Query         psy4661
Match_columns 59
No_of_seqs    114 out of 1046
Neff          7.4 
Searched_HMMs 46136
Date          Fri Aug 16 22:33:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4661.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4661hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0164|consensus               99.5 8.4E-14 1.8E-18   98.6   6.9   58    1-58    668-726 (1001)
  2 COG5022 Myosin heavy chain [Cy  99.5 9.8E-14 2.1E-18  102.5   7.3   58    1-58    718-775 (1463)
  3 KOG0162|consensus               99.4 4.7E-13   1E-17   95.2   6.7   57    1-57    668-725 (1106)
  4 KOG0161|consensus               99.4 5.9E-13 1.3E-17  100.7   6.8   57    2-58    747-803 (1930)
  5 PTZ00014 myosin-A; Provisional  99.4 9.7E-13 2.1E-17   94.1   7.5   55    1-55    747-804 (821)
  6 KOG0160|consensus               99.0 6.1E-10 1.3E-14   80.2   6.7   57    1-57    646-702 (862)
  7 KOG0163|consensus               98.5 2.7E-07 5.8E-12   66.9   5.7   52    1-52    747-837 (1259)
  8 PF00612 IQ:  IQ calmodulin-bin  98.3 2.2E-06 4.8E-11   35.7   3.6   20   29-48      2-21  (21)
  9 cd01384 MYSc_type_XI Myosin mo  98.3 3.9E-07 8.4E-12   64.6   1.7   26    1-26    648-673 (674)
 10 cd01386 MYSc_type_XVIII Myosin  98.0 2.2E-06 4.8E-11   61.7   0.6   23    1-23    745-767 (767)
 11 cd01378 MYSc_type_I Myosin mot  97.9 2.6E-06 5.7E-11   60.5   0.9   23    1-23    651-674 (674)
 12 smart00242 MYSc Myosin. Large   97.9 3.1E-06 6.8E-11   60.0   1.2   24    1-24    654-677 (677)
 13 cd01383 MYSc_type_VIII Myosin   97.9 2.8E-06 6.2E-11   60.4   0.8   23    1-23    655-677 (677)
 14 cd01377 MYSc_type_II Myosin mo  97.9 3.3E-06 7.2E-11   60.1   0.8   23    1-23    671-693 (693)
 15 cd01382 MYSc_type_VI Myosin mo  97.9 5.5E-06 1.2E-10   59.2   1.8   22    1-22    694-715 (717)
 16 cd01380 MYSc_type_V Myosin mot  97.9 4.3E-06 9.3E-11   59.5   0.8   23    1-23    669-691 (691)
 17 smart00015 IQ Short calmodulin  97.9 3.2E-05   7E-10   33.5   3.3   22   27-48      2-23  (26)
 18 cd01387 MYSc_type_XV Myosin mo  97.9 4.7E-06   1E-10   59.2   0.8   23    1-23    655-677 (677)
 19 cd01379 MYSc_type_III Myosin m  97.8 7.1E-06 1.5E-10   58.2   1.0   23    1-23    631-653 (653)
 20 cd01381 MYSc_type_VII Myosin m  97.8 8.1E-06 1.7E-10   58.0   0.8   23    1-23    649-671 (671)
 21 cd00124 MYSc Myosin motor doma  97.7 1.2E-05 2.5E-10   57.1   0.7   23    1-23    657-679 (679)
 22 cd01385 MYSc_type_IX Myosin mo  97.3 0.00011 2.3E-09   52.6   1.6   23    1-23    666-688 (692)
 23 KOG4427|consensus               91.5     0.7 1.5E-05   34.7   5.5   28   25-52     27-54  (1096)
 24 KOG0942|consensus               87.3     1.2 2.7E-05   33.7   4.2   27   26-52     27-53  (1001)
 25 KOG0160|consensus               82.4     2.9 6.2E-05   31.5   4.3   28   27-54    717-744 (862)
 26 KOG0165|consensus               75.4       5 0.00011   30.4   3.7   24   28-51    943-966 (1023)
 27 KOG0377|consensus               70.4      13 0.00028   26.7   4.6   30   20-49      9-38  (631)
 28 PF15157 IQ-like:  IQ-like       64.5      11 0.00023   21.1   2.7   20   27-46     46-65  (97)
 29 PTZ00014 myosin-A; Provisional  59.1      25 0.00055   26.4   4.6   20   27-46    799-818 (821)
 30 KOG1419|consensus               48.9      26 0.00057   25.7   3.2   24   20-43    328-355 (654)
 31 KOG0520|consensus               48.1      42 0.00091   26.0   4.3   33   23-55    909-941 (975)
 32 PF14202 TnpW:  Transposon-enco  36.6      26 0.00055   16.2   1.2   21    2-22      5-29  (37)
 33 PF07106 TBPIP:  Tat binding pr  31.9      20 0.00044   21.2   0.5   10    4-13     53-62  (169)
 34 COG4072 Uncharacterized protei  29.5      25 0.00054   21.3   0.6   15    1-15     77-91  (161)
 35 PF04852 DUF640:  Protein of un  29.3      23 0.00049   21.1   0.4    7    3-9      60-66  (132)
 36 PF03719 Ribosomal_S5_C:  Ribos  21.1      43 0.00094   17.6   0.5   12    3-14      4-15  (74)
 37 KOG2128|consensus               20.9 1.6E+02  0.0036   23.9   3.6   24   28-51    592-615 (1401)

No 1  
>KOG0164|consensus
Probab=99.49  E-value=8.4e-14  Score=98.62  Aligned_cols=58  Identities=29%  Similarity=0.513  Sum_probs=55.0

Q ss_pred             Ccccccceeecc-cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q psy4661           1 MVKWSHCTVFFR-AGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDR   58 (59)
Q Consensus         1 ~~q~G~TKVF~r-~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~~   58 (59)
                      |+.+|+||||+| +.+++.||+.|..++..+++.||+.||||++|.+|+++++....|+
T Consensus       668 d~a~G~TKIFIRsPrTLF~lEe~r~~~l~~lvtllQK~~RG~~~R~ry~rmka~~~ii~  726 (1001)
T KOG0164|consen  668 DVAFGRTKIFIRSPRTLFALEEQRAERLPSLVTLLQKAWRGWLARQRYRRMKASATIIR  726 (1001)
T ss_pred             hhhcCceeEEEecchhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            578999999999 5899999999999999999999999999999999999999988775


No 2  
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=99.49  E-value=9.8e-14  Score=102.46  Aligned_cols=58  Identities=29%  Similarity=0.481  Sum_probs=54.4

Q ss_pred             CcccccceeecccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDR   58 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~~   58 (59)
                      +||+|.||||||+|+++.||++|+..+..+++.||+.|||++.|++|....+...+++
T Consensus       718 ~YqiG~TKvFfKagvL~~LE~~Rd~~~~~~~~~iq~aiR~~~~rrr~~~~~k~i~~~~  775 (1463)
T COG5022         718 KYQIGNTKVFFKAGVLAALEDMRDAKLDNIATRIQRAIRGRYLRRRYLQALKRIKKIQ  775 (1463)
T ss_pred             heeccceeEEeeCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4999999999999999999999999999999999999999999999999888776654


No 3  
>KOG0162|consensus
Probab=99.42  E-value=4.7e-13  Score=95.16  Aligned_cols=57  Identities=21%  Similarity=0.362  Sum_probs=53.6

Q ss_pred             Ccccccceeecc-cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy4661           1 MVKWSHCTVFFR-AGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCD   57 (59)
Q Consensus         1 ~~q~G~TKVF~r-~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~   57 (59)
                      +||+|.||||+| +..++.||++|+.....++..||++||.|++|++|.++++...-+
T Consensus       668 qyQmG~tkVFiKnPEsLF~LEemRer~~d~~A~~IQkAWRrfv~rrky~k~ree~t~l  725 (1106)
T KOG0162|consen  668 QYQMGVTKVFIKNPESLFLLEEMRERKWDGMARRIQKAWRRFVARRKYEKMREEATKL  725 (1106)
T ss_pred             HhhccceeEEecChHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            699999999999 689999999999999999999999999999999999999877654


No 4  
>KOG0161|consensus
Probab=99.41  E-value=5.9e-13  Score=100.68  Aligned_cols=57  Identities=44%  Similarity=0.763  Sum_probs=55.1

Q ss_pred             cccccceeecccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q psy4661           2 VKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCDR   58 (59)
Q Consensus         2 ~q~G~TKVF~r~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~~   58 (59)
                      |.+|.||||||.|+++.||++|+..++.+++.+|+.||||++|+.|.+...+..|+.
T Consensus       747 yriG~tKvFfkaGvla~LEe~Rd~~ls~ii~~fQA~~Rg~l~r~~~~kr~~~~~ai~  803 (1930)
T KOG0161|consen  747 YRIGHTKVFFKAGVLAHLEEMRDEKLSQIITLFQAAIRGYLARKEFKKRLQQLDAIK  803 (1930)
T ss_pred             EeecceeeeehHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            789999999999999999999999999999999999999999999999999988874


No 5  
>PTZ00014 myosin-A; Provisional
Probab=99.41  E-value=9.7e-13  Score=94.13  Aligned_cols=55  Identities=9%  Similarity=0.233  Sum_probs=49.2

Q ss_pred             CcccccceeecccchHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRDDRLG---KIVGWMQSYMRGYLSRKEYKKIQEQRY   55 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~~~l~---~~~~~iQ~~~rg~~~r~~~~~~~~~~~   55 (59)
                      +|++|+||||||++++..||+.++.++.   .+++.||++||||++|++|.+.+.+..
T Consensus       747 ~~~iGkTKVFlr~~~~~~Le~~~~~~~~~~~~~~~~iq~~~r~~~~r~~~~~~~~~~~  804 (821)
T PTZ00014        747 SYAIGKTMVFLKKDAAKELTQIQREKLAAWEPLVSVLEALILKIKKKRKVRKNIKSLV  804 (821)
T ss_pred             cEEecCCeEEEcCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5999999999999999999998888864   688899999999999999999876543


No 6  
>KOG0160|consensus
Probab=99.05  E-value=6.1e-10  Score=80.20  Aligned_cols=57  Identities=26%  Similarity=0.457  Sum_probs=53.7

Q ss_pred             CcccccceeecccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRYCD   57 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~~~   57 (59)
                      .||+|+||||++.|....||..|...+..+++.||+.+|+|+.|+.|..++.....+
T Consensus       646 ~yq~g~tkif~r~gq~~~le~~R~~vl~~~~~~iq~~~r~~~~r~~f~~~r~~~~~~  702 (862)
T KOG0160|consen  646 LYQIGKTKIFLRAGQIAVLEARRSDVLSAAKVLIQRQIRGYLARKKFLQLRSAVIII  702 (862)
T ss_pred             ceeeeeeeeeeccchhHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            389999999999999999999999999999999999999999999999998877654


No 7  
>KOG0163|consensus
Probab=98.51  E-value=2.7e-07  Score=66.85  Aligned_cols=52  Identities=29%  Similarity=0.456  Sum_probs=40.3

Q ss_pred             CcccccceeecccchHHHHHH-HHHH---H-----------------------------------HHHHHHHHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEE-LRDD---R-----------------------------------LGKIVGWMQSYMRGY   41 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~-~r~~---~-----------------------------------l~~~~~~iQ~~~rg~   41 (59)
                      ||++|.|||||++|-....++ ++.+   .                                   -...++++|+++|||
T Consensus       747 DfkFGlTKVFFr~GKFaEFDqiMksDPe~m~~lv~kVn~WLv~sRWkk~q~~a~sVIKLkNkI~yRae~v~k~Q~~~Rg~  826 (1259)
T KOG0163|consen  747 DFKFGLTKVFFRPGKFAEFDQIMKSDPETMLELVAKVNKWLVRSRWKKSQYGALSVIKLKNKIIYRAECVLKAQRIARGY  826 (1259)
T ss_pred             cccccceeEeecCcchHHHHHHHhcCHHHHHHHHHHHHHHHHHhHHHHhhhhhhheeehhhHHHHHHHHHHHHHHHHHHH
Confidence            689999999999998877665 2222   0                                   115678999999999


Q ss_pred             HHHHHHHHHHH
Q psy4661          42 LSRKEYKKIQE   52 (59)
Q Consensus        42 ~~r~~~~~~~~   52 (59)
                      ++|++|.+...
T Consensus       827 L~rkr~~~ri~  837 (1259)
T KOG0163|consen  827 LARKRHRPRIA  837 (1259)
T ss_pred             HHHhhhchHHH
Confidence            99999987543


No 8  
>PF00612 IQ:  IQ calmodulin-binding motif;  InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K. The IQ motif, which can be present in one or more copies, serves as a binding site for different EF-hand proteins including the essential and regulatory myosin light chains, calmodulin (CaM), and CaM-like proteins [, ].Many IQ motifs are protein kinase C (PKC) phosphorylation sites [, ]. Resolution of the 3D structure of scallop myosin has shown that the IQ motif forms a basic amphipathic helix []. Some proteins known to contain an IQ motif are listed below:  A number of conventional and unconventional myosins. Neuromodulin (GAP-43). This protein is associated with nerve growth. It is a major component of the motile "growth cones" that form the tips of elongating axons. Neurogranin (NG/p17). Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Sperm surface protein Sp17. Ras GTPase-activating-like protein IQGAP1. IQGAP1 contains 4 IQ motifs.   This entry covers the entire IQ motif.; GO: 0005515 protein binding; PDB: 2DFS_A 2IX7_C 1OE9_A 1W7J_A 1W7I_A 1KQM_A 1KK7_A 1WDC_A 1DFL_A 1B7T_A ....
Probab=98.28  E-value=2.2e-06  Score=35.68  Aligned_cols=20  Identities=60%  Similarity=0.898  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy4661          29 KIVGWMQSYMRGYLSRKEYK   48 (59)
Q Consensus        29 ~~~~~iQ~~~rg~~~r~~~~   48 (59)
                      .+++.||+.||||++|+.|+
T Consensus         2 ~aai~iQ~~~R~~~~Rk~~k   21 (21)
T PF00612_consen    2 KAAIIIQSYWRGYLARKRYK   21 (21)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhcC
Confidence            57889999999999999985


No 9  
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=98.26  E-value=3.9e-07  Score=64.64  Aligned_cols=26  Identities=23%  Similarity=0.437  Sum_probs=24.4

Q ss_pred             CcccccceeecccchHHHHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRDDR   26 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~~~   26 (59)
                      +|++|+||||||+++++.||+.|++.
T Consensus       648 ~~~~GktkVFlr~~~~~~LE~~R~~~  673 (674)
T cd01384         648 GYQIGKTKVFLRAGQMAELDARRTEV  673 (674)
T ss_pred             CEEecCeeEEEcCCHHHHHHHHHHhc
Confidence            59999999999999999999999875


No 10 
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=97.96  E-value=2.2e-06  Score=61.66  Aligned_cols=23  Identities=48%  Similarity=0.794  Sum_probs=21.3

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||.++++.||+.|
T Consensus       745 ~~~iGkTKVFlr~~~~~~LE~~R  767 (767)
T cd01386         745 SYRIGHSQVFFRAGVLSRLEAQR  767 (767)
T ss_pred             eEEeecceEEecccHHHHHhccC
Confidence            59999999999999999999865


No 11 
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=97.95  E-value=2.6e-06  Score=60.46  Aligned_cols=23  Identities=26%  Similarity=0.407  Sum_probs=20.8

Q ss_pred             Ccccccceeecccc-hHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAG-VLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~-~~~~LE~~r   23 (59)
                      +|++|+||||||+| +++.||+.|
T Consensus       651 ~~~~GkTkVFlr~~~~l~~le~~R  674 (674)
T cd01378         651 EYQMGKTKIFIRNPETLFALEEMR  674 (674)
T ss_pred             cEEecCceEEEeCchhHHHHHhcC
Confidence            59999999999986 899999875


No 12 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=97.94  E-value=3.1e-06  Score=60.02  Aligned_cols=24  Identities=38%  Similarity=0.673  Sum_probs=22.4

Q ss_pred             CcccccceeecccchHHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELRD   24 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r~   24 (59)
                      +|++|+||||||+++++.||+.|+
T Consensus       654 ~~~iGkTkVFlk~~~~~~Le~~R~  677 (677)
T smart00242      654 EYQLGKTKVFLRPGQLAELEELRE  677 (677)
T ss_pred             cEEecCceEeECccHHHHHHhhcC
Confidence            599999999999999999999885


No 13 
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=97.93  E-value=2.8e-06  Score=60.36  Aligned_cols=23  Identities=35%  Similarity=0.693  Sum_probs=21.3

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||.++++.||+.|
T Consensus       655 ~~~~GkTKVFlr~~~~~~LE~~r  677 (677)
T cd01383         655 MYQVGYTKLFFRTGQIGALEDTR  677 (677)
T ss_pred             cEEeccceEEecCcHHHHHhhcC
Confidence            59999999999999999999865


No 14 
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=97.91  E-value=3.3e-06  Score=60.12  Aligned_cols=23  Identities=52%  Similarity=0.983  Sum_probs=21.4

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||++++..||+.|
T Consensus       671 ~~~~G~TKVFlk~~~~~~LE~~R  693 (693)
T cd01377         671 QYRFGHTKVFFRAGVLAHLEEMR  693 (693)
T ss_pred             cEEecCCeEeECccHHHHHhhcC
Confidence            59999999999999999999865


No 15 
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=97.90  E-value=5.5e-06  Score=59.23  Aligned_cols=22  Identities=27%  Similarity=0.623  Sum_probs=20.6

Q ss_pred             CcccccceeecccchHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEEL   22 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~   22 (59)
                      +|++|+||||||+|+++.||++
T Consensus       694 ~~~~GkTKVFlr~g~~~~le~~  715 (717)
T cd01382         694 DYKFGLTKVFFRPGKFAEFDQI  715 (717)
T ss_pred             cEEecceeEEecccHHHHHHHH
Confidence            5999999999999999999975


No 16 
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=97.87  E-value=4.3e-06  Score=59.54  Aligned_cols=23  Identities=35%  Similarity=0.703  Sum_probs=21.3

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||++++..||+.|
T Consensus       669 ~~~~G~tkVFlk~~~~~~LE~~R  691 (691)
T cd01380         669 KYQFGKTKIFFRAGQVAFLEKLR  691 (691)
T ss_pred             cEEecCceEEECcCHHHHHhhcC
Confidence            59999999999999999999865


No 17 
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues. Calmodulin-binding motif.
Probab=97.86  E-value=3.2e-05  Score=33.54  Aligned_cols=22  Identities=45%  Similarity=0.685  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy4661          27 LGKIVGWMQSYMRGYLSRKEYK   48 (59)
Q Consensus        27 l~~~~~~iQ~~~rg~~~r~~~~   48 (59)
                      ...+++.||+.||||++|+.|.
T Consensus         2 ~~~aa~~IQa~~Rg~~~r~~y~   23 (26)
T smart00015        2 LTRAAIIIQAAWRGYLARKRYK   23 (26)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhh
Confidence            3578899999999999999984


No 18 
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=97.86  E-value=4.7e-06  Score=59.24  Aligned_cols=23  Identities=17%  Similarity=0.387  Sum_probs=21.3

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||+++...||+.|
T Consensus       655 ~~~iG~TkVFlk~~~~~~LE~~r  677 (677)
T cd01387         655 MYRVGASKLFLKEHLHQLLESMR  677 (677)
T ss_pred             cEEecceeEEEcCCHHHHHHhcC
Confidence            59999999999999999999875


No 19 
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=97.80  E-value=7.1e-06  Score=58.18  Aligned_cols=23  Identities=17%  Similarity=0.200  Sum_probs=21.2

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||.+.++.||.+|
T Consensus       631 ~~~~GktkvFlk~~~~~~le~~~  653 (653)
T cd01379         631 NWALGKTKVFLKYYHVEQLNLMR  653 (653)
T ss_pred             CEEecceEEEEecCHHHHHHhcC
Confidence            59999999999999999999864


No 20 
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=97.76  E-value=8.1e-06  Score=58.04  Aligned_cols=23  Identities=17%  Similarity=0.107  Sum_probs=21.2

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||++.+..||+.|
T Consensus       649 ~~~~G~TkVFlr~~~~~~LE~~r  671 (671)
T cd01381         649 DWQLGKTKVFLKDHHDLLLEQER  671 (671)
T ss_pred             cEEeccceEEECcCHHHHHhhcC
Confidence            59999999999999999999865


No 21 
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=97.69  E-value=1.2e-05  Score=57.13  Aligned_cols=23  Identities=26%  Similarity=0.527  Sum_probs=21.1

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||++++..||+.|
T Consensus       657 ~~~vGkTkVFlr~~~~~~LE~~r  679 (679)
T cd00124         657 EWQVGKTKVFLKEGQLSELEKMR  679 (679)
T ss_pred             CEEecCCeEEECcCHHHHHhccC
Confidence            59999999999999999999764


No 22 
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=97.32  E-value=0.00011  Score=52.63  Aligned_cols=23  Identities=13%  Similarity=0.186  Sum_probs=20.9

Q ss_pred             CcccccceeecccchHHHHHHHH
Q psy4661           1 MVKWSHCTVFFRAGVLGQMEELR   23 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~~~~LE~~r   23 (59)
                      +|++|+||||||++....||+.-
T Consensus       666 ~~~iGkTkVFlr~~~~~~Le~~~  688 (692)
T cd01385         666 NYQIGKTKIFMRETEKQALDETL  688 (692)
T ss_pred             cEEeeCceEEEcccHHHHHHHHH
Confidence            59999999999999999999854


No 23 
>KOG4427|consensus
Probab=91.46  E-value=0.7  Score=34.68  Aligned_cols=28  Identities=25%  Similarity=0.305  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          25 DRLGKIVGWMQSYMRGYLSRKEYKKIQE   52 (59)
Q Consensus        25 ~~l~~~~~~iQ~~~rg~~~r~~~~~~~~   52 (59)
                      .+-+.++..||+.+|||++|++++.-..
T Consensus        27 rrr~~aa~~iq~~lrsyl~Rkk~~~~I~   54 (1096)
T KOG4427|consen   27 RRREAAALFIQRVLRSYLVRKKAQIEIQ   54 (1096)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456788999999999999999886544


No 24 
>KOG0942|consensus
Probab=87.33  E-value=1.2  Score=33.66  Aligned_cols=27  Identities=26%  Similarity=0.298  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          26 RLGKIVGWMQSYMRGYLSRKEYKKIQE   52 (59)
Q Consensus        26 ~l~~~~~~iQ~~~rg~~~r~~~~~~~~   52 (59)
                      +-++.++.+|+.||||..|++.+..-+
T Consensus        27 k~e~~av~vQs~~Rg~~~r~~~~~~~R   53 (1001)
T KOG0942|consen   27 KQEKNAVKVQSFWRGFRVRHNQKLLFR   53 (1001)
T ss_pred             HHhccchHHHHHHHHHHHHHHHHHHHH
Confidence            456778899999999999998765433


No 25 
>KOG0160|consensus
Probab=82.43  E-value=2.9  Score=31.50  Aligned_cols=28  Identities=21%  Similarity=0.297  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          27 LGKIVGWMQSYMRGYLSRKEYKKIQEQR   54 (59)
Q Consensus        27 l~~~~~~iQ~~~rg~~~r~~~~~~~~~~   54 (59)
                      ...+++.+|+.+|++..|++|...+...
T Consensus       717 ~~~aai~~q~~~r~~~~r~~y~~~~~~~  744 (862)
T KOG0160|consen  717 REAAAIGIQKECRSYLNRRRYRALIPAS  744 (862)
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHH
Confidence            3444556666666666666666655544


No 26 
>KOG0165|consensus
Probab=75.42  E-value=5  Score=30.37  Aligned_cols=24  Identities=21%  Similarity=0.454  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          28 GKIVGWMQSYMRGYLSRKEYKKIQ   51 (59)
Q Consensus        28 ~~~~~~iQ~~~rg~~~r~~~~~~~   51 (59)
                      .+.++.||.+.||+.+|++|+.-.
T Consensus       943 Kkaavviqkmirgfiarrkfqmei  966 (1023)
T KOG0165|consen  943 KKAAVVIQKMIRGFIARRKFQMEI  966 (1023)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHH
Confidence            367788999999999999998743


No 27 
>KOG0377|consensus
Probab=70.35  E-value=13  Score=26.73  Aligned_cols=30  Identities=27%  Similarity=0.297  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          20 EELRDDRLGKIVGWMQSYMRGYLSRKEYKK   49 (59)
Q Consensus        20 E~~r~~~l~~~~~~iQ~~~rg~~~r~~~~~   49 (59)
                      |-.++..--++|+.||++.|+|.+|..-++
T Consensus         9 ~~~~s~raikaAilIQkWYRr~~ARle~rr   38 (631)
T KOG0377|consen    9 ELKKSTRAIKAAILIQKWYRRYEARLEARR   38 (631)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445566667788889999999999887554


No 28 
>PF15157 IQ-like:  IQ-like
Probab=64.48  E-value=11  Score=21.11  Aligned_cols=20  Identities=35%  Similarity=0.473  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy4661          27 LGKIVGWMQSYMRGYLSRKE   46 (59)
Q Consensus        27 l~~~~~~iQ~~~rg~~~r~~   46 (59)
                      ++.-+.+||+.||-|+.|.-
T Consensus        46 Leskvkiiqrawre~lq~qd   65 (97)
T PF15157_consen   46 LESKVKIIQRAWREYLQRQD   65 (97)
T ss_pred             hhHHHHHHHHHHHHHHHhcC
Confidence            34556679999999998865


No 29 
>PTZ00014 myosin-A; Provisional
Probab=59.13  E-value=25  Score=26.43  Aligned_cols=20  Identities=25%  Similarity=0.052  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy4661          27 LGKIVGWMQSYMRGYLSRKE   46 (59)
Q Consensus        27 l~~~~~~iQ~~~rg~~~r~~   46 (59)
                      ...+++.||+.+|+|+.++.
T Consensus       799 ~~~~~~~iQ~~~R~~l~~~~  818 (821)
T PTZ00014        799 NIKSLVRIQAHLRRHLVIAE  818 (821)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            35678899999999998864


No 30 
>KOG1419|consensus
Probab=48.94  E-value=26  Score=25.68  Aligned_cols=24  Identities=21%  Similarity=0.299  Sum_probs=18.0

Q ss_pred             HHHHHHHHH----HHHHHHHHHHHHHHH
Q psy4661          20 EELRDDRLG----KIVGWMQSYMRGYLS   43 (59)
Q Consensus        20 E~~r~~~l~----~~~~~iQ~~~rg~~~   43 (59)
                      |+.|.++.+    -+|..||+.||.|.+
T Consensus       328 eq~RQKHf~rrr~pAA~LIQc~WR~yaa  355 (654)
T KOG1419|consen  328 EQHRQKHFNRRRNPAASLIQCAWRYYAA  355 (654)
T ss_pred             HHHHHHHHHhhcchHHHHHHHHHHHHhc
Confidence            356666554    678999999998875


No 31 
>KOG0520|consensus
Probab=48.08  E-value=42  Score=25.97  Aligned_cols=33  Identities=21%  Similarity=0.329  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          23 RDDRLGKIVGWMQSYMRGYLSRKEYKKIQEQRY   55 (59)
Q Consensus        23 r~~~l~~~~~~iQ~~~rg~~~r~~~~~~~~~~~   55 (59)
                      -+.++.++++.||+.+|-+.++..|+++.....
T Consensus       909 ~~~r~~~A~~~VQsm~rs~~a~qqyrR~~~~~~  941 (975)
T KOG0520|consen  909 TEERLTRAVVRVQSMFRSPKAQQQYRRLLLVYE  941 (975)
T ss_pred             HHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHH
Confidence            345788999999999999999999998876543


No 32 
>PF14202 TnpW:  Transposon-encoded protein TnpW
Probab=36.61  E-value=26  Score=16.15  Aligned_cols=21  Identities=24%  Similarity=0.230  Sum_probs=14.9

Q ss_pred             cccccce----eecccchHHHHHHH
Q psy4661           2 VKWSHCT----VFFRAGVLGQMEEL   22 (59)
Q Consensus         2 ~q~G~TK----VF~r~~~~~~LE~~   22 (59)
                      +++|+|-    ++|.+..-+.+++.
T Consensus         5 ~kIG~Tty~V~~~F~~~s~et~~DK   29 (37)
T PF14202_consen    5 KKIGKTTYVVEVHFSETSKETMQDK   29 (37)
T ss_pred             EEECCEEEEEEEEECCCccccHHHH
Confidence            5678774    88888777666653


No 33 
>PF07106 TBPIP:  Tat binding protein 1(TBP-1)-interacting protein (TBPIP);  InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences. TBP-1 has been demonstrated to interact with the human immunodeficiency virus type 1 (HIV-1) viral protein Tat, then modulate the essential replication process of HIV. In addition, TBP-1 has been shown to be a component of the 26S proteasome, a basic multiprotein complex that degrades ubiquitinated proteins in an ATP-dependent fashion. Human TBPIP interacts with human TBP-1 then modulates the inhibitory action of human TBP-1 on HIV-Tat-mediated transactivation [].
Probab=31.94  E-value=20  Score=21.25  Aligned_cols=10  Identities=10%  Similarity=0.571  Sum_probs=8.7

Q ss_pred             cccceeeccc
Q psy4661           4 WSHCTVFFRA   13 (59)
Q Consensus         4 ~G~TKVF~r~   13 (59)
                      +||+|||+-.
T Consensus        53 ~GKqkiY~~~   62 (169)
T PF07106_consen   53 YGKQKIYFAN   62 (169)
T ss_pred             ecceEEEeeC
Confidence            7999999984


No 34 
>COG4072 Uncharacterized protein conserved in archaea [Function unknown]
Probab=29.50  E-value=25  Score=21.29  Aligned_cols=15  Identities=7%  Similarity=0.096  Sum_probs=11.9

Q ss_pred             Ccccccceeecccch
Q psy4661           1 MVKWSHCTVFFRAGV   15 (59)
Q Consensus         1 ~~q~G~TKVF~r~~~   15 (59)
                      +|--|+|++|+|.|.
T Consensus        77 ey~drRt~~ylkkGd   91 (161)
T COG4072          77 EYPDRRTKTYLKKGD   91 (161)
T ss_pred             eccCCcEEEEecCCC
Confidence            356789999999864


No 35 
>PF04852 DUF640:  Protein of unknown function (DUF640);  InterPro: IPR006936 This conserved region is found in plant proteins including the resistance protein-like protein (O49468 from SWISSPROT).
Probab=29.35  E-value=23  Score=21.06  Aligned_cols=7  Identities=14%  Similarity=0.434  Sum_probs=5.9

Q ss_pred             cccccee
Q psy4661           3 KWSHCTV    9 (59)
Q Consensus         3 q~G~TKV    9 (59)
                      ++|+|||
T Consensus        60 ~~GkTkV   66 (132)
T PF04852_consen   60 QFGKTKV   66 (132)
T ss_pred             ccCCeee
Confidence            6899997


No 36 
>PF03719 Ribosomal_S5_C:  Ribosomal protein S5, C-terminal domain;  InterPro: IPR005324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This is a family of proteins related to the 30S ribosomal protein S5P from Sulfolobus acidocaldarius (O05641 from SWISSPROT). Ribosomal protein S5 is one of the proteins from the small ribosomal subunit. In Escherichia coli, S5 is known to be important in the assembly and function of the 30S ribosomal subunit. Mutations in S5 have been shown to increase translational error frequencies.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2XZN_E 2XZM_E 2WDK_E 3KNJ_E 3HUY_E 2B9M_E 2Y18_E 1XMQ_E 1IBM_E 3TVF_H ....
Probab=21.06  E-value=43  Score=17.55  Aligned_cols=12  Identities=25%  Similarity=0.609  Sum_probs=8.8

Q ss_pred             ccccceeecccc
Q psy4661           3 KWSHCTVFFRAG   14 (59)
Q Consensus         3 q~G~TKVF~r~~   14 (59)
                      ++|.|+|++++.
T Consensus         4 k~g~~~V~l~Pa   15 (74)
T PF03719_consen    4 KFGATKVFLKPA   15 (74)
T ss_dssp             EETTEEEEEEES
T ss_pred             EEeeEEEEEEeC
Confidence            467888888853


No 37 
>KOG2128|consensus
Probab=20.90  E-value=1.6e+02  Score=23.93  Aligned_cols=24  Identities=46%  Similarity=0.462  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy4661          28 GKIVGWMQSYMRGYLSRKEYKKIQ   51 (59)
Q Consensus        28 ~~~~~~iQ~~~rg~~~r~~~~~~~   51 (59)
                      ...++.+|+..||+++|++|.+..
T Consensus       592 ~~evv~~qs~~R~~lsrk~~~~~~  615 (1401)
T KOG2128|consen  592 KKEVVKFQSLTRGALSRKKYSRKL  615 (1401)
T ss_pred             hHHHHHHHHHHHHHHHHhhHHHHH
Confidence            456788999999999999987654


Done!