Diaphorina citri psyllid: psy4617

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MYKCINYTELQMDCALDLMRRLPPQQIEKNLSDLIDLVPGLCEDLLSSVDQPLKIARDKEMGKDYLLCDYNRDGDSYRSPWSNVYDPPLEDGSMPSERLRKLEIDANHAFDQYREMYFEGGVSSVYLWDLDHGFAEIDANHAFDQYREMYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSRKIQGCWDSIHVVEVQEKPTGRNAHYKLTSTVMLWLQTNKIASGKMNLGGSLTRQIEMDAQVSDTSPHIANIGRMVEEMENKIRNTLNEIYFGKTKDIVNGLRSLQPLSVQQAQQALKQDLAAALQKRNAKTEN
ccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHccccccEEEEcccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHccccccEEEccccccEEEEEEEEEccccccccccEEEEEEEEEEEEccccccccEEEEEEEEEEEEEcccccEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccc
******YTELQMDCALDLMRRLPPQQIEKNLSDLIDLVPGLCEDLLSSVDQPLKIARDKEMGKDYLLCDYNRDGDSYRSPWSNVYDPPLEDGSMPSERLRKLEIDANHAFDQYREMYFEGGVSSVYLWDLDHGFAEIDANHAFDQYREMYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSRKIQGCWDSIHVVEVQEKPTGRNAHYKLTSTVMLWLQTNKIASGKMNLGG*************DTSPHIANIGRMVEEMENKIRNTLNEIYFGKTKDIVNGLRSL*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYKCINYTELQMDCALDLMRRLPPQQIEKNLSDLIDLVPGLCEDLLSSVDQPLKIARDKEMGKDYLLCDYNRDGDSYRSPWSNVYDPPLEDGSMPSERLRKLEIDANHAFDQYREMYFEGGVSSVYLWDLDHGFAEIDANHAFDQYREMYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSRKIQGCWDSIHVVEVQEKPTGRNAHYKLTSTVMLWLQTNKIASGKMNLGGSLTRQIEMDAQVSDTSPHxxxxxxxxxxxxxxxxxxxxxIYFGKTKDIVNGLRSLQPLSVQQAQQALKQDLAAALQKRNAKTEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. The isoform beta-3 may play a role in spermatogenesis. Alternatively, may play a role in later maturation steps such as capacitation and fertilization which involve changes of membrane domains. May play a role in the regulation of cell morphology and cytoskeletal organization.very confidentP79136
F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.very confidentQ5XI32
F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.very confidentQ5R507

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043229 [CC]intracellular organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031115 [BP]negative regulation of microtubule polymerizationprobableGO:0031110, GO:0031111, GO:0031113, GO:0033043, GO:0051129, GO:0051128, GO:0032886, GO:0050789, GO:0044699, GO:0051494, GO:0051493, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0031333, GO:0009987, GO:0050794, GO:0044763, GO:0043254, GO:0010639, GO:0044087, GO:0008150, GO:0070507, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071203 [CC]WASH complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0001669 [CC]acrosomal vesicleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051016 [BP]barbed-end actin filament cappingprobableGO:0033043, GO:1901879, GO:0051129, GO:0051128, GO:0008064, GO:0032970, GO:0043244, GO:0050789, GO:0044699, GO:0043242, GO:0030832, GO:0030833, GO:0030834, GO:0030835, GO:0030837, GO:0071840, GO:0051494, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0051693, GO:0065008, GO:0009987, GO:0031333, GO:1901880, GO:0044763, GO:0032956, GO:0043254, GO:0050794, GO:0010639, GO:0044087, GO:0032535, GO:0008150, GO:0048523
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005869 [CC]dynactin complexprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0051286 [CC]cell tipprobableGO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0007596 [BP]blood coagulationprobableGO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0007298 [BP]border follicle cell migrationprobableGO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0051490 [BP]negative regulation of filopodium assemblyprobableGO:0051489, GO:0008150, GO:0009987, GO:0051129, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0050794, GO:0031345, GO:0031344, GO:0048523
GO:0035220 [BP]wing disc developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043332 [CC]mating projection tipprobableGO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0022604 [BP]regulation of cell morphogenesisprobableGO:0022603, GO:0050793, GO:0050794, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0008290 [CC]F-actin capping protein complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0048487 [MF]beta-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0000578 [BP]embryonic axis specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009798, GO:0007275, GO:0044699
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0000902 [BP]cell morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0009617 [BP]response to bacteriumprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0030479 [CC]actin cortical patchprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035046 [BP]pronuclear migrationprobableGO:0044699, GO:0051656, GO:0000003, GO:0051234, GO:0040023, GO:0009987, GO:0009566, GO:0019953, GO:0008150, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0051649, GO:0051647, GO:0007097, GO:0051179, GO:0051640, GO:0051641
GO:0010591 [BP]regulation of lamellipodium assemblyprobableGO:0051128, GO:0044087, GO:0060491, GO:0065007, GO:0008150, GO:0050794, GO:0031344, GO:0050789
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0014704 [CC]intercalated discprobableGO:0005575, GO:0044291, GO:0030054, GO:0005911
GO:0030032 [BP]lamellipodium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0007303 [BP]cytoplasmic transport, nurse cell to oocyteprobableGO:0019953, GO:0007292, GO:0032501, GO:0007276, GO:0000003, GO:0044699, GO:0016482, GO:0048477, GO:0009987, GO:0048609, GO:0032504, GO:0006810, GO:0022414, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0007300, GO:0044702, GO:0046907, GO:0044763
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0048747 [BP]muscle fiber developmentprobableGO:0032502, GO:0055001, GO:0055002, GO:0048856, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0051146, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0005884 [CC]actin filamentprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AA0, chain B
Confidence level:very confident
Coverage over the Query: 8-118,152-283
View the alignment between query and template
View the model in PyMOL
Template: 3LK4, chain B
Confidence level:very confident
Coverage over the Query: 9-118,152-283
View the alignment between query and template
View the model in PyMOL
Template: 3AA0, chain B
Confidence level:very confident
Coverage over the Query: 24-66,83-237
View the alignment between query and template
View the model in PyMOL