Diaphorina citri psyllid: psy4634


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MTATSLGSTYIGFMPQETALFDEFTIAETFQFYASLYRISSEEFRAKMKELQEVLDLPPDHRTCSTLSGGQVRRVSIAVTLLHTPSLVILDEPTSGLDPMLAHYFWQYLQRMSSNGQTIIITTHYIEEARQANVVGLMRKGVLLAEKSPEELIASYGVDSLEEVFLRLCHQQNQAIEAEPEKGPNKKGLVGGVRVIEILAGYTIVLVLYNLINIAAMSLVQFVIYGQPYGNFWLSYVLINFIGFTGIFF
ccccccccccccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHccEEEEEEccEEEEcccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccEEEEEEEEccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHcccccc
******G*TYIGFMPQETALFDEFTIAETFQFYASLYRISSEEFRAKMKELQEVLDLPPDHRTCSTLSGGQVRRVSIAVTLLHTPSLVILDEPTSGLDPMLAHYFWQYLQRMSSNGQTIIITTHYIEEARQANVVGLMRKGVLLAEKSPEELIASYGVDSLEEVFLRLCHQQ***************GLVGGVRVIEILAGYTIVLVLYNLINIAAMSLVQFVIYGQPYGNFWLSYVLINFIGFTGIFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTATSLGSTYIGFMPQETALFDEFTIAETFQFYASLYRISSEEFRAKMKELQEVLDLPPDHRTCSTLSGGQVRRVSIAVTLLHTPSLVILDEPTSGLDPMLAHYFWQYLQRMSSNGQTIIITTHYIEEARQANVVGLMRKGVLLAEKSPEELIASYGVDSLEEVFLRLCHQQNQAIEAEPEKGPNKKGLVGGVRVIEILAGYTIVLVLYNLINIAAMSLVQFVIYGQPYGNFWLSYVLINFIGFTGIFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0022892 [MF]substrate-specific transporter activityprobableGO:0005215, GO:0003674
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VPL, chain A
Confidence level:very confident
Coverage over the Query: 9-167
View the alignment between query and template
View the model in PyMOL