Diaphorina citri psyllid: psy4625

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120

PRSRRIKSGKDKRSKEKRPRTAFSGEQLSRLKVEFTENRYLTERRRQELANELGLNEAQIKIWFQNKRAKIKKASGQKNPLALQLMAQGLYNHSTVPMSDEEMEMELSLLNKANSNNQNN

ccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHcccccHHHHHHHccccccccccccccHHHHHHHHHcccccccccc

***********************SGEQLSRLKVEFTENRYLTERRRQELANELGLNEAQIKIWFQNKRA*************LQLMA**L******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

PRSRRIKSGKDKRSKEKRPRTAFSGEQLSRLKVEFTENRYLTERRRQELANELGLNEAQIKIWFQNKRAKIKKASGQKNPLALQLMAQGLYNHSTVPMSDEEMEMELSLLNKANSNNQNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox protein E60 (Fragment)		confident	P09075
Homeobox protein E30 (Fragment)		confident	P09076
Homeobox protein engrailed-2		confident	P09066

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0010557 [BP]	positive regulation of macromolecule biosynthetic process	confident	GO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010604
GO:0044464 [CC]	cell part	confident	GO:0005575, GO:0005623
GO:0031328 [BP]	positive regulation of cellular biosynthetic process	confident	GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:2000112 [BP]	regulation of cellular macromolecule biosynthetic process	confident	GO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0080090 [BP]	regulation of primary metabolic process	confident	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010468 [BP]	regulation of gene expression	confident	GO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0030917 [BP]	midbrain-hindbrain boundary development	probable	GO:0021903, GO:0021532, GO:0009790, GO:0009792, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048513, GO:0043009, GO:0032502, GO:0032501, GO:0021915, GO:0044767, GO:0008150, GO:0003002, GO:0048731, GO:0009952, GO:0007420, GO:0044707, GO:0048856, GO:0007399
GO:0042327 [BP]	positive regulation of phosphorylation	probable	GO:0042325, GO:0019220, GO:0009893, GO:0045937, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0031325, GO:0048522
GO:0030175 [CC]	filopodium	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009954 [BP]	proximal/distal pattern formation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0007411 [BP]	axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0009953 [BP]	dorsal/ventral pattern formation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0043473 [BP]	pigmentation	probable	GO:0008150, GO:0044699
GO:0030027 [CC]	lamellipodium	probable	GO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0035115 [BP]	embryonic forelimb morphogenesis	probable	GO:0048598, GO:0032502, GO:0035108, GO:0044707, GO:0030326, GO:0060173, GO:0035107, GO:0044767, GO:0009790, GO:0032501, GO:0035136, GO:0044699, GO:0035113, GO:0008150, GO:0009653, GO:0007275, GO:0048736, GO:0048856
GO:0045727 [BP]	positive regulation of translation	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0030901 [BP]	midbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030902 [BP]	hindbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030426 [CC]	growth cone	probable	GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001078 [MF]	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription	probable	GO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0000980 [MF]	RNA polymerase II distal enhancer sequence-specific DNA binding	probable	GO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0048103 [BP]	somatic stem cell division	probable	GO:0009987, GO:0008150, GO:0051301, GO:0044763, GO:0017145, GO:0044699
GO:0048100 [BP]	wing disc anterior/posterior pattern formation	probable	GO:0032502, GO:0007389, GO:0048856, GO:0007447, GO:0009952, GO:0044707, GO:0007444, GO:0032501, GO:0007448, GO:0035222, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0030855 [BP]	epithelial cell differentiation	probable	GO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0009888, GO:0044763, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0035270 [BP]	endocrine system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035277 [BP]	spiracle morphogenesis, open tracheal system	probable	GO:0032502, GO:0007424, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048099 [BP]	anterior/posterior lineage restriction, imaginal disc	probable	GO:0032502, GO:0007389, GO:0032501, GO:0007447, GO:0009952, GO:0044707, GO:0007444, GO:0007448, GO:0035161, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699, GO:0048856
GO:0048704 [BP]	embryonic skeletal system morphogenesis	probable	GO:0048705, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0048513, GO:0009790, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0001501, GO:0048706, GO:0008150, GO:0009792, GO:0048731, GO:0043009, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0031490 [MF]	chromatin DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0007400 [BP]	neuroblast fate determination	probable	GO:0030154, GO:0007275, GO:0044699, GO:0014016, GO:0048863, GO:0048865, GO:0048867, GO:0048869, GO:0001709, GO:0008150, GO:0032502, GO:0032501, GO:0009987, GO:0014017, GO:0044763, GO:0022008, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0035289 [BP]	posterior head segmentation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0060322, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699, GO:0035287
GO:0035288 [BP]	anterior head segmentation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0097065, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009880, GO:0060322, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699, GO:0035287
GO:0043065 [BP]	positive regulation of apoptotic process	probable	GO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0007476 [BP]	imaginal disc-derived wing morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0001568 [BP]	blood vessel development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0071837 [MF]	HMG box domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0007487 [BP]	analia development	probable	GO:0032502, GO:0035215, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007486 [BP]	imaginal disc-derived female genitalia development	probable	GO:0061458, GO:0032501, GO:0048608, GO:0007275, GO:0044699, GO:0000003, GO:0003006, GO:0030540, GO:0045137, GO:0048513, GO:0048806, GO:0032502, GO:0035215, GO:0007484, GO:0046545, GO:0044767, GO:0022414, GO:0008150, GO:0046660, GO:0007548, GO:0044707, GO:0007444, GO:0048856, GO:0048731
GO:0007485 [BP]	imaginal disc-derived male genitalia development	probable	GO:0032502, GO:0035215, GO:0007484, GO:0048608, GO:0000003, GO:0044707, GO:0007444, GO:0061458, GO:0032501, GO:0048856, GO:0022414, GO:0007548, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0048732 [BP]	gland development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0042220 [BP]	response to cocaine	probable	GO:1901700, GO:0009719, GO:0050896, GO:0060359, GO:0010243, GO:0010033, GO:0008150, GO:0043279, GO:0042221, GO:1901698, GO:0014070
GO:0035290 [BP]	trunk segmentation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699
GO:2000738 [BP]	positive regulation of stem cell differentiation	probable	GO:2000736, GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030054 [CC]	cell junction	probable	GO:0005575
GO:0042127 [BP]	regulation of cell proliferation	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0022603 [BP]	regulation of anatomical structure morphogenesis	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0048646 [BP]	anatomical structure formation involved in morphogenesis	probable	GO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0060041 [BP]	retina development in camera-type eye	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001708 [BP]	cell fate specification	probable	GO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0060218 [BP]	hematopoietic stem cell differentiation	probable	GO:0032502, GO:0002376, GO:0048863, GO:0044707, GO:0048856, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0021960 [BP]	anterior commissure morphogenesis	probable	GO:0021537, GO:0048666, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0007417, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0048513, GO:0071840, GO:0021955, GO:0021954, GO:0021953, GO:0021952, GO:0032502, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0022008, GO:0032990, GO:0007420, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0044763, GO:0048812, GO:0030900, GO:0048731
GO:0007388 [BP]	posterior compartment specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0007386, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0010870 [BP]	positive regulation of receptor biosynthetic process	probable	GO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0031325, GO:0031323, GO:0010604, GO:0050794, GO:0010869, GO:0010557, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051216 [BP]	cartilage development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045647 [BP]	negative regulation of erythrocyte differentiation	probable	GO:0051093, GO:0050793, GO:0045646, GO:0045595, GO:0032844, GO:0050789, GO:0045596, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0050794, GO:0045637, GO:0048523
GO:0008406 [BP]	gonad development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0045137, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045639 [BP]	positive regulation of myeloid cell differentiation	probable	GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0050789, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0002682, GO:0045637, GO:0048522
GO:0002009 [BP]	morphogenesis of an epithelium	probable	GO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0048663 [BP]	neuron fate commitment	probable	GO:0032502, GO:0048699, GO:0045165, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0007418 [BP]	ventral midline development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PUF, chain A
Confidence level:very confident
Coverage over the Query: 11-76
View the alignment between query and template
View the model in PyMOL