|    .|.|...++|++
T Consensus         3 ~~G~N~TL----~Gp~~~~V~Wy~   22 (63)
T PF02440_consen    3 TVGSNVTL----VGPPDGPVTWYK   22 (63)
T ss_pred             eEcCcEEE----eCCCCCceEEEE
Confidence            34666654    354656789984


No 216
>PF09866 DUF2093:  Uncharacterized protein conserved in bacteria (DUF2093);  InterPro: IPR018661  This family of various hypothetical prokaryotic proteins has no known function. 
Probab=21.93  E-value=79  Score=12.82  Aligned_cols=12  Identities=33%  Similarity=0.708  Sum_probs=9.0

Q ss_pred             EEEeeEeeecCC
Q psy4606          30 KLVCKAKGYPRP   41 (69)
Q Consensus        30 ~l~C~~~g~P~P   41 (69)
                      ...|-++|.+.|
T Consensus         7 ~V~CAVTg~~Ip   18 (42)
T PF09866_consen    7 FVRCAVTGQPIP   18 (42)
T ss_pred             EEEEEeeCCccc
Confidence            457888887776


No 217
>PHA02840 hypothetical protein; Provisional
Probab=20.09  E-value=1.2e+02  Score=14.08  Aligned_cols=18  Identities=33%  Similarity=0.604  Sum_probs=14.1

Q ss_pred             EEecCCCeEEEEeeEeee
Q psy4606          21 IMAPEGGTIKLVCKAKGY   38 (69)
Q Consensus        21 ~~~~~g~~~~l~C~~~g~   38 (69)
                      +....|..+.+.|+....
T Consensus        10 ITS~~GstISiyCEsks~   27 (82)
T PHA02840         10 ITSNSGNTISIYCETKTT   27 (82)
T ss_pred             EecCCCCEEEEEEcccCc
Confidence            556779999999997553


Done!