Diaphorina citri psyllid: psy4616

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MSANGGMNPLLKEWGASFKAPTVYRVSNGTLRIQVQLMSLIAFAGLFALILCVYYSHSTYNHVPAGFGPYESNIYLKSLGKGLMYNNTYPLTPPVQTAQGIQYRIAPDNKSWLSYFKKGYLLWNPTFDQISIIWDSEKPTVLKSGYGLNGRGMELSELVVFDGKLLTVDDRTGIVYIVENNMVIPWVVLMDGNGQSPKGYMIHESGVWSEYHQRWFFLPRRSSHFKYDEVTDERMATNVLLSTDSNFTNVMVTYIGEVIPTHGYSSFKFLPGTKDRVIVALKSEEDKGRTATYITAFTLAGTILVPETKIADYKYEGLEFI

ccccccccHHHHHHHHcccccccEEECcccccEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccccccccccccccccEECcccEEEEcccccccEEEEEEEEEEEEcccccEEEEEEcccccEEEEccccccccccEEEEEEEEccEEEEECccccEEEEEccccccHHHHHHHcccccccCEEEEEEEEEccccccEEEECccccccccccHHHHHccccEEEEEccccccEEEEEEccccccccccccEECcccccEEEEEEEEEEcccCEEEEEEEEEEccEEECcccccccCEEEEEEEc

*********LLKEWGASFKAPTVYRVSNGTLRIQVQLMSLIAFAGLFALILCVYYSHST********************GKGLMYNNTYPLTPPVQTAQGIQYRIAPDNKSWLSYFKKGYLLWNPTFDQISIIWDSEKPTVLKSGYGLNGRGMELSELVVFDGKLLTVDDRTGIVYIVENNMVIPWVVLMDGNGQSPKGYMIHESGVWSEYHQRWFFLPRRSSHFKYDEVTDERMATNVLLSTDSNFTNVMVTYIGEVIPTHGYSSFKFLPGTKDRVIVALKSEEDKGRTATYITAFTLAGTILVPETKIADYKYEGLEFI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Soluble calcium-activated nucleotidase 1	Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP.	confident	Q8WVQ1
Soluble calcium-activated nucleotidase 1	Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > IDP >> UTP > CDP = GTP = ITP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP.	confident	Q8VCF1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0007165 [BP]	signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S1D, chain A
Confidence level:very confident
Coverage over the Query: 83-321
View the alignment between query and template
View the model in PyMOL