Query         psy4618
Match_columns 96
No_of_seqs    102 out of 119
Neff          2.6 
Searched_HMMs 46136
Date          Fri Aug 16 21:28:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4618.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4618hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01115 F_actin_cap_B:  F-acti 100.0 1.4E-37   3E-42  242.5   1.1   74   11-91     11-89  (242)
  2 KOG3174|consensus              100.0 1.7E-33 3.7E-38  223.4   3.2   76   11-93     15-90  (275)
  3 PF15232 DUF4585:  Domain of un  54.7     8.1 0.00018   26.5   1.4   26   49-81      7-32  (75)
  4 PF02757 YLP:  YLP motif;  Inte  47.5      11 0.00025   16.8   0.9    9   79-87      1-9   (9)
  5 PF08727 P3A:  Poliovirus 3A pr  44.0     1.7 3.6E-05   28.4  -3.0   24   36-59     17-40  (57)
  6 PF09822 ABC_transp_aux:  ABC-t  35.4      31 0.00067   25.8   2.1   29   23-57      6-34  (271)
  7 PF09671 Spore_GerQ:  Spore coa  32.5      27 0.00058   24.3   1.3   28   43-70     43-70  (81)
  8 PF05556 Calsarcin:  Calcineuri  32.2      16 0.00034   29.8   0.1   17   71-87    156-174 (274)
  9 PRK11346 hypothetical protein;  30.4      31 0.00067   28.6   1.5   29   62-92    144-172 (285)
 10 PRK10318 hypothetical protein;  26.1      24 0.00052   25.9   0.1   13   64-76     40-52  (121)
 11 PF05554 Novirhabdo_Nv:  Viral   24.6      28  0.0006   25.6   0.2   18   51-71     24-41  (122)
 12 PF06702 DUF1193:  Protein of u  22.1      43 0.00093   26.6   0.9   13   72-84     49-61  (221)
 13 PF11411 DNA_ligase_IV:  DNA li  20.8      20 0.00042   21.5  -1.0   17   60-76      3-19  (36)
 14 PF14685 Tricorn_PDZ:  Tricorn   20.7      19  0.0004   24.4  -1.2   26   62-87      2-34  (88)
 15 TIGR02192 HtrL_YibB conserved   20.2      61  0.0013   26.5   1.4   29   62-92    139-167 (270)
 16 COG1153 FwdD Formylmethanofura  20.1      61  0.0013   24.2   1.3   61   25-92     31-96  (128)

No 1  
>PF01115 F_actin_cap_B:  F-actin capping protein, beta subunit;  InterPro: IPR001698 This entry represents a component of the WASH complex. The WASH complex is present at the surface of endosomes and recruits and activates the Arp2/3 complex to induce actin polymerisation. The WASH complex plays a key role in the fission of tubules that serve as transport intermediates during endosome sorting []. The WASH complex's subunit structure: F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH (WASH1, WASH2P, WASH3P, WASH4P, WASH5P or WASH6P), FAM21 (FAM21A, FAM21B or FAM21C), KIAA1033, KIAA0196 (strumpellin) and CCDC53. The actin filament system, a prominent part of the cytoskeleton in eukaryotic cells, is both a static structure and a dynamic network that can undergo rearrangements: it is thought to be involved in processes such as cell movement and phagocytosis [], as well as muscle contraction. The F-actin capping protein binds in a calcium-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike gelsolin (see IPR007122 from INTERPRO) and severin this protein does not sever actin filaments. The F-actin capping protein is a heterodimer composed of two unrelated subunits: alpha and beta. Neither of the subunits shows sequence similarity to other filament-capping proteins []. The beta subunit is a protein of about 280 amino acid residues whose sequence is well conserved in eukaryotic species [].; GO: 0003779 actin binding, 0030036 actin cytoskeleton organization, 0005737 cytoplasm, 0008290 F-actin capping protein complex; PDB: 3AAE_D 3LK4_Q 2KXP_B 2KZ7_B 3AA1_B 3LK2_B 3AA7_B 3AAA_B 1IZN_B 3AA0_B ....
Probab=100.00  E-value=1.4e-37  Score=242.49  Aligned_cols=74  Identities=45%  Similarity=0.716  Sum_probs=58.7

Q ss_pred             CCCchhHhhhcCCCcccccccCCCCCchhhhhhcCCCcceeEeeccccCceeeecccCCCCCccCCCCCCCccCCCC---
Q psy4618          11 NASPDSMQANRSSGSMHTLSPYSDDSSQKSDSITPSDQPLKIARDKEMGKDYLLCDYNRDGDSYRHRAAKAIDTYFK---   87 (96)
Q Consensus        11 ~~~P~~i~~nl~~~~ic~l~~~~l~PdltedLLssVDqPLkI~~D~e~~K~yL~CDYNRDGDSYRSPwSN~Y~P~l~---   87 (96)
                      .+.|+.++.||+  +||.|.     |+|++||||+|||||||++|+++||+||+||||||||||||||||+||||++   
T Consensus        11 RlpP~~ie~nl~--~l~~L~-----Pdl~edLLssVD~PLkv~~d~~~~k~yL~CdYNRDgDSYRSPwSNkY~P~~~~~~   83 (242)
T PF01115_consen   11 RLPPKKIEKNLS--NLIDLV-----PDLTEDLLSSVDQPLKVARDKETGKDYLLCDYNRDGDSYRSPWSNKYYPPLEGDD   83 (242)
T ss_dssp             TS-GGGHHHHHH--HHHHHS-----GGGHHHHHHHS----EEEEETTTTEEEEESGGGEETTEEE-TTT--EES--S---
T ss_pred             hCChHHHHHHHH--HHHHHH-----HHHHHHHHHhCCCcceEEEchhhCCeeEeecccCCcccccCCCCcccCCCccccc
Confidence            578999999999  888887     7999999999999999999999999999999999999999999999999999   


Q ss_pred             --CCCC
Q psy4618          88 --SGRG   91 (96)
Q Consensus        88 --dG~~   91 (96)
                        +|..
T Consensus        84 ~~dg~~   89 (242)
T PF01115_consen   84 LEDGPV   89 (242)
T ss_dssp             --S---
T ss_pred             cCCCCC
Confidence              7764


No 2  
>KOG3174|consensus
Probab=99.97  E-value=1.7e-33  Score=223.38  Aligned_cols=76  Identities=43%  Similarity=0.673  Sum_probs=70.7

Q ss_pred             CCCchhHhhhcCCCcccccccCCCCCchhhhhhcCCCcceeEeeccccCceeeecccCCCCCccCCCCCCCccCCCCCCC
Q psy4618          11 NASPDSMQANRSSGSMHTLSPYSDDSSQKSDSITPSDQPLKIARDKEMGKDYLLCDYNRDGDSYRHRAAKAIDTYFKSGR   90 (96)
Q Consensus        11 ~~~P~~i~~nl~~~~ic~l~~~~l~PdltedLLssVDqPLkI~~D~e~~K~yL~CDYNRDGDSYRSPwSN~Y~P~l~dG~   90 (96)
                      .++|..|+.||+  +++.     |+|+|++|||++|||||||++|+|+||+||+||||||||||||||||+|+||++||+
T Consensus        15 rLpPqqieKnL~--nLId-----L~P~L~edLLsSVdqplKia~dke~g~~yllcDynrdgDsyRsPwsnsy~pPledg~   87 (275)
T KOG3174|consen   15 RLPPQQIEKNLS--NLID-----LAPHLCEDLLSSVDQPLKIARDKESGKQYLLCDYNRDGDSYRSPWSNSYDPPLEDGV   87 (275)
T ss_pred             cCCHHHHHHHHH--HHHH-----hchHHHHHHHhhcccceeehhhhhcCCeeeeeecCCCcccccCCCCcccCCccccCC
Confidence            589999999999  6555     458999999999999999999999999999999999999999999999999999998


Q ss_pred             CCC
Q psy4618          91 GSN   93 (96)
Q Consensus        91 ~~~   93 (96)
                      ...
T Consensus        88 ~Ps   90 (275)
T KOG3174|consen   88 YPS   90 (275)
T ss_pred             CcH
Confidence            753


No 3  
>PF15232 DUF4585:  Domain of unknown function (DUF4585)
Probab=54.68  E-value=8.1  Score=26.46  Aligned_cols=26  Identities=27%  Similarity=0.349  Sum_probs=18.8

Q ss_pred             ceeEeeccccCceeeecccCCCCCccCCCCCCC
Q psy4618          49 PLKIARDKEMGKDYLLCDYNRDGDSYRHRAAKA   81 (96)
Q Consensus        49 PLkI~~D~e~~K~yL~CDYNRDGDSYRSPwSN~   81 (96)
                      +=||..|+++|++|+       -|.=|.|-+..
T Consensus         7 qrKvL~DP~SG~Yy~-------vd~P~Qp~~k~   32 (75)
T PF15232_consen    7 QRKVLQDPESGQYYV-------VDAPVQPKTKT   32 (75)
T ss_pred             CccEeecCCCCCEEE-------EecCCCcceee
Confidence            448999999999998       35555555444


No 4  
>PF02757 YLP:  YLP motif;  InterPro: IPR004019 The YLP motif is found in one or several copies in various Drosophila proteins. Its function is unknown, however the presence of completely conserved tyrosine residues and its presence in the human Erbb-2 and ErbB-4 receptor protein-tyrosine kinases (2.7.10.1 from EC) may suggest it could be a substrate for tyrosine kinases. ErbBs (1-4) are single-pass transmembrane proteins that activate a wide variety of signalling pathways, including those involved in proliferation, migration, differentiation, survival, and apoptosis; they are frequently misregulated in cancer []. ErbB-2 is an essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. ErbB-4 specifically binds and is activated by neuregulins, NRG-2, NRG-3, heparin-binding EGF-like growth factor, betacellulin and NTAK [].
Probab=47.51  E-value=11  Score=16.78  Aligned_cols=9  Identities=0%  Similarity=-0.164  Sum_probs=6.8

Q ss_pred             CCCccCCCC
Q psy4618          79 AKAIDTYFK   87 (96)
Q Consensus        79 SN~Y~P~l~   87 (96)
                      ||+|.||.+
T Consensus         1 s~eYLpP~~    9 (9)
T PF02757_consen    1 SNEYLPPVE    9 (9)
T ss_pred             CccccCCCC
Confidence            578888863


No 5  
>PF08727 P3A:  Poliovirus 3A protein like;  InterPro: IPR014838 The 3A protein is found in positive-strand RNA viruses. It is a critical component of the poliovirus replication complex, and is also an inhibitor of host cell ER to Golgi transport. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0017111 nucleoside-triphosphatase activity; PDB: 1NG7_A.
Probab=44.01  E-value=1.7  Score=28.41  Aligned_cols=24  Identities=21%  Similarity=0.213  Sum_probs=18.2

Q ss_pred             CchhhhhhcCCCcceeEeeccccC
Q psy4618          36 SSQKSDSITPSDQPLKIARDKEMG   59 (96)
Q Consensus        36 PdltedLLssVDqPLkI~~D~e~~   59 (96)
                      |+...|||++||.|=-+.+|++.|
T Consensus        17 P~~I~DLL~SV~~~eV~~YC~~~G   40 (57)
T PF08727_consen   17 PPAIADLLRSVDSPEVREYCEEQG   40 (57)
T ss_dssp             S-TTHHHHHHH--HHHHHHHHHHT
T ss_pred             CHHHHHHHHhcCCHHHHHHHHHCC
Confidence            899999999999998888887754


No 6  
>PF09822 ABC_transp_aux:  ABC-type uncharacterized transport system;  InterPro: IPR019196  This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. 
Probab=35.41  E-value=31  Score=25.80  Aligned_cols=29  Identities=21%  Similarity=0.256  Sum_probs=23.2

Q ss_pred             CCcccccccCCCCCchhhhhhcCCCcceeEeeccc
Q psy4618          23 SGSMHTLSPYSDDSSQKSDSITPSDQPLKIARDKE   57 (96)
Q Consensus        23 ~~~ic~l~~~~l~PdltedLLssVDqPLkI~~D~e   57 (96)
                      .+.+++|.      +.|.++|++++.|++|..--.
T Consensus         6 ~~k~ysLS------~~T~~~L~~L~~pV~i~~~~s   34 (271)
T PF09822_consen    6 ANKRYSLS------DQTKKVLKSLDEPVTITVYFS   34 (271)
T ss_pred             CCCCccCC------HHHHHHHHhCCCCEEEEEEEC
Confidence            45677777      689999999999999987443


No 7  
>PF09671 Spore_GerQ:  Spore coat protein (Spore_GerQ);  InterPro: IPR014099 Members of this protein family are the spore coat protein GerQ of endospore-forming Firmicutes (low GC Gram-positive bacteria). This protein is cross-linked by a spore coat-associated transglutaminase.
Probab=32.47  E-value=27  Score=24.33  Aligned_cols=28  Identities=32%  Similarity=0.367  Sum_probs=20.6

Q ss_pred             hcCCCcceeEeeccccCceeeecccCCC
Q psy4618          43 ITPSDQPLKIARDKEMGKDYLLCDYNRD   70 (96)
Q Consensus        43 LssVDqPLkI~~D~e~~K~yL~CDYNRD   70 (96)
                      +..+-.---|..|++|||.||+-.-|=|
T Consensus        43 iE~aGRDhiiisDp~tg~ryLllmvylD   70 (81)
T PF09671_consen   43 IEAAGRDHIIISDPKTGKRYLLLMVYLD   70 (81)
T ss_pred             ehhcCcceEEEeCCCCCcEEEEEEEeee
Confidence            3344445568899999999999776654


No 8  
>PF05556 Calsarcin:  Calcineurin-binding protein (Calsarcin);  InterPro: IPR008438 This family consists of several mammalian calcineurin-binding proteins. Calcineurin is a Ca/calmodulin-dependent serine-threonine phosphatase and has been implicated in the transduction of signals that control the hypertrophy of cardiac muscle and slow fibre gene expression in striated muscle. A novel family of striated muscle-specific calcineurin-interacting proteins called calsarcins or myozenins has been identified that interact and co-localize with the Z-disc protein alpha-actinin thereby coupling muscle activity to calcineurin activation []. Because calcineurin responds to sustained, low amplitude calcium signals, calsarcins may serve to localize calcineurin in the vicinity of unique intracellular pool, where it can interact with specific upstream activators or downstream substrates. Therefore, calsarcins may play an important role in modulating the function and substrate specificity of calcineurin in striated muscle cells. Three isoforms of calsarcins that have been identified in human, rat and mouse.   Calsarcin-1 (CALS-1, Myozenin-2, MYOZ2)  Calsarcin-2 (CALS-2, Myozenin-1, FATZ)  Calsarcin-3 (Myozenin-3, MYOZ3)   Calsarcin-1, is expressed, throughout the development-cycle, in all striated muscle tissues. However, CALS-1 expression is localized in slow-twitch fibres. Calsarcin-2, has an approximate ~30% identity with CALS-1 is a globular protein with central glycine-rich domain flanked by a-helical regions. CALS-2 is expressed transiently in heart during early embryogenesis and later becomes restricted to skeletal muscle with weaker signals in adult prostate, placenta and pancreas. In contrast to CALS-1, the expression of Calsarcin-2 is restricted to fast-twitch skeletal fibre. Calsarcin-3, is expressed specifically in skeletal muscle and is enriched in fast-twitch muscle fibres. Like calsarcin-1 and calsarcin-2, calsarcin-3 interacts with calcineurin, and the Z-disc proteins alpha-actinin, gamma-filamin, and telethonin [].
Probab=32.24  E-value=16  Score=29.81  Aligned_cols=17  Identities=18%  Similarity=0.055  Sum_probs=12.5

Q ss_pred             CCccCCCCCC--CccCCCC
Q psy4618          71 GDSYRHRAAK--AIDTYFK   87 (96)
Q Consensus        71 GDSYRSPwSN--~Y~P~l~   87 (96)
                      =-+|+|||--  .++|.|.
T Consensus       156 pKsY~SPWe~am~~d~~l~  174 (274)
T PF05556_consen  156 PKSYISPWEEAMGGDPELA  174 (274)
T ss_pred             cccccChHHHHhccCHHHh
Confidence            4799999986  5665554


No 9  
>PRK11346 hypothetical protein; Provisional
Probab=30.37  E-value=31  Score=28.58  Aligned_cols=29  Identities=21%  Similarity=0.257  Sum_probs=23.8

Q ss_pred             eeecccCCCCCccCCCCCCCccCCCCCCCCC
Q psy4618          62 YLLCDYNRDGDSYRHRAAKAIDTYFKSGRGS   92 (96)
Q Consensus        62 yL~CDYNRDGDSYRSPwSN~Y~P~l~dG~~~   92 (96)
                      +|-=-|||+|..|  |-+++|+++++++.|+
T Consensus       144 WiDFGynhgg~~f--~~~~ew~f~~d~nKI~  172 (285)
T PRK11346        144 WIDFGYCRKPNVT--RGLKIWDFPFDENKMH  172 (285)
T ss_pred             eeeccccCCCccc--CCcccccccCCCCceE
Confidence            4555699999997  7789999999988764


No 10 
>PRK10318 hypothetical protein; Provisional
Probab=26.11  E-value=24  Score=25.87  Aligned_cols=13  Identities=31%  Similarity=0.644  Sum_probs=11.2

Q ss_pred             ecccCCCCCccCC
Q psy4618          64 LCDYNRDGDSYRH   76 (96)
Q Consensus        64 ~CDYNRDGDSYRS   76 (96)
                      .|.|.|+|+.|-+
T Consensus        40 ~c~FiRNG~~h~~   52 (121)
T PRK10318         40 DCTFVRNGDEHTC   52 (121)
T ss_pred             CCEEEECCCcCCH
Confidence            6999999999854


No 11 
>PF05554 Novirhabdo_Nv:  Viral hemorrhagic septicemia virus non-virion protein;  InterPro: IPR008720 This family consists of several viral hemorrhagic septicemia virus non-virion (Nv) proteins. The NV protein is a nonstructural protein absent from mature virions although it is present in infected cells. The function of this protein is unknown [].
Probab=24.59  E-value=28  Score=25.64  Aligned_cols=18  Identities=33%  Similarity=0.763  Sum_probs=13.5

Q ss_pred             eEeeccccCceeeecccCCCC
Q psy4618          51 KIARDKEMGKDYLLCDYNRDG   71 (96)
Q Consensus        51 kI~~D~e~~K~yL~CDYNRDG   71 (96)
                      ++.+|+.   .||.||++|-.
T Consensus        24 rl~fdps---nylncd~drsd   41 (122)
T PF05554_consen   24 RLTFDPS---NYLNCDIDRSD   41 (122)
T ss_pred             hcccCcc---cccccccchhh
Confidence            3456665   79999999964


No 12 
>PF06702 DUF1193:  Protein of unknown function (DUF1193);  InterPro: IPR009581 This family is baesd on the C terminus of several hypothetical eukaryotic proteins of unknown function. Proteins in this entry contain two conserved motifs: DRHHYE and QCC, as well as a number of conserved cysteine residues.
Probab=22.08  E-value=43  Score=26.62  Aligned_cols=13  Identities=15%  Similarity=0.256  Sum_probs=10.5

Q ss_pred             CccCCCCCCCccC
Q psy4618          72 DSYRHRAAKAIDT   84 (96)
Q Consensus        72 DSYRSPwSN~Y~P   84 (96)
                      .++||||.-.|--
T Consensus        49 ~~~r~Pw~RsY~~   61 (221)
T PF06702_consen   49 KSWRSPWRRSYSK   61 (221)
T ss_pred             hhCCCCCCCCcCc
Confidence            4799999988853


No 13 
>PF11411 DNA_ligase_IV:  DNA ligase IV;  InterPro: IPR021536  DNA ligase IV along with Xrcc4 functions in DNA non-homologous end joining. This process is required to mend double-strand breaks. Upon ligase binding to an Xrcc4 dimer, the helical tails unwind leading to a flat interaction surface []. ; GO: 0003910 DNA ligase (ATP) activity; PDB: 3II6_Y 2E2W_A 1IK9_C.
Probab=20.75  E-value=20  Score=21.52  Aligned_cols=17  Identities=35%  Similarity=0.559  Sum_probs=11.2

Q ss_pred             ceeeecccCCCCCccCC
Q psy4618          60 KDYLLCDYNRDGDSYRH   76 (96)
Q Consensus        60 K~yL~CDYNRDGDSYRS   76 (96)
                      |+-+.|+|-+=||||=-
T Consensus         3 k~~fa~eyD~yGDSY~~   19 (36)
T PF11411_consen    3 KEHFAKEYDCYGDSYTV   19 (36)
T ss_dssp             HHHHHHHB-TTS-BSSS
T ss_pred             HHHHHHHhccccccccc
Confidence            34467899999999953


No 14 
>PF14685 Tricorn_PDZ:  Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A.
Probab=20.71  E-value=19  Score=24.38  Aligned_cols=26  Identities=19%  Similarity=0.267  Sum_probs=17.5

Q ss_pred             eeecccCCCCCccC-------CCCCCCccCCCC
Q psy4618          62 YLLCDYNRDGDSYR-------HRAAKAIDTYFK   87 (96)
Q Consensus        62 yL~CDYNRDGDSYR-------SPwSN~Y~P~l~   87 (96)
                      +|.|||..|...||       .||.-....||.
T Consensus         2 ~LGAd~~~~~~~y~I~~I~~gd~~~~~~~sPL~   34 (88)
T PF14685_consen    2 LLGADFSYDNGGYRIARIYPGDPWNPNARSPLA   34 (88)
T ss_dssp             B-SEEEEEETTEEEEEEE-BS-TTSSS-B-GGG
T ss_pred             ccceEEEEcCCEEEEEEEeCCCCCCccccCCcc
Confidence            68999999998887       477777666664


No 15 
>TIGR02192 HtrL_YibB conserved hypothetical protein HtrL. The protein from this rare, uncharacterized protein family is designated HtrL or YibB in E. coli, where its gene is found in a region of LPS core biosynthesis genes. Homologs are found in Shigella flexneri, Campylobacter jejuni, and Caenorhabditis elegans only. The htrL gene may represent an insertion to the LPS core biosynthesis region, rather than an LPS biosynthetic protein.
Probab=20.24  E-value=61  Score=26.54  Aligned_cols=29  Identities=14%  Similarity=0.197  Sum_probs=22.9

Q ss_pred             eeecccCCCCCccCCCCCCCccCCCCCCCCC
Q psy4618          62 YLLCDYNRDGDSYRHRAAKAIDTYFKSGRGS   92 (96)
Q Consensus        62 yL~CDYNRDGDSYRSPwSN~Y~P~l~dG~~~   92 (96)
                      +|-=-|||+|.-|  |.+++|+|++.+|.|+
T Consensus       139 WiDFGy~hgg~~f--~~~~~w~f~~~~~KI~  167 (270)
T TIGR02192       139 WLDFGYGHAENHF--PYSYKWQFALPEGKIS  167 (270)
T ss_pred             EEEccccCCCCcC--CCcccccCcCCCCcEE
Confidence            3445699998885  5699999999998764


No 16 
>COG1153 FwdD Formylmethanofuran dehydrogenase subunit D [Energy production and conversion]
Probab=20.07  E-value=61  Score=24.23  Aligned_cols=61  Identities=11%  Similarity=0.070  Sum_probs=38.2

Q ss_pred             cccccccCCCCCchhhhhhcCCCcceeEeeccccC---ceeeecccCCCCCcc--CCCCCCCccCCCCCCCCC
Q psy4618          25 SMHTLSPYSDDSSQKSDSITPSDQPLKIARDKEMG---KDYLLCDYNRDGDSY--RHRAAKAIDTYFKSGRGS   92 (96)
Q Consensus        25 ~ic~l~~~~l~PdltedLLssVDqPLkI~~D~e~~---K~yL~CDYNRDGDSY--RSPwSN~Y~P~l~dG~~~   92 (96)
                      .+|.+.     |+--+.|-.+---++||..  +-|   -.=-.-|++..|=-|  |+||+|.-.+|=.+|-++
T Consensus        31 a~~~in-----p~D~~~Lgv~EGD~VkVks--e~GeVVV~Ak~~~~~~pG~vfiPmgpWaN~vi~P~T~sTG~   96 (128)
T COG1153          31 AVCEIN-----PEDMKQLGVSEGDKVKVKS--EFGEVVVKAKEADGVQPGMVFIPMGPWANVVIDPDTDSTGM   96 (128)
T ss_pred             eEEEEC-----HHHHHHhCCCcCCeEEEEe--cCccEEEEEeeCCCCCCCeEEecCCcccceeeCCCCCCcCC
Confidence            455555     5555666555555677664  112   011234667777777  899999998887777665


Done!