BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy4648
         (116 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2GJL|A Chain A, Crystal Structure Of 2-Nitropropane Dioxygenase
 pdb|2GJN|A Chain A, Crystal Structure Of 2-Nitropropane Dioxygenase Complexed
           With Fmn And Substrate
          Length = 328

 Score = 30.0 bits (66), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 3   EITASSSTQRDFRLYVRLALIMGLTWSVGLFAGYIDNEP 41
           +I A  S QR  ++Y +    +G+ WS G+  G ID+EP
Sbjct: 263 DIAALVSGQRGRQVYQQGDTDLGI-WSAGMVQGLIDDEP 300


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.138    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,433,392
Number of Sequences: 62578
Number of extensions: 68238
Number of successful extensions: 134
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 1
length of query: 116
length of database: 14,973,337
effective HSP length: 79
effective length of query: 37
effective length of database: 10,029,675
effective search space: 371097975
effective search space used: 371097975
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)