Query         psy4648
Match_columns 116
No_of_seqs    127 out of 836
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 22:08:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4648.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4648hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4193|consensus               99.8 3.8E-19 8.3E-24  152.6   9.6   88   12-99    514-604 (610)
  2 KOG4564|consensus               98.7 1.6E-08 3.4E-13   85.2   4.9   70   10-79    349-421 (473)
  3 PF00002 7tm_2:  7 transmembran  98.6   5E-09 1.1E-13   78.9   0.0   46   12-57    195-242 (242)
  4 KOG4289|consensus               98.4   1E-06 2.2E-11   81.8   8.1   60   13-72   2339-2399(2531)
  5 PF05462 Dicty_CAR:  Slime mold  87.4     3.3 7.1E-05   33.3   7.3   54   22-75    209-268 (303)
  6 PF01102 Glycophorin_A:  Glycop  73.9     3.9 8.5E-05   28.9   2.9   26   40-65     65-90  (122)
  7 PF10323 7TM_GPCR_Srv:  Serpent  69.7      32  0.0007   26.8   7.5   24   54-77    260-283 (283)
  8 PF02101 Ocular_alb:  Ocular al  68.4       9 0.00019   32.3   4.3   46   16-61    245-310 (405)
  9 PF12273 RCR:  Chitin synthesis  59.5     6.7 0.00015   27.3   1.8   21   44-64      3-23  (130)
 10 PF10328 7TM_GPCR_Srx:  Serpent  47.2      45 0.00097   25.5   4.7   58   15-75    206-273 (274)
 11 KOG4812|consensus               44.4      37 0.00081   27.0   3.9   30   41-74    224-254 (262)
 12 PHA03087 G protein-coupled che  44.1      87  0.0019   24.2   6.0   70    9-78    238-324 (335)
 13 PF14110 DUF4282:  Domain of un  36.6 1.2E+02  0.0026   19.7   5.3   49   20-68     21-69  (90)
 14 KOG4219|consensus               32.1   1E+02  0.0022   26.4   4.8   69   10-78    256-336 (423)
 15 PHA03235 DNA packaging protein  31.6 2.2E+02  0.0048   23.5   6.8   19   59-77    304-323 (409)
 16 PHA03240 envelope glycoprotein  30.8      92   0.002   24.5   4.1   20   55-74    223-244 (258)
 17 TIGR00869 sec62 protein transl  28.7 1.1E+02  0.0024   23.9   4.3   38   21-58    119-163 (232)
 18 PRK14749 hypothetical protein;  28.6      70  0.0015   17.3   2.2    7   27-33      5-11  (30)
 19 COG4890 Predicted outer membra  27.6      71  0.0015   17.9   2.2    7   27-33      5-11  (37)
 20 PF13994 PgaD:  PgaD-like prote  26.0 2.2E+02  0.0048   19.9   5.1   17   99-115   120-136 (138)
 21 PF11970 Git3_C:  G protein-cou  25.6 1.9E+02   0.004   18.5   4.3   25   42-66     48-72  (76)
 22 TIGR02106 cyd_oper_ybgT cyd op  24.7      90   0.002   16.9   2.2    7   27-33      5-11  (30)
 23 PHA03351 tegument protein UL16  23.6      27 0.00059   26.5   0.1   16   21-36      8-23  (235)
 24 PF08173 YbgT_YccB:  Membrane b  22.5 1.1E+02  0.0023   16.3   2.2    7   27-33      5-11  (28)
 25 PF09680 Tiny_TM_bacill:  Prote  21.1      69  0.0015   16.5   1.3   15   15-29     10-24  (24)
 26 PHA03105 EEV glycoprotein; Pro  20.6 1.5E+02  0.0032   22.4   3.4   24   51-74     14-37  (188)

No 1  
>KOG4193|consensus
Probab=99.79  E-value=3.8e-19  Score=152.58  Aligned_cols=88  Identities=25%  Similarity=0.350  Sum_probs=69.5

Q ss_pred             HHHHHHHHHHHhhchhhhhhhhhhcc-CcchHHHHHHHHhhHHHHHHHHHHhc-CHHHHHHHHHhhcccCCCCCC-Ccee
Q psy4648          12 RDFRLYVRLALIMGLTWSVGLFAGYI-DNEPLWYAFIALNTLQGVFIFLAFTC-TNKMIRNLFKSSSSINRPIRP-ASFS   88 (116)
Q Consensus        12 ~~~~~~~~L~~lmG~tWi~g~l~~~~-~~~~~~ylf~ilnslQG~fIFl~~~l-~~~V~~~~~k~~~~~~~~~~~-~~~s   88 (116)
                      +..+.++.|++|||+||+||++++.. ....++|+|+++|++||+|||++||+ ++++|++|+|++.+..++.+. +..+
T Consensus       514 ~~~~~~l~L~~lLGlTW~fgi~s~~~~~~~v~~YlFti~NalQG~fIFi~~cll~~kvr~~~~k~~~~~~~~~~~~~~~s  593 (610)
T KOG4193|consen  514 SLIRSALALLFLLGLTWIFGIFSWLPGTSVVFAYLFTIFNALQGVFIFIFHCLLRKKVRKEYRKWLCCGRGDSSASENGS  593 (610)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHhhhhHhhHhhhhhhHHHHHHHHHHhcccCCCCCCCcccc
Confidence            44788889999999999999999998 56789999999999999999999998 689999999999866544333 3334


Q ss_pred             eccccccCccc
Q psy4648          89 CSNTDMSNNTN   99 (116)
Q Consensus        89 ~s~t~~~~~~~   99 (116)
                      .+++.+...++
T Consensus       594 ~~~s~~~~~~~  604 (610)
T KOG4193|consen  594 LTSSSSRNSSR  604 (610)
T ss_pred             ccccccccccc
Confidence            33333333333


No 2  
>KOG4564|consensus
Probab=98.71  E-value=1.6e-08  Score=85.20  Aligned_cols=70  Identities=17%  Similarity=0.239  Sum_probs=55.0

Q ss_pred             hHHHHHHHHHHHHhhchhhhhhhhhhccC--cchHHHHHHHHhhHHHHHHHHHHhc-CHHHHHHHHHhhcccC
Q psy4648          10 TQRDFRLYVRLALIMGLTWSVGLFAGYID--NEPLWYAFIALNTLQGVFIFLAFTC-TNKMIRNLFKSSSSIN   79 (116)
Q Consensus        10 ~~~~~~~~~~L~~lmG~tWi~g~l~~~~~--~~~~~ylf~ilnslQG~fIFl~~~l-~~~V~~~~~k~~~~~~   79 (116)
                      .++-.|+.+.|.|++|++.++-......+  ..+..|+-..++++||+|+.++||+ |+||+.++||+|+++.
T Consensus       349 y~K~vKaTLvLIPLfGI~~ilf~~~P~~~~~~~v~~~~~~~L~SfQGf~VAvlYCFlN~EVq~elrr~W~r~~  421 (473)
T KOG4564|consen  349 YRKLVKATLVLIPLFGIHYILFAFRPDEDTLREVYLYFELFLGSFQGFFVAVLYCFLNGEVQAELRRKWSRWR  421 (473)
T ss_pred             HHHHHHHHHHHHHHcCCeeEEEEecCchHHHHHHHHHHHHHHHhccchheehheeecCHHHHHHHHHHHHhcC
Confidence            56667888899999999986644443322  1233477778999999999999996 9999999999998873


No 3  
>PF00002 7tm_2:  7 transmembrane receptor (Secretin family);  InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The secretin-like GPCRs include secretin [], calcitonin [], parathyroid hormone/parathyroid hormone-related peptides [] and vasoactive intestinal peptide [], all of which activate adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. These receptors contain seven transmembrane regions, in a manner reminiscent of the rhodopsins and other receptors believed to interact with G-proteins (however there is no significant sequence identity between these families, the secretin-like receptors thus bear their own unique '7TM' signature). Their N terminus is probably located on the extracellular side of the membrane and potentially glycosylated. This N-terminal region contains a long conserved region which allow the binding of large peptidic ligand such as glucagon, secretin, VIP and PACAP; this region contains five conserved cysteines residues which could be involved in disulphide bond. The C-terminal region of these receptor is probably cytoplasmic. Every receptor gene in this family is encoded on multiple exons, and several of these genes are alternatively spliced to yield functionally distinct products. ; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane; PDB: 3L2J_A 1BL1_A.
Probab=98.64  E-value=5e-09  Score=78.93  Aligned_cols=46  Identities=37%  Similarity=0.601  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhhchhhhhhhhhhcc--CcchHHHHHHHHhhHHHHHH
Q psy4648          12 RDFRLYVRLALIMGLTWSVGLFAGYI--DNEPLWYAFIALNTLQGVFI   57 (116)
Q Consensus        12 ~~~~~~~~L~~lmG~tWi~g~l~~~~--~~~~~~ylf~ilnslQG~fI   57 (116)
                      +..+..+.|++++|++|+++++++..  ....++|+|+++|++||++|
T Consensus       195 ~~~~~~~~L~~llg~~w~~~~~~~~~~~~~~~~~~lf~i~nslQG~~I  242 (242)
T PF00002_consen  195 KILRASLILLPLLGITWLFGILAVSDSVDSLVFQYLFAILNSLQGFFI  242 (242)
T ss_dssp             ------------------------------------------------
T ss_pred             hHHHHHHHHHHHHHHHheeeeeeecccchHHHHHHHHHHHHcCcceeC
Confidence            37888999999999999999999877  45678999999999999986


No 4  
>KOG4289|consensus
Probab=98.40  E-value=1e-06  Score=81.81  Aligned_cols=60  Identities=27%  Similarity=0.403  Sum_probs=55.1

Q ss_pred             HHHHHHHHHHhhchhhhhhhhhhccCcchHHHHHHHHhhHHHHHHHHHHhc-CHHHHHHHH
Q psy4648          13 DFRLYVRLALIMGLTWSVGLFAGYIDNEPLWYAFIALNTLQGVFIFLAFTC-TNKMIRNLF   72 (116)
Q Consensus        13 ~~~~~~~L~~lmG~tWi~g~l~~~~~~~~~~ylf~ilnslQG~fIFl~~~l-~~~V~~~~~   72 (116)
                      -++-.+.+++++|.||.+++++.......+.|+|..++.+||.|++++||+ +.++|++++
T Consensus      2339 ~lq~~fl~llllsatwl~~ll~vn~~~l~fhyl~a~~~~lqg~~Vlll~cVl~~~~raa~~ 2399 (2531)
T KOG4289|consen 2339 VLQHSFLLLLLLSATWLLGLLAVNPDPLEFHYLFASIIGLQGPFVLLLWCVLNIEVRAALK 2399 (2531)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHhcCCchHHHHHHHHHHHHhhhHHHHHHHhhhcHHHHHhhc
Confidence            466777889999999999999998888889999999999999999999996 899999996


No 5  
>PF05462 Dicty_CAR:  Slime mold cyclic AMP receptor
Probab=87.42  E-value=3.3  Score=33.26  Aligned_cols=54  Identities=20%  Similarity=0.247  Sum_probs=36.1

Q ss_pred             Hhhchhhhhhhhhhcc---C--cchHHHHHHHHhhHHHHHHHHHHhcCHHH-HHHHHHhh
Q psy4648          22 LIMGLTWSVGLFAGYI---D--NEPLWYAFIALNTLQGVFIFLAFTCTNKM-IRNLFKSS   75 (116)
Q Consensus        22 ~lmG~tWi~g~l~~~~---~--~~~~~ylf~ilnslQG~fIFl~~~l~~~V-~~~~~k~~   75 (116)
                      .++=+.|+++++.-..   +  +..+.++-+.+..+||++-.++|.+|++. ++.+..++
T Consensus       209 ~ifiicw~fa~INRI~~~~~~~~~~l~~Lh~~~s~lqGf~nsivy~~n~~~~~~~~~~~~  268 (303)
T PF05462_consen  209 LIFIICWIFATINRIYNFIGKNPFWLSVLHVGFSPLQGFFNSIVYGYNNSLMWRYLGSKI  268 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCchHHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHH
Confidence            3444589999874321   1  22344666678899999999999997665 55554444


No 6  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=73.91  E-value=3.9  Score=28.94  Aligned_cols=26  Identities=8%  Similarity=0.278  Sum_probs=21.6

Q ss_pred             chHHHHHHHHhhHHHHHHHHHHhcCH
Q psy4648          40 EPLWYAFIALNTLQGVFIFLAFTCTN   65 (116)
Q Consensus        40 ~~~~ylf~ilnslQG~fIFl~~~l~~   65 (116)
                      .....+|.++...=|+.++++||++|
T Consensus        65 ~i~~Ii~gv~aGvIg~Illi~y~irR   90 (122)
T PF01102_consen   65 AIIGIIFGVMAGVIGIILLISYCIRR   90 (122)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceeehhHHHHHHHHHHHHHHHHHHHH
Confidence            45678899999999999999999743


No 7  
>PF10323 7TM_GPCR_Srv:  Serpentine type 7TM GPCR chemoreceptor Srv;  InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class v (Srv) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=69.65  E-value=32  Score=26.81  Aligned_cols=24  Identities=0%  Similarity=0.025  Sum_probs=19.0

Q ss_pred             HHHHHHHHhcCHHHHHHHHHhhcc
Q psy4648          54 GVFIFLAFTCTNKMIRNLFKSSSS   77 (116)
Q Consensus        54 G~fIFl~~~l~~~V~~~~~k~~~~   77 (116)
                      ++=.+.+.++|+++|++.++.++|
T Consensus       260 ~inP~~LLi~n~~lr~~~~~~~~~  283 (283)
T PF10323_consen  260 FINPWMLLIFNKDLRKQVRRMLKC  283 (283)
T ss_pred             hhhhHHhhhccHHHHHHHHHHcCC
Confidence            333667888899999999988765


No 8  
>PF02101 Ocular_alb:  Ocular albinism type 1 protein;  InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes. A novel transcript from the OA1 critical region is expressed in high levels in RNA samples from retina and from melanoma and encodes a potential integral membrane protein []. This protein is of unknown function but is known to bind heterotrimeric G proteins.; GO: 0016020 membrane
Probab=68.38  E-value=9  Score=32.30  Aligned_cols=46  Identities=26%  Similarity=0.560  Sum_probs=32.0

Q ss_pred             HHHHHHHhhchhhhhhhhh----hc----cC------------cchHHHHHHHHhhHHHHHHHHHH
Q psy4648          16 LYVRLALIMGLTWSVGLFA----GY----ID------------NEPLWYAFIALNTLQGVFIFLAF   61 (116)
Q Consensus        16 ~~~~L~~lmG~tWi~g~l~----~~----~~------------~~~~~ylf~ilnslQG~fIFl~~   61 (116)
                      .++++.+++=+.|+.-++-    +.    .+            ....||+..++|.+||++-.+.|
T Consensus       245 kFf~I~lVF~iCWlpNIINg~LL~~l~~~~~i~~~sl~~~~~a~~t~W~IMaIlNPlQgfLnsLay  310 (405)
T PF02101_consen  245 KFFKIMLVFYICWLPNIINGSLLFYLEMQPDINGGSLKQVRNAALTTWFIMAILNPLQGFLNSLAY  310 (405)
T ss_pred             HHHHHHHHHHHHhhhhhHhHHHHHHhhcccccccccccchhhHHHHHHHHHHHHhHHHHHHHHHhh
Confidence            3445667777788765542    11    11            12479999999999999999987


No 9  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=59.49  E-value=6.7  Score=27.33  Aligned_cols=21  Identities=19%  Similarity=0.314  Sum_probs=10.5

Q ss_pred             HHHHHHhhHHHHHHHHHHhcC
Q psy4648          44 YAFIALNTLQGVFIFLAFTCT   64 (116)
Q Consensus        44 ylf~ilnslQG~fIFl~~~l~   64 (116)
                      .+|.++-.+=-+++|+++|.+
T Consensus         3 ~l~~iii~~i~l~~~~~~~~~   23 (130)
T PF12273_consen    3 VLFAIIIVAILLFLFLFYCHN   23 (130)
T ss_pred             eeHHHHHHHHHHHHHHHHHHH
Confidence            344444444445555555654


No 10 
>PF10328 7TM_GPCR_Srx:  Serpentine type 7TM GPCR chemoreceptor Srx;  InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class x (Srx) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=47.19  E-value=45  Score=25.46  Aligned_cols=58  Identities=14%  Similarity=0.231  Sum_probs=35.2

Q ss_pred             HHHHHHHHhhchhhhhhhhhhccC-----cchHHHHHH-----HHhhHHHHHHHHHHhcCHHHHHHHHHhh
Q psy4648          15 RLYVRLALIMGLTWSVGLFAGYID-----NEPLWYAFI-----ALNTLQGVFIFLAFTCTNKMIRNLFKSS   75 (116)
Q Consensus        15 ~~~~~L~~lmG~tWi~g~l~~~~~-----~~~~~ylf~-----ilnslQG~fIFl~~~l~~~V~~~~~k~~   75 (116)
                      +.+++-+++-|+..+++.+.+...     .....++.+     ..+++.|+.+   ..+|+|+|+.++|..
T Consensus       206 ~~f~~Qs~~Q~~~~~i~~~~~~~~~~~~~~~~~~F~~~t~~w~~~h~~DG~i~---l~fN~~~r~~~~~~~  273 (274)
T PF10328_consen  206 IRFFIQSFIQDLLYLIDLIFYFFIPPLSSNRWWQFFCTTFSWVLVHALDGLIM---LIFNSEIRRKIRKKK  273 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHhcceeE---eEEcHHHHHHHHhcc
Confidence            455566777777777777655422     233333333     3466677654   446899999988764


No 11 
>KOG4812|consensus
Probab=44.35  E-value=37  Score=27.01  Aligned_cols=30  Identities=33%  Similarity=0.475  Sum_probs=21.8

Q ss_pred             hHHHHHHHHhhHHHHHHHHHHhcC-HHHHHHHHHh
Q psy4648          41 PLWYAFIALNTLQGVFIFLAFTCT-NKMIRNLFKS   74 (116)
Q Consensus        41 ~~~ylf~ilnslQG~fIFl~~~l~-~~V~~~~~k~   74 (116)
                      ++|++|+++    |++||+--.++ -+|||++++-
T Consensus       224 wLwwi~~vl----G~ll~lr~~i~YikVrrm~~~~  254 (262)
T KOG4812|consen  224 WLWWIFLVL----GLLLFLRGFINYIKVRRMEEKY  254 (262)
T ss_pred             HHHHHHHHH----HHHHHHHHHHhHHHHhhHHHHH
Confidence            466766665    88888877776 5888887654


No 12 
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional
Probab=44.13  E-value=87  Score=24.25  Aligned_cols=70  Identities=10%  Similarity=0.151  Sum_probs=38.2

Q ss_pred             hhHHHHHHHHHHHHhhchhhhhhhhhhc---------cCc-c---hHHHHHH---HHhhHHHHHHHHHHhc-CHHHHHHH
Q psy4648           9 STQRDFRLYVRLALIMGLTWSVGLFAGY---------IDN-E---PLWYAFI---ALNTLQGVFIFLAFTC-TNKMIRNL   71 (116)
Q Consensus         9 s~~~~~~~~~~L~~lmG~tWi~g~l~~~---------~~~-~---~~~ylf~---ilnslQG~fIFl~~~l-~~~V~~~~   71 (116)
                      ++++..|..+.+..+.-+.|.-..+...         ... .   ...++..   .+-.+-+.+=-++|++ +++.|++.
T Consensus       238 ~~~k~~k~l~~iv~~f~i~w~P~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~ns~~NPiIY~~~~~~fr~~~  317 (335)
T PHA03087        238 KNKKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILHFKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHK  317 (335)
T ss_pred             hcchHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHHHHHHHHhhhhhHHHHcCHHHHHHH
Confidence            4455567777777777888866433211         111 1   1122222   2333345555566776 78888888


Q ss_pred             HHhhccc
Q psy4648          72 FKSSSSI   78 (116)
Q Consensus        72 ~k~~~~~   78 (116)
                      |+.++..
T Consensus       318 ~~~~~~~  324 (335)
T PHA03087        318 KKSLKLM  324 (335)
T ss_pred             HHHHHHH
Confidence            7776554


No 13 
>PF14110 DUF4282:  Domain of unknown function (DUF4282)
Probab=36.61  E-value=1.2e+02  Score=19.74  Aligned_cols=49  Identities=18%  Similarity=0.217  Sum_probs=24.8

Q ss_pred             HHHhhchhhhhhhhhhccCcchHHHHHHHHhhHHHHHHHHHHhcCHHHH
Q psy4648          20 LALIMGLTWSVGLFAGYIDNEPLWYAFIALNTLQGVFIFLAFTCTNKMI   68 (116)
Q Consensus        20 L~~lmG~tWi~g~l~~~~~~~~~~ylf~ilnslQG~fIFl~~~l~~~V~   68 (116)
                      ...+.++.|+.+++..............++.-+.|++.|+++.+--++.
T Consensus        21 ~li~i~l~~~~~~~~~~~~~~~~~~~~g~~~~l~~~~~~l~~~i~~Ri~   69 (90)
T PF14110_consen   21 GLILIVLSGLSGIFSGFMAGMGFSFGGGFLGLLLGPLGFLLGIILWRIM   69 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455555665555543311112223444445555777787777644433


No 14 
>KOG4219|consensus
Probab=32.10  E-value=1e+02  Score=26.35  Aligned_cols=69  Identities=7%  Similarity=0.131  Sum_probs=36.3

Q ss_pred             hHHHHHHHHHHHHhhchhhhhhhh----hhccCc----chHH--HHHHH-HhhHHHHHHHHHHhc-CHHHHHHHHHhhcc
Q psy4648          10 TQRDFRLYVRLALIMGLTWSVGLF----AGYIDN----EPLW--YAFIA-LNTLQGVFIFLAFTC-TNKMIRNLFKSSSS   77 (116)
Q Consensus        10 ~~~~~~~~~~L~~lmG~tWi~g~l----~~~~~~----~~~~--ylf~i-lnslQG~fIFl~~~l-~~~V~~~~~k~~~~   77 (116)
                      +++-.|+++...+.+++.|.-==+    ....+.    ....  |+..- +...--.+==++||+ |++-|..+++.|++
T Consensus       256 k~K~vkmliiVV~~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~gf~~~fr~  335 (423)
T KOG4219|consen  256 KKKVVKMLIIVVVIFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRGGFRRAFRW  335 (423)
T ss_pred             HHHHHHHHHHHHHHHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHHHHhhhhhe
Confidence            344456666677888888853211    111111    1122  22221 111112222255775 89999999999988


Q ss_pred             c
Q psy4648          78 I   78 (116)
Q Consensus        78 ~   78 (116)
                      +
T Consensus       336 c  336 (423)
T KOG4219|consen  336 C  336 (423)
T ss_pred             e
Confidence            7


No 15 
>PHA03235 DNA packaging protein UL33; Provisional
Probab=31.57  E-value=2.2e+02  Score=23.49  Aligned_cols=19  Identities=5%  Similarity=0.263  Sum_probs=11.4

Q ss_pred             HHHhc-CHHHHHHHHHhhcc
Q psy4648          59 LAFTC-TNKMIRNLFKSSSS   77 (116)
Q Consensus        59 l~~~l-~~~V~~~~~k~~~~   77 (116)
                      ++|++ +++.|+.+++.+++
T Consensus       304 iIY~~~~~~FRk~~~~~l~~  323 (409)
T PHA03235        304 ILYAFLGNDFLKRFRQCFRG  323 (409)
T ss_pred             HHHHHhhHHHHHHHHHHHhh
Confidence            44554 67777776665544


No 16 
>PHA03240 envelope glycoprotein M; Provisional
Probab=30.78  E-value=92  Score=24.55  Aligned_cols=20  Identities=10%  Similarity=0.245  Sum_probs=15.6

Q ss_pred             HHHHHHHhcC--HHHHHHHHHh
Q psy4648          55 VFIFLAFTCT--NKMIRNLFKS   74 (116)
Q Consensus        55 ~fIFl~~~l~--~~V~~~~~k~   74 (116)
                      +.|++++|++  +++++.|+.+
T Consensus       223 IiIIIL~cfKiPQKl~dKw~~~  244 (258)
T PHA03240        223 IIVIILFFFKIPQKLFDKWDLH  244 (258)
T ss_pred             HHHHHHHHHhccHHHHHHHhhh
Confidence            7888999986  6788777654


No 17 
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=28.72  E-value=1.1e+02  Score=23.94  Aligned_cols=38  Identities=13%  Similarity=0.141  Sum_probs=24.6

Q ss_pred             HHhhchhhhhhhhhhccCc-------chHHHHHHHHhhHHHHHHH
Q psy4648          21 ALIMGLTWSVGLFAGYIDN-------EPLWYAFIALNTLQGVFIF   58 (116)
Q Consensus        21 ~~lmG~tWi~g~l~~~~~~-------~~~~ylf~ilnslQG~fIF   58 (116)
                      ..++|+.+++++++...-+       ..+||+-..+-.+=|+++.
T Consensus       119 ~~l~~~~~~~~ila~~lFPlWP~~~r~gv~YlS~~~lgll~~~~~  163 (232)
T TIGR00869       119 DYLIVILVVSIILALVLFPLWPRFMRRGSWYLSLGALGIIGGFFA  163 (232)
T ss_pred             HHHHHHHHHHHHHHHhhcccChHHHhHhHHHHHHHHHHHHHHHHH
Confidence            4577888888888776443       2356877776666654443


No 18 
>PRK14749 hypothetical protein; Provisional
Probab=28.56  E-value=70  Score=17.28  Aligned_cols=7  Identities=43%  Similarity=1.184  Sum_probs=3.9

Q ss_pred             hhhhhhh
Q psy4648          27 TWSVGLF   33 (116)
Q Consensus        27 tWi~g~l   33 (116)
                      +|++|+.
T Consensus         5 aWiLG~~   11 (30)
T PRK14749          5 LWFVGIL   11 (30)
T ss_pred             HHHHHHH
Confidence            5666554


No 19 
>COG4890 Predicted outer membrane lipoprotein [Function unknown]
Probab=27.61  E-value=71  Score=17.92  Aligned_cols=7  Identities=43%  Similarity=1.303  Sum_probs=3.5

Q ss_pred             hhhhhhh
Q psy4648          27 TWSVGLF   33 (116)
Q Consensus        27 tWi~g~l   33 (116)
                      .|++|++
T Consensus         5 aWiLG~l   11 (37)
T COG4890           5 AWILGLL   11 (37)
T ss_pred             HHHHHHH
Confidence            4555543


No 20 
>PF13994 PgaD:  PgaD-like protein
Probab=26.01  E-value=2.2e+02  Score=19.92  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=11.6

Q ss_pred             cCCCCCcccccCCCCcC
Q psy4648          99 NSTKKSQIIHSDNHDML  115 (116)
Q Consensus        99 ~~~s~sq~i~~~~~~~~  115 (116)
                      -...|..+++-||||=+
T Consensus       120 lr~~k~~~V~~d~~G~I  136 (138)
T PF13994_consen  120 LRQAKVLTVHHDDHGRI  136 (138)
T ss_pred             HHhCCeEEEEeCCCCCc
Confidence            34467777888887744


No 21 
>PF11970 Git3_C:  G protein-coupled glucose receptor regulating Gpa2 C-term;  InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This family is the conserved C-terminal domain of the member proteins. 
Probab=25.60  E-value=1.9e+02  Score=18.54  Aligned_cols=25  Identities=24%  Similarity=0.256  Sum_probs=20.0

Q ss_pred             HHHHHHHHhhHHHHHHHHHHhcCHH
Q psy4648          42 LWYAFIALNTLQGVFIFLAFTCTNK   66 (116)
Q Consensus        42 ~~ylf~ilnslQG~fIFl~~~l~~~   66 (116)
                      +.++-.++-++||+.=.++|.++++
T Consensus        48 l~~i~~~~~~~~G~VD~lvf~~~er   72 (76)
T PF11970_consen   48 LFCIAGFMQPSQGFVDCLVFTLRER   72 (76)
T ss_pred             HHHHHHHHHHccCHHHhhheeeecc
Confidence            3466667899999999999998653


No 22 
>TIGR02106 cyd_oper_ybgT cyd operon protein YbgT. This model describes a very small (as short as 33 amino acids) protein of unknown function, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It begins with an aromatic motif MWYFXW and appears to contain a membrane-spanning helix. This protein appears to be restricted to the Proteobacteria and exist in a single copy only. We suggest it may be a membrane subunit of the terminal oxidase. The family is named after the E. coli member YbgT. This model excludes the apparently related protein YccB.
Probab=24.74  E-value=90  Score=16.86  Aligned_cols=7  Identities=29%  Similarity=1.051  Sum_probs=3.7

Q ss_pred             hhhhhhh
Q psy4648          27 TWSVGLF   33 (116)
Q Consensus        27 tWi~g~l   33 (116)
                      +|++|+.
T Consensus         5 aWilG~~   11 (30)
T TIGR02106         5 AWILGTL   11 (30)
T ss_pred             HHHHHHH
Confidence            5555544


No 23 
>PHA03351 tegument protein UL16; Provisional
Probab=23.63  E-value=27  Score=26.54  Aligned_cols=16  Identities=19%  Similarity=0.416  Sum_probs=12.2

Q ss_pred             HHhhchhhhhhhhhhc
Q psy4648          21 ALIMGLTWSVGLFAGY   36 (116)
Q Consensus        21 ~~lmG~tWi~g~l~~~   36 (116)
                      .|+||+.|+|.++...
T Consensus         8 vpmmgi~w~~fvlcls   23 (235)
T PHA03351          8 VPMMGIAWIFFVLCLS   23 (235)
T ss_pred             Ccchhhhhhhheeecc
Confidence            4789999998776543


No 24 
>PF08173 YbgT_YccB:  Membrane bound YbgT-like protein;  InterPro: IPR012994 This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in Escherichia coli. Members have a consensus motif (MWYFXW), which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to proteobacteria [].
Probab=22.53  E-value=1.1e+02  Score=16.27  Aligned_cols=7  Identities=29%  Similarity=1.198  Sum_probs=3.8

Q ss_pred             hhhhhhh
Q psy4648          27 TWSVGLF   33 (116)
Q Consensus        27 tWi~g~l   33 (116)
                      +|++|+.
T Consensus         5 aWilG~~   11 (28)
T PF08173_consen    5 AWILGVL   11 (28)
T ss_pred             HHHHHHH
Confidence            5555554


No 25 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=21.15  E-value=69  Score=16.45  Aligned_cols=15  Identities=20%  Similarity=0.264  Sum_probs=9.7

Q ss_pred             HHHHHHHHhhchhhh
Q psy4648          15 RLYVRLALIMGLTWS   29 (116)
Q Consensus        15 ~~~~~L~~lmG~tWi   29 (116)
                      .+++.|+++.|.+|.
T Consensus        10 vVLFILLiIvG~s~~   24 (24)
T PF09680_consen   10 VVLFILLIIVGASCF   24 (24)
T ss_pred             HHHHHHHHHhcceeC
Confidence            345566777787773


No 26 
>PHA03105 EEV glycoprotein; Provisional
Probab=20.58  E-value=1.5e+02  Score=22.35  Aligned_cols=24  Identities=21%  Similarity=0.492  Sum_probs=16.6

Q ss_pred             hHHHHHHHHHHhcCHHHHHHHHHh
Q psy4648          51 TLQGVFIFLAFTCTNKMIRNLFKS   74 (116)
Q Consensus        51 slQG~fIFl~~~l~~~V~~~~~k~   74 (116)
                      ++=-++.++++++++.+.+.++|+
T Consensus        14 SfiiLi~Yll~i~K~~iKKflkkk   37 (188)
T PHA03105         14 SFIVLILYIFFICKNTIKKFLKKK   37 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcc
Confidence            444456677777888888887644


Done!