Query         psy4688
Match_columns 388
No_of_seqs    595 out of 2632
Neff          10.5
Searched_HMMs 46136
Date          Fri Aug 16 23:21:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4688.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4688hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074|consensus              100.0   3E-31 6.6E-36  245.7   5.5  240  104-368   605-936 (958)
  2 KOG1074|consensus              100.0 4.5E-31 9.8E-36  244.6   6.3  198  188-388   605-930 (958)
  3 KOG2462|consensus              100.0 1.9E-30 4.1E-35  212.9   5.9  130  217-385   130-263 (279)
  4 KOG2462|consensus              100.0   1E-28 2.2E-33  202.6   7.4  137  184-335   126-265 (279)
  5 KOG3608|consensus               99.9 9.3E-28   2E-32  201.8   9.5  231   71-339   135-378 (467)
  6 KOG3608|consensus               99.9 7.8E-27 1.7E-31  196.3  10.4  241   41-325   134-398 (467)
  7 KOG3623|consensus               99.9 1.7E-26 3.6E-31  210.9  11.7  113   41-153   210-330 (1007)
  8 KOG3576|consensus               99.8 1.2E-19 2.6E-24  141.5   1.6  122  214-341   114-240 (267)
  9 KOG3576|consensus               99.7 1.1E-17 2.4E-22  130.6   1.2  111  251-367   117-240 (267)
 10 KOG3623|consensus               99.6 9.4E-16   2E-20  141.3   3.7  112  188-299   210-329 (1007)
 11 PLN03086 PRLI-interacting fact  99.4 5.6E-13 1.2E-17  124.1   5.5  138  218-385   408-560 (567)
 12 PLN03086 PRLI-interacting fact  99.3 4.1E-12 8.8E-17  118.4   6.8  142  189-361   408-562 (567)
 13 PHA00733 hypothetical protein   99.1   5E-11 1.1E-15   90.7   4.3   80  251-338    40-124 (128)
 14 KOG3993|consensus               99.1 2.5E-11 5.5E-16  105.9   2.4  201  103-338   266-483 (500)
 15 PHA00733 hypothetical protein   99.0 2.9E-10 6.3E-15   86.5   5.5   98   54-157    25-124 (128)
 16 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.6E-10 3.4E-15   61.4   1.6   25  354-378     1-25  (26)
 17 PHA02768 hypothetical protein;  99.0 3.4E-10 7.4E-15   70.2   2.7   44  251-296     5-48  (55)
 18 KOG3993|consensus               98.9   2E-10 4.3E-15  100.4  -0.3  110   41-158   267-382 (500)
 19 PHA02768 hypothetical protein;  98.9   1E-09 2.2E-14   68.1   2.0   43  104-148     5-47  (55)
 20 PHA00616 hypothetical protein   98.7 6.8E-09 1.5E-13   61.2   1.4   34  313-346     1-34  (44)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.7   1E-08 2.2E-13   54.4   1.8   25  266-290     1-25  (26)
 22 PHA00732 hypothetical protein   98.6 1.6E-08 3.5E-13   69.5   1.5   46  314-362     2-47  (79)
 23 PHA00616 hypothetical protein   98.5 7.2E-08 1.6E-12   56.9   2.6   32  341-372     1-34  (44)
 24 PF05605 zf-Di19:  Drought indu  98.5 1.9E-07 4.2E-12   59.6   4.8   50  313-363     2-53  (54)
 25 PHA00732 hypothetical protein   98.4 1.8E-07 3.9E-12   64.3   3.2   21  218-238     2-22  (79)
 26 PF05605 zf-Di19:  Drought indu  98.4 7.8E-07 1.7E-11   56.8   4.6   51   41-94      2-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.1 1.8E-06 3.9E-11   44.4   1.8   23  314-336     1-23  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   97.9 5.5E-06 1.2E-10   43.1   1.9   24  314-337     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  97.8 1.1E-05 2.4E-10   41.4   1.7   20  219-238     2-21  (23)
 30 COG5189 SFP1 Putative transcri  97.8 5.8E-06 1.3E-10   70.2   0.9   58  277-334   347-419 (423)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.8E-05 3.9E-10   42.4   1.6   26  313-338     1-26  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.3E-05   5E-10   57.6   2.2   24  132-155    50-73  (100)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.6 2.6E-05 5.6E-10   57.3   2.0   72  191-274     2-73  (100)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.6 3.8E-05 8.2E-10   39.8   2.0   22  219-240     2-23  (24)
 35 PF09237 GAGA:  GAGA factor;  I  97.5 0.00014   3E-09   44.0   3.0   32  310-341    21-52  (54)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.4 5.6E-05 1.2E-09   40.5   1.2   23  218-240     2-24  (27)
 37 COG5189 SFP1 Putative transcri  97.3   9E-05 1.9E-09   63.2   1.4   24  276-299   395-418 (423)
 38 PRK04860 hypothetical protein;  97.0 0.00028   6E-09   55.9   1.6   34  342-377   120-153 (160)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00045 9.8E-09   35.7   1.9   24  314-338     1-24  (24)
 40 KOG2231|consensus               97.0 0.00075 1.6E-08   64.8   4.6  147  189-371   100-275 (669)
 41 smart00355 ZnF_C2H2 zinc finge  97.0 0.00059 1.3E-08   35.8   2.2   23  314-336     1-23  (26)
 42 KOG2231|consensus               96.9  0.0019 4.1E-08   62.1   6.1  103  191-303   118-236 (669)
 43 COG5236 Uncharacterized conser  96.9  0.0015 3.3E-08   56.5   4.8   24   71-94    152-177 (493)
 44 PF12874 zf-met:  Zinc-finger o  96.9  0.0006 1.3E-08   35.6   1.5   23  314-336     1-23  (25)
 45 smart00355 ZnF_C2H2 zinc finge  96.9 0.00092   2E-08   35.0   2.2   21  253-273     2-22  (26)
 46 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5   0.001 2.2E-08   35.5   0.9   22  314-335     2-23  (27)
 47 PF09237 GAGA:  GAGA factor;  I  96.5  0.0014   3E-08   39.7   1.5   33  212-244    19-51  (54)
 48 PF12874 zf-met:  Zinc-finger o  96.4  0.0016 3.6E-08   33.9   1.3   17  107-123     3-19  (25)
 49 PRK04860 hypothetical protein;  96.3   0.002 4.4E-08   51.0   1.9   40  250-293   118-157 (160)
 50 KOG2482|consensus               96.3   0.026 5.6E-07   49.2   8.5   77  189-274   280-357 (423)
 51 COG5236 Uncharacterized conser  96.0  0.0031 6.7E-08   54.7   1.3   19  254-272   223-241 (493)
 52 KOG1146|consensus               95.9  0.0012 2.6E-08   67.2  -1.6  189   43-240   438-641 (1406)
 53 PF13909 zf-H2C2_5:  C2H2-type   95.9  0.0066 1.4E-07   31.2   1.9   21  219-240     2-22  (24)
 54 PF12171 zf-C2H2_jaz:  Zinc-fin  95.8  0.0036 7.9E-08   33.3   0.7   22  252-273     2-23  (27)
 55 KOG2785|consensus               95.6   0.038 8.3E-07   49.1   6.6   57  217-273   166-242 (390)
 56 KOG2785|consensus               95.4   0.047   1E-06   48.6   6.4   53  188-240   166-243 (390)
 57 PF13913 zf-C2HC_2:  zinc-finge  95.3   0.014   3E-07   30.3   1.8   20  314-334     3-22  (25)
 58 KOG4173|consensus               95.0  0.0079 1.7E-07   48.3   0.4   42  194-239    87-128 (253)
 59 KOG4173|consensus               94.9  0.0066 1.4E-07   48.7  -0.2  113    6-125    47-167 (253)
 60 COG5048 FOG: Zn-finger [Genera  94.9  0.0091   2E-07   56.6   0.6  157  216-377   288-456 (467)
 61 PF13913 zf-C2HC_2:  zinc-finge  94.7   0.031 6.7E-07   29.0   2.1   20   42-62      3-22  (25)
 62 smart00451 ZnF_U1 U1-like zinc  94.0   0.035 7.6E-07   31.5   1.5   23  313-335     3-25  (35)
 63 KOG2893|consensus               94.0   0.034 7.4E-07   45.8   1.9   47  254-304    13-59  (341)
 64 TIGR00622 ssl1 transcription f  93.6   0.077 1.7E-06   38.9   3.0   47  315-363    57-105 (112)
 65 smart00451 ZnF_U1 U1-like zinc  93.4   0.063 1.4E-06   30.4   1.9   23  251-273     3-25  (35)
 66 KOG2482|consensus               93.2    0.13 2.8E-06   45.0   4.2  117   39-155   142-357 (423)
 67 COG5048 FOG: Zn-finger [Genera  93.2   0.043 9.3E-07   52.0   1.5  154  187-350   288-455 (467)
 68 TIGR00622 ssl1 transcription f  92.3    0.39 8.4E-06   35.3   5.0   21  216-236    14-34  (112)
 69 KOG2893|consensus               92.0   0.048   1E-06   45.0   0.2   47   43-94     12-58  (341)
 70 KOG1146|consensus               92.0    0.06 1.3E-06   55.6   0.9   83  190-272   438-539 (1406)
 71 cd00350 rubredoxin_like Rubred  91.7   0.097 2.1E-06   29.3   1.1    7  281-287     3-9   (33)
 72 COG4049 Uncharacterized protei  90.3    0.14 3.1E-06   31.6   1.0   29  310-338    14-42  (65)
 73 COG4049 Uncharacterized protei  90.3    0.16 3.5E-06   31.4   1.2   28   67-94     14-41  (65)
 74 PF00301 Rubredoxin:  Rubredoxi  89.4    0.38 8.3E-06   29.3   2.4   42  280-322     2-43  (47)
 75 PF01352 KRAB:  KRAB box;  Inte  87.5   0.047   1E-06   32.2  -2.4   23    3-25     18-40  (41)
 76 cd00730 rubredoxin Rubredoxin;  87.2    0.43 9.4E-06   29.5   1.6   12  280-291     2-13  (50)
 77 PF02176 zf-TRAF:  TRAF-type zi  87.0    0.36 7.9E-06   31.2   1.4   46  312-358     8-60  (60)
 78 PF09986 DUF2225:  Uncharacteri  86.3    0.47   1E-05   40.0   2.0   13  314-326    49-61  (214)
 79 PF12013 DUF3505:  Protein of u  85.8       1 2.2E-05   33.4   3.3   26  313-338    80-109 (109)
 80 cd00729 rubredoxin_SM Rubredox  85.7    0.45 9.7E-06   26.8   1.1    6  315-320     4-9   (34)
 81 TIGR02098 MJ0042_CXXC MJ0042 f  84.0    0.67 1.5E-05   26.8   1.4   11  313-323    25-35  (38)
 82 PF12013 DUF3505:  Protein of u  83.7     1.9   4E-05   32.0   4.0   26  187-213    10-35  (109)
 83 PHA00626 hypothetical protein   83.6    0.72 1.6E-05   28.8   1.4   14  312-325    22-35  (59)
 84 COG1592 Rubrerythrin [Energy p  83.5    0.56 1.2E-05   37.3   1.1   11  364-374   146-156 (166)
 85 PF13717 zinc_ribbon_4:  zinc-r  83.4    0.88 1.9E-05   26.0   1.6   32  190-227     4-35  (36)
 86 PF02176 zf-TRAF:  TRAF-type zi  82.0    0.67 1.5E-05   29.9   0.9   46  339-384     7-60  (60)
 87 KOG2186|consensus               81.6     0.7 1.5E-05   38.9   1.1   46  218-272     4-49  (276)
 88 PF09538 FYDLN_acid:  Protein o  81.4    0.99 2.1E-05   33.2   1.7   12  313-324    26-37  (108)
 89 PF13719 zinc_ribbon_5:  zinc-r  80.9     1.1 2.3E-05   25.8   1.4   33  190-228     4-36  (37)
 90 PF09538 FYDLN_acid:  Protein o  80.4     0.9 1.9E-05   33.4   1.2   28  313-351     9-36  (108)
 91 PF09986 DUF2225:  Uncharacteri  80.2    0.37 8.1E-06   40.6  -1.0   10  253-262    50-59  (214)
 92 PRK00398 rpoP DNA-directed RNA  79.3     1.3 2.9E-05   26.8   1.5   12  279-290     3-14  (46)
 93 PF10571 UPF0547:  Uncharacteri  78.9     1.4   3E-05   23.0   1.3   11  314-324    15-25  (26)
 94 TIGR00373 conserved hypothetic  78.5     1.1 2.3E-05   35.8   1.1   29  313-350   109-137 (158)
 95 smart00734 ZnF_Rad18 Rad18-lik  77.9       2 4.4E-05   22.4   1.7   19  315-334     3-21  (26)
 96 PRK06266 transcription initiat  77.2     1.1 2.5E-05   36.4   1.0   29  313-350   117-145 (178)
 97 TIGR00373 conserved hypothetic  76.7     1.8   4E-05   34.5   2.1   16  252-267   110-125 (158)
 98 smart00531 TFIIE Transcription  75.2     1.6 3.4E-05   34.4   1.3   12  279-290    99-110 (147)
 99 PF09723 Zn-ribbon_8:  Zinc rib  75.1     1.7 3.7E-05   25.8   1.1   11  280-290     6-16  (42)
100 PF02892 zf-BED:  BED zinc fing  75.0     2.6 5.7E-05   25.2   2.0   24  312-335    15-42  (45)
101 COG4957 Predicted transcriptio  74.4     1.7 3.7E-05   32.7   1.2   22  314-338    77-98  (148)
102 smart00531 TFIIE Transcription  73.3     3.3 7.2E-05   32.6   2.7   35  251-289    99-133 (147)
103 PRK00464 nrdR transcriptional   73.3       1 2.2E-05   35.6  -0.2   16  280-295    29-44  (154)
104 PRK14890 putative Zn-ribbon RN  73.2     2.2 4.7E-05   27.2   1.3    9  313-321    48-56  (59)
105 COG1773 Rubredoxin [Energy pro  73.1       3 6.5E-05   26.2   1.9   13  279-291     3-15  (55)
106 KOG2186|consensus               73.0     1.2 2.7E-05   37.5   0.2   54  280-342     4-57  (276)
107 PRK06266 transcription initiat  72.6     2.6 5.6E-05   34.4   2.0   13  279-291   117-129 (178)
108 COG1592 Rubrerythrin [Energy p  72.4     2.2 4.8E-05   34.0   1.5   12  275-286   145-156 (166)
109 TIGR01384 TFS_arch transcripti  72.1     1.3 2.8E-05   32.5   0.1    9  314-322    63-71  (104)
110 smart00834 CxxC_CXXC_SSSS Puta  71.1     1.4 3.1E-05   25.8   0.1   11  280-290     6-16  (41)
111 PF04959 ARS2:  Arsenite-resist  71.0     1.6 3.5E-05   36.5   0.4   30  311-340    75-104 (214)
112 PRK00464 nrdR transcriptional   70.5     2.4 5.2E-05   33.5   1.3   18  313-330    28-45  (154)
113 smart00659 RPOLCX RNA polymera  70.1     2.8 6.2E-05   25.1   1.3   10  280-289     3-12  (44)
114 TIGR02605 CxxC_CxxC_SSSS putat  69.2     1.6 3.6E-05   27.2   0.1   11  280-290     6-16  (52)
115 COG2888 Predicted Zn-ribbon RN  69.1     2.9 6.3E-05   26.6   1.2    8  313-320    50-57  (61)
116 smart00614 ZnF_BED BED zinc fi  68.6     4.1   9E-05   25.2   1.9   23  313-335    18-45  (50)
117 TIGR02300 FYDLN_acid conserved  68.3     2.9 6.4E-05   31.3   1.3   10  315-324    11-20  (129)
118 TIGR02300 FYDLN_acid conserved  67.0     4.3 9.2E-05   30.5   1.9   30  252-292    10-39  (129)
119 PF03604 DNA_RNApol_7kD:  DNA d  65.6     4.9 0.00011   22.2   1.5   10  313-322    17-26  (32)
120 KOG2593|consensus               65.3     4.4 9.5E-05   37.3   2.0   35   41-79    128-162 (436)
121 COG2331 Uncharacterized protei  64.8     5.4 0.00012   26.8   1.8   38  310-355     9-47  (82)
122 PRK09678 DNA-binding transcrip  64.6     2.9 6.4E-05   28.1   0.6   42  252-295     2-45  (72)
123 PRK04023 DNA polymerase II lar  63.8     5.2 0.00011   41.0   2.4    8  342-349   664-671 (1121)
124 PF08274 PhnA_Zn_Ribbon:  PhnA   63.3     3.4 7.3E-05   22.5   0.6    8  313-320    19-26  (30)
125 PF09845 DUF2072:  Zn-ribbon co  63.2     3.8 8.3E-05   31.0   1.1   13  314-326     2-14  (131)
126 PF12907 zf-met2:  Zinc-binding  62.3     4.6  0.0001   23.6   1.1   23   72-94      3-28  (40)
127 COG1996 RPC10 DNA-directed RNA  61.8     3.6 7.9E-05   25.2   0.6   11  313-323     6-16  (49)
128 PF14353 CpXC:  CpXC protein     61.5     7.7 0.00017   29.6   2.6   24  278-301    37-60  (128)
129 PF13451 zf-trcl:  Probable zin  61.1       5 0.00011   24.6   1.1   15   40-54      3-17  (49)
130 PF05443 ROS_MUCR:  ROS/MUCR tr  59.9     5.1 0.00011   30.7   1.3   27  312-341    71-97  (132)
131 COG5151 SSL1 RNA polymerase II  59.8      11 0.00023   33.0   3.3   12  340-351   387-398 (421)
132 TIGR01206 lysW lysine biosynth  58.9     5.9 0.00013   25.0   1.2    9  314-322    23-31  (54)
133 PF07754 DUF1610:  Domain of un  58.8     3.8 8.2E-05   20.9   0.3    8  367-374    16-23  (24)
134 KOG2272|consensus               57.3       7 0.00015   33.0   1.7   18  217-234    99-116 (332)
135 KOG2807|consensus               55.5      20 0.00044   31.7   4.2   33  251-297   276-308 (378)
136 PF15269 zf-C2H2_7:  Zinc-finge  54.5      15 0.00032   21.8   2.2   23  250-272    19-41  (54)
137 COG1997 RPL43A Ribosomal prote  54.2     7.7 0.00017   27.0   1.3   13  313-325    53-65  (89)
138 KOG2593|consensus               53.7     9.1  0.0002   35.3   2.0   19  276-294   125-143 (436)
139 COG1198 PriA Primosomal protei  52.6     3.1 6.8E-05   41.7  -1.2   40  314-376   445-484 (730)
140 PF04959 ARS2:  Arsenite-resist  52.2     9.3  0.0002   32.1   1.7   29   68-96     75-103 (214)
141 PF07503 zf-HYPF:  HypF finger;  52.1     5.3 0.00011   22.6   0.2   31  282-324     2-32  (35)
142 KOG2807|consensus               50.4      29 0.00062   30.8   4.4   13   46-58    138-150 (378)
143 PF14446 Prok-RING_1:  Prokaryo  50.1     9.2  0.0002   24.0   1.0    9  253-261     7-15  (54)
144 KOG4124|consensus               49.8       5 0.00011   35.6  -0.2   51  102-153   176-233 (442)
145 PRK04023 DNA polymerase II lar  49.5      17 0.00037   37.6   3.3   10  217-226   626-635 (1121)
146 KOG4124|consensus               49.2     6.6 0.00014   34.9   0.4   26  278-303   348-375 (442)
147 PF11789 zf-Nse:  Zinc-finger o  49.1      11 0.00024   24.0   1.4   29  341-372    24-53  (57)
148 COG1198 PriA Primosomal protei  48.6      13 0.00028   37.6   2.3   10  313-322   475-484 (730)
149 KOG4167|consensus               48.0     4.5 9.8E-05   39.7  -0.8   26  313-338   792-817 (907)
150 PF08790 zf-LYAR:  LYAR-type C2  47.6     6.2 0.00013   21.0   0.0    9  281-289     2-10  (28)
151 PF05443 ROS_MUCR:  ROS/MUCR tr  47.6     6.5 0.00014   30.1   0.1   26  341-367    72-97  (132)
152 TIGR00595 priA primosomal prot  45.2      12 0.00026   36.3   1.6   13  275-287   236-248 (505)
153 KOG1280|consensus               44.2      17 0.00036   32.5   2.1   37  312-348    78-116 (381)
154 PF04216 FdhE:  Protein involve  43.9       2 4.3E-05   38.2  -3.7    9  314-322   212-220 (290)
155 COG4957 Predicted transcriptio  43.5      11 0.00025   28.5   0.9   17  280-299    77-93  (148)
156 COG4530 Uncharacterized protei  42.4      14  0.0003   26.8   1.1   11  313-323    26-36  (129)
157 PF05191 ADK_lid:  Adenylate ki  42.2      10 0.00022   21.6   0.4   30  106-143     3-32  (36)
158 smart00504 Ubox Modified RING   42.1      25 0.00054   22.6   2.3   26  347-377    19-45  (63)
159 PF01286 XPA_N:  XPA protein N-  41.9      14 0.00029   20.8   0.8   11  281-291     5-15  (34)
160 PRK00432 30S ribosomal protein  41.9      17 0.00036   22.5   1.3    6  315-320    39-44  (50)
161 TIGR00595 priA primosomal prot  40.9      16 0.00036   35.4   1.7    9  313-321   240-248 (505)
162 PF01780 Ribosomal_L37ae:  Ribo  40.9      13 0.00028   26.2   0.8   13  313-325    53-65  (90)
163 COG0068 HypF Hydrogenase matur  40.7     8.3 0.00018   38.1  -0.3   37  188-232   101-138 (750)
164 PF01363 FYVE:  FYVE zinc finge  40.4      13 0.00027   24.7   0.6    9  315-323    11-19  (69)
165 PF06524 NOA36:  NOA36 protein;  40.4      12 0.00025   32.0   0.5   25  131-155   208-232 (314)
166 PF13639 zf-RING_2:  Ring finge  40.1      20 0.00042   21.2   1.4   29  339-373    14-43  (44)
167 COG1655 Uncharacterized protei  38.6      12 0.00025   31.4   0.3    7  343-349    64-70  (267)
168 COG0068 HypF Hydrogenase matur  38.4      11 0.00024   37.3   0.1   56  253-321   125-181 (750)
169 PF09963 DUF2197:  Uncharacteri  38.3     9.1  0.0002   24.2  -0.3   37   42-80      3-41  (56)
170 KOG4167|consensus               38.2      12 0.00025   37.0   0.3   25   69-93    791-815 (907)
171 COG5151 SSL1 RNA polymerase II  38.0      28 0.00061   30.5   2.5   99   39-156   306-412 (421)
172 PRK14873 primosome assembly pr  37.8      17 0.00037   36.5   1.4    9  281-289   385-393 (665)
173 PF14445 Prok-RING_2:  Prokaryo  37.8     9.4  0.0002   23.3  -0.3   14  312-325     6-19  (57)
174 PF04780 DUF629:  Protein of un  37.7      21 0.00046   33.7   1.9   28   69-96     56-83  (466)
175 TIGR03831 YgiT_finger YgiT-typ  36.9      17 0.00036   21.6   0.7   13  313-325    32-44  (46)
176 TIGR00100 hypA hydrogenase nic  36.8      16 0.00034   27.4   0.7   14  313-326    70-83  (115)
177 PF05290 Baculo_IE-1:  Baculovi  36.7      33 0.00072   26.1   2.4   58  213-294    76-136 (140)
178 PRK14714 DNA polymerase II lar  36.3      38 0.00082   36.2   3.5    8  280-287   693-700 (1337)
179 KOG1280|consensus               36.2      31 0.00067   30.9   2.5   27   70-96     79-105 (381)
180 TIGR00280 L37a ribosomal prote  36.1      18 0.00039   25.6   0.8   13  313-325    53-65  (91)
181 COG4888 Uncharacterized Zn rib  35.9      19  0.0004   25.8   0.9   10  251-260    22-31  (104)
182 cd00162 RING RING-finger (Real  35.8      46   0.001   19.0   2.7   27  346-376    17-44  (45)
183 PF04780 DUF629:  Protein of un  35.5      24 0.00051   33.4   1.8   27   42-68     58-84  (466)
184 PRK03824 hypA hydrogenase nick  34.9      15 0.00033   28.4   0.4   11  280-290    71-81  (135)
185 PF12760 Zn_Tnp_IS1595:  Transp  34.6      69  0.0015   19.2   3.2   10  312-321    36-45  (46)
186 PF08271 TF_Zn_Ribbon:  TFIIB z  34.6      14  0.0003   21.9   0.1   10   70-79     19-28  (43)
187 PRK05452 anaerobic nitric oxid  34.5      25 0.00054   33.9   1.9   12  279-290   425-436 (479)
188 COG1571 Predicted DNA-binding   34.5      16 0.00036   33.9   0.6   27  315-352   352-378 (421)
189 smart00154 ZnF_AN1 AN1-like Zi  34.4      19 0.00041   20.9   0.6   14  313-326    12-25  (39)
190 PRK12380 hydrogenase nickel in  34.2      19  0.0004   26.9   0.8   13  313-325    70-82  (113)
191 PF13878 zf-C2H2_3:  zinc-finge  34.2      29 0.00062   20.4   1.4   12  314-325    14-25  (41)
192 PF06524 NOA36:  NOA36 protein;  34.1      33 0.00071   29.4   2.2   12  214-225   139-150 (314)
193 PTZ00255 60S ribosomal protein  33.9      21 0.00047   25.2   1.0   13  313-325    54-66  (90)
194 COG5188 PRP9 Splicing factor 3  33.5      84  0.0018   28.3   4.6   22  104-125   238-259 (470)
195 cd00065 FYVE FYVE domain; Zinc  33.1      23  0.0005   22.3   1.0    9  316-324     5-13  (57)
196 KOG3408|consensus               32.9      26 0.00056   26.1   1.3   27  129-155    54-80  (129)
197 PF07649 C1_3:  C1-like domain;  32.1      18 0.00039   19.4   0.3    9  341-349    15-23  (30)
198 smart00249 PHD PHD zinc finger  31.8      64  0.0014   18.7   2.8   11  279-289    14-24  (47)
199 PF07282 OrfB_Zn_ribbon:  Putat  31.3      17 0.00036   24.1   0.1   27  315-351    30-56  (69)
200 PF01927 Mut7-C:  Mut7-C RNAse   31.3      45 0.00098   26.1   2.6   19  313-331   124-142 (147)
201 PF08209 Sgf11:  Sgf11 (transcr  30.6      23 0.00049   19.7   0.5   10  368-377     5-14  (33)
202 KOG3214|consensus               30.6      17 0.00037   25.9   0.1   41   39-84     21-61  (109)
203 PRK03976 rpl37ae 50S ribosomal  30.2      25 0.00055   24.8   0.9   13  313-325    54-66  (90)
204 KOG3408|consensus               30.1      41  0.0009   25.1   1.9   29   98-126    51-79  (129)
205 PF02591 DUF164:  Putative zinc  29.9      46   0.001   21.0   2.0   31   43-78     24-54  (56)
206 KOG0717|consensus               29.3      27 0.00058   32.7   1.0   22  314-335   293-314 (508)
207 KOG1842|consensus               29.2      28 0.00062   32.3   1.2   29   40-68     14-42  (505)
208 PF01428 zf-AN1:  AN1-like Zinc  29.2      20 0.00043   21.3   0.2   15  312-326    12-26  (43)
209 PRK00564 hypA hydrogenase nick  29.1      24 0.00051   26.5   0.6   13  313-325    71-83  (117)
210 PF15135 UPF0515:  Uncharacteri  28.8      37 0.00081   28.9   1.7   15  216-230   154-168 (278)
211 KOG0717|consensus               28.4      28  0.0006   32.6   1.0   25   39-63    290-314 (508)
212 PRK05580 primosome assembly pr  28.3      33 0.00071   34.8   1.6    9  341-349   421-429 (679)
213 KOG0978|consensus               28.2      29 0.00064   34.6   1.2   11  368-378   679-689 (698)
214 PF14311 DUF4379:  Domain of un  28.0      40 0.00086   21.2   1.4   13  314-326    29-41  (55)
215 PRK12496 hypothetical protein;  27.6      30 0.00065   27.8   1.0   10  314-323   128-137 (164)
216 PF09416 UPF1_Zn_bind:  RNA hel  27.5      64  0.0014   25.4   2.7   10  340-349    59-68  (152)
217 PF10013 DUF2256:  Uncharacteri  27.5      35 0.00076   20.1   1.0   17  314-330     9-25  (42)
218 COG3091 SprT Zn-dependent meta  27.5      27 0.00059   27.3   0.7   32  251-287   117-148 (156)
219 COG3364 Zn-ribbon containing p  27.4      29 0.00062   24.9   0.7   14  251-264     2-15  (112)
220 PF12230 PRP21_like_P:  Pre-mRN  27.2      21 0.00045   30.5   0.0   19  342-360   169-188 (229)
221 smart00064 FYVE Protein presen  27.2      29 0.00063   22.9   0.7   10  315-324    12-21  (68)
222 COG1675 TFA1 Transcription ini  27.2      47   0.001   26.9   2.0   15  276-290   110-124 (176)
223 COG3880 Modulator of heat shoc  26.5      39 0.00083   26.9   1.3   35  313-357    74-108 (176)
224 PF13453 zf-TFIIB:  Transcripti  26.1      37 0.00081   19.8   1.0   18  217-234    19-36  (41)
225 PF01096 TFIIS_C:  Transcriptio  26.1      29 0.00064   20.1   0.5   11  313-323    28-38  (39)
226 PF04423 Rad50_zn_hook:  Rad50   25.8      27 0.00058   21.9   0.3   13  315-327    22-34  (54)
227 PF05741 zf-nanos:  Nanos RNA b  25.8      23  0.0005   22.4   0.0   10  367-376    33-42  (55)
228 PF05495 zf-CHY:  CHY zinc fing  25.5      20 0.00044   24.1  -0.3   13  313-325    41-53  (71)
229 COG4896 Uncharacterized protei  25.3      41 0.00088   21.6   1.0   12  277-288    29-40  (68)
230 PTZ00303 phosphatidylinositol   25.1      22 0.00048   35.5  -0.2   12  106-117   462-473 (1374)
231 PF15227 zf-C3HC4_4:  zinc fing  24.8      33  0.0007   20.2   0.5    6  368-373    37-42  (42)
232 KOG0562|consensus               24.6      54  0.0012   26.0   1.8   30   37-66    149-178 (184)
233 KOG1842|consensus               24.5      38 0.00082   31.5   1.1   29  311-339    13-41  (505)
234 KOG2636|consensus               24.5      50  0.0011   30.8   1.9   26   65-90    396-422 (497)
235 smart00440 ZnF_C2C2 C2C2 Zinc   24.4      52  0.0011   19.2   1.3   12  313-324    28-39  (40)
236 PF01155 HypA:  Hydrogenase exp  24.3      27 0.00059   26.0   0.2   12  314-325    71-82  (113)
237 smart00132 LIM Zinc-binding do  23.9      53  0.0011   18.2   1.4   11  313-323    27-37  (39)
238 PF03833 PolC_DP2:  DNA polymer  23.9      26 0.00056   35.6   0.0    8  280-287   656-663 (900)
239 PF04606 Ogr_Delta:  Ogr/Delta-  23.3      28 0.00061   21.1   0.1   12  314-325    26-39  (47)
240 PRK03681 hypA hydrogenase nick  23.1      30 0.00065   25.8   0.2   10  314-323    71-80  (114)
241 PF11931 DUF3449:  Domain of un  22.9      28  0.0006   28.7   0.0   24   39-62     99-123 (196)
242 PF05129 Elf1:  Transcription e  22.9      35 0.00077   23.6   0.5   10  314-323    47-56  (81)
243 PF12230 PRP21_like_P:  Pre-mRN  22.8      28 0.00061   29.7   0.0   29  312-341   167-195 (229)
244 COG4306 Uncharacterized protei  22.1      30 0.00065   25.8   0.0   12   70-81     68-79  (160)
245 PF14803 Nudix_N_2:  Nudix N-te  21.9      51  0.0011   18.5   0.9   12  311-322    20-31  (34)
246 TIGR03830 CxxCG_CxxCG_HTH puta  21.8      50  0.0011   24.8   1.2   22  312-333    30-51  (127)
247 KOG2817|consensus               21.7      62  0.0013   29.7   1.9   24   27-50    358-383 (394)
248 PF09332 Mcm10:  Mcm10 replicat  21.5      14  0.0003   33.5  -2.2   14  312-325   284-297 (344)
249 PF14634 zf-RING_5:  zinc-RING   20.9 1.3E+02  0.0028   17.7   2.7   11  365-375    34-44  (44)
250 PRK14559 putative protein seri  20.3      88  0.0019   31.4   2.8   11  281-291    43-53  (645)
251 PRK05978 hypothetical protein;  20.3      55  0.0012   25.7   1.2    7  253-259    35-41  (148)
252 PF06220 zf-U1:  U1 zinc finger  20.2      77  0.0017   18.2   1.5   11  313-323     3-13  (38)
253 PF04810 zf-Sec23_Sec24:  Sec23  20.2      70  0.0015   18.6   1.3   10  312-321    23-32  (40)
254 PF06397 Desulfoferrod_N:  Desu  20.1      38 0.00083   19.3   0.2   10  367-376     6-15  (36)

No 1  
>KOG1074|consensus
Probab=99.97  E-value=3e-31  Score=245.71  Aligned_cols=240  Identities=24%  Similarity=0.402  Sum_probs=173.2

Q ss_pred             ccccccchhccCCchHHHHHHhhcCCCCCccCCccccccCChHHHHHHHhhhcccccccccCceeeecCCCCCccccchh
Q psy4688         104 HFECNYCHAKFSNKSLLSDHISSHTGLKNYKCHVCDKAYSCRKALKTHTLLHEQEKVIKSSKKEFIIDTGDCTLDEWNDF  183 (388)
Q Consensus       104 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~  183 (388)
                      |.+|-+|-++.+-++.|+.|.++|+|++||+|.+|++.|+++.+|+.||-+|......                      
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~----------------------  662 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPA----------------------  662 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccc----------------------
Confidence            5789999999999999999999999999999999999999999999999998654322                      


Q ss_pred             hccCCCccc---ccccccCCchHHHHhHHhhhCC-CC------------cccCCCCcccCCChhHHHHHHHHhccCCc--
Q psy4688         184 IKRRVTVCP---KCNRDYRNPRNMRKHLRRVHTS-VR------------KYGCDECGKMLKSRDSLNTHKKIQHEGKK--  245 (388)
Q Consensus       184 ~~~~~~~C~---~C~~~f~~~~~l~~H~~~~h~~-~~------------~~~C~~C~~~f~~~~~l~~H~~~~~~~~~--  245 (388)
                        +..+.|+   +|-+.|.+.-.|..|++ .|.+ ..            .-+|..|.+.|.....+..++..+-....  
T Consensus       663 --R~q~ScP~~~ic~~kftn~V~lpQhIr-iH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~  739 (958)
T KOG1074|consen  663 --RVQFSCPSTFICQKKFTNAVTLPQHIR-IHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEP  739 (958)
T ss_pred             --cccccCCchhhhcccccccccccceEE-eecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCC
Confidence              2346799   99999999999999974 5652 11            24699999999999999988877632111  


Q ss_pred             ------------ccccCcccccccCCcCCChhHHHHHHh-----------------------hcCCCCCc-ccccccccc
Q psy4688         246 ------------VKVKYEYECDYCGAKYPNKYTLSDHIS-----------------------GHTGIPNH-ICKICNKGY  289 (388)
Q Consensus       246 ------------~~~~~~~~C~~C~~~f~~~~~L~~H~~-----------------------~H~~~~~~-~C~~C~k~f  289 (388)
                                  ....-+..+..|+..+.....+..+-.                       .++++++. .+.+++-.-
T Consensus       740 ~~~~~~~t~t~~~~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~  819 (958)
T KOG1074|consen  740 DEQMDERTETEELDVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEIL  819 (958)
T ss_pred             cccccccccccccccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCC
Confidence                        111225678889998887766655421                       23345555 555555433


Q ss_pred             ccccccc----hh-------------hccccc-------cc------------cCCCCCccccCCCcccccChhhHHhHH
Q psy4688         290 ACAASLK----IH-------------NIKTHL-------QF------------TGVPIEKFKCDLCDKEFFEKKKLNKHK  333 (388)
Q Consensus       290 ~~~~~L~----~H-------------~~~~H~-------~~------------~~~~~~~~~C~~C~k~F~~~~~L~~H~  333 (388)
                      ...-...    .-             +...+.       +.            .........|.+||+.|.+.++|+.|+
T Consensus       820 ~~~v~~~pvl~~~~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~  899 (958)
T KOG1074|consen  820 APSVNMDPVLWNQETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHM  899 (958)
T ss_pred             ccccccCchhhcccccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhh
Confidence            2111000    00             000000       00            000012378999999999999999999


Q ss_pred             hhhcCCCcccCCcchhhH--HhHHHHHHHHhcCCCCc
Q psy4688         334 NWAHGDKFHLCKVCGAKI--KGSLKQHMITHTGERKY  368 (388)
Q Consensus       334 ~~hh~~~~~~C~~C~~~f--~~~L~~H~~~H~~~~~~  368 (388)
                      ++|.|+|||.|.+|++.|  +++|+.||.+|....|+
T Consensus       900 rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~  936 (958)
T KOG1074|consen  900 RTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPP  936 (958)
T ss_pred             hcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCC
Confidence            999999999999999998  78899999999876654


No 2  
>KOG1074|consensus
Probab=99.97  E-value=4.5e-31  Score=244.57  Aligned_cols=198  Identities=27%  Similarity=0.532  Sum_probs=146.4

Q ss_pred             CCcccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCccccc---ccCCcCCCh
Q psy4688         188 VTVCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECD---YCGAKYPNK  264 (388)
Q Consensus       188 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~---~C~~~f~~~  264 (388)
                      +..|-+|-++..-++.|+.|+ +.|+|+|||+|.+||+.|.++.+|+.|+-+|-.....+  ..+.|+   +|-+.|.+.
T Consensus       605 PNqCiiC~rVlSC~saLqmHy-rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R--~q~ScP~~~ic~~kftn~  681 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHY-RTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPAR--VQFSCPSTFICQKKFTNA  681 (958)
T ss_pred             ccceeeeeecccchhhhhhhh-hcccCcCccccccccchhccccchhhcccccccCcccc--ccccCCchhhhccccccc
Confidence            346999999999999999997 67999999999999999999999999999886554433  479999   999999999


Q ss_pred             hHHHHHHhhcCCC-C------------Cccccccccccccccccchhhccc-------ccccc---CCC----CCccccC
Q psy4688         265 YTLSDHISGHTGI-P------------NHICKICNKGYACAASLKIHNIKT-------HLQFT---GVP----IEKFKCD  317 (388)
Q Consensus       265 ~~L~~H~~~H~~~-~------------~~~C~~C~k~f~~~~~L~~H~~~~-------H~~~~---~~~----~~~~~C~  317 (388)
                      ..|..|+++|.+. .            .-+|..|.+.|.....+..++...       +.+..   ..+    ..+..+.
T Consensus       682 V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~  761 (958)
T KOG1074|consen  682 VTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPEN  761 (958)
T ss_pred             ccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccc
Confidence            9999999999832 1            247999999998888777774332       11000   000    0123333


Q ss_pred             CCcccccChhhHHhHHhhh-------------------------------------------------------------
Q psy4688         318 LCDKEFFEKKKLNKHKNWA-------------------------------------------------------------  336 (388)
Q Consensus       318 ~C~k~F~~~~~L~~H~~~h-------------------------------------------------------------  336 (388)
                      .|+..+.....+..+-..+                                                             
T Consensus       762 ~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~  841 (958)
T KOG1074|consen  762 SCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGL  841 (958)
T ss_pred             ccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccc
Confidence            3433333222111110000                                                             


Q ss_pred             -----------------------cC--------C--CcccCCcchhhH--HhHHHHHHHHhcCCCCccccccchhh--Hh
Q psy4688         337 -----------------------HG--------D--KFHLCKVCGAKI--KGSLKQHMITHTGERKYCCHICGKKL--RG  379 (388)
Q Consensus       337 -----------------------h~--------~--~~~~C~~C~~~f--~~~L~~H~~~H~~~~~~~C~~C~k~f--~~  379 (388)
                                             ..        .  ..+.|.+||+.|  .+.|..||++|+|++||.|.+|++.|  ++
T Consensus       842 ~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrg  921 (958)
T KOG1074|consen  842 ATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRG  921 (958)
T ss_pred             ccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhh
Confidence                                   00        0  127799999999  45699999999999999999999999  78


Q ss_pred             hhhhhhccC
Q psy4688         380 KLKEHMLNT  388 (388)
Q Consensus       380 ~l~~H~~~~  388 (388)
                      +||+||+.|
T Consensus       922 nLKvHMgtH  930 (958)
T KOG1074|consen  922 NLKVHMGTH  930 (958)
T ss_pred             hhhhhhccc
Confidence            899999987


No 3  
>KOG2462|consensus
Probab=99.96  E-value=1.9e-30  Score=212.85  Aligned_cols=130  Identities=33%  Similarity=0.648  Sum_probs=78.0

Q ss_pred             cccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhHHHHHHhhcCCCCCccccccccccccccccc
Q psy4688         217 KYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAASLK  296 (388)
Q Consensus       217 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~  296 (388)
                      .|+|+.||+.+.+.+.|.+|.++|-....   ++.+.|.+|||.|.+...|..|+++|+                     
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s---~ka~~C~~C~K~YvSmpALkMHirTH~---------------------  185 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDS---KKAFSCKYCGKVYVSMPALKMHIRTHT---------------------  185 (279)
T ss_pred             ceeccccccccccccccchhhcccccccc---cccccCCCCCceeeehHHHhhHhhccC---------------------
Confidence            45555555555555555555555543221   223555555555555555555555554                     


Q ss_pred             hhhccccccccCCCCCccccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhH--HhHHHHHHHHhcCCCCccccccc
Q psy4688         297 IHNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKI--KGSLKQHMITHTGERKYCCHICG  374 (388)
Q Consensus       297 ~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f--~~~L~~H~~~H~~~~~~~C~~C~  374 (388)
                                     -+++|.+|||.|.+.-.|+-|+|+|+|||||.|++|+++|  +++|+.||++|++.++|+|+.|+
T Consensus       186 ---------------l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~  250 (279)
T KOG2462|consen  186 ---------------LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCG  250 (279)
T ss_pred             ---------------CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchh
Confidence                           2456666666666666666677777777777777777776  56677777777777777777777


Q ss_pred             hhhH--hhhhhhh
Q psy4688         375 KKLR--GKLKEHM  385 (388)
Q Consensus       375 k~f~--~~l~~H~  385 (388)
                      |+|.  +-|.+|.
T Consensus       251 KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  251 KSFALKSYLNKHS  263 (279)
T ss_pred             hHHHHHHHHHHhh
Confidence            7773  3366664


No 4  
>KOG2462|consensus
Probab=99.95  E-value=1e-28  Score=202.64  Aligned_cols=137  Identities=32%  Similarity=0.672  Sum_probs=111.9

Q ss_pred             hccCCCcccccccccCCchHHHHhHHhhhC---CCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCc
Q psy4688         184 IKRRVTVCPKCNRDYRNPRNMRKHLRRVHT---SVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAK  260 (388)
Q Consensus       184 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~---~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~  260 (388)
                      .....+.|+.|++.+.+..+|.+| +..|-   ..+.+.|++||+.|.+..+|..|+++|..        +++|.+|||.
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrH-kQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l--------~c~C~iCGKa  196 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRH-KQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL--------PCECGICGKA  196 (279)
T ss_pred             ccCCceeccccccccccccccchh-hcccccccccccccCCCCCceeeehHHHhhHhhccCC--------Cccccccccc
Confidence            455678999999999999999999 45664   35679999999999999999999999973        6899999999


Q ss_pred             CCChhHHHHHHhhcCCCCCccccccccccccccccchhhccccccccCCCCCccccCCCcccccChhhHHhHHhh
Q psy4688         261 YPNKYTLSDHISGHTGIPNHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLNKHKNW  335 (388)
Q Consensus       261 f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~  335 (388)
                      |...+.|+.|+|+|+||+||.|+.|+|.|+.+++|+.| +.+|.     ..++|+|+.|+|.|..++.|.+|...
T Consensus       197 FSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAH-mQTHS-----~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  197 FSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAH-MQTHS-----DVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccchHHhhcccccccCCCCccCCcccchhcchHHHHHH-HHhhc-----CCccccCcchhhHHHHHHHHHHhhhh
Confidence            99999999999999999988888777777777777766 33332     24567777777777777777777653


No 5  
>KOG3608|consensus
Probab=99.95  E-value=9.3e-28  Score=201.83  Aligned_cols=231  Identities=23%  Similarity=0.464  Sum_probs=195.0

Q ss_pred             ccc--ccchhcccChhhHHHHHHhhccCCCc-----CC-C-Cccccc--cchhccCCchHHHHHHhhcCCCCCccCCccc
Q psy4688          71 TTC--TMCKKTFRNKATFQKHMQRAHVGLKI-----SV-S-KHFECN--YCHAKFSNKSLLSDHISSHTGLKNYKCHVCD  139 (388)
Q Consensus        71 ~~C--~~C~~~f~~~~~l~~H~~~~h~~~~~-----~~-~-~~~~C~--~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~  139 (388)
                      |.|  ..|+..|.+...+..|+..+-.....     .. . ..+.|.  .|-+.|.+++.|++|++.|++++...|+.|+
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg  214 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCG  214 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHH
Confidence            456  45999999999999998644332111     11 1 235565  5999999999999999999999999999999


Q ss_pred             cccCChHHHHHHHhhhcccccccccCceeeecCCCCCccccchhhccCCCcccccccccCCchHHHHhHHhhhCCCCccc
Q psy4688         140 KAYSCRKALKTHTLLHEQEKVIKSSKKEFIIDTGDCTLDEWNDFIKRRVTVCPKCNRDYRNPRNMRKHLRRVHTSVRKYG  219 (388)
Q Consensus       140 ~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~  219 (388)
                      ..|.++..|-.|.+.-...                          ...+|.|..|.|.|.+...|..|+.+ |.  .-|+
T Consensus       215 ~~F~~~tkl~DH~rRqt~l--------------------------~~n~fqC~~C~KrFaTeklL~~Hv~r-Hv--n~yk  265 (467)
T KOG3608|consen  215 ELFRTKTKLFDHLRRQTEL--------------------------NTNSFQCAQCFKRFATEKLLKSHVVR-HV--NCYK  265 (467)
T ss_pred             HHhccccHHHHHHHhhhhh--------------------------cCCchHHHHHHHHHhHHHHHHHHHHH-hh--hccc
Confidence            9999999999998754321                          22468899999999999999999754 44  3599


Q ss_pred             CCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhHHHHHHhhcCCCCCccccc--cccccccccccch
Q psy4688         220 CDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYTLSDHISGHTGIPNHICKI--CNKGYACAASLKI  297 (388)
Q Consensus       220 C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~--C~k~f~~~~~L~~  297 (388)
                      |+.|+.+....++|..|++..|...     +||+|+.|++.|.+.+.|.+|..+|+ +..|.|+.  |..+|.+..+|++
T Consensus       266 CplCdmtc~~~ssL~~H~r~rHs~d-----kpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~  339 (467)
T KOG3608|consen  266 CPLCDMTCSSASSLTTHIRYRHSKD-----KPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRR  339 (467)
T ss_pred             ccccccCCCChHHHHHHHHhhhccC-----CCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHH
Confidence            9999999999999999999988654     38999999999999999999999999 67899988  9999999999999


Q ss_pred             hhccccccccCCCCCccccCCCcccccChhhHHhHHhhhcCC
Q psy4688         298 HNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLNKHKNWAHGD  339 (388)
Q Consensus       298 H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~  339 (388)
                      |.+.+|   .+....+|.|-.|++.|++-.+|..|++..|+-
T Consensus       340 H~~evh---Eg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f  378 (467)
T KOG3608|consen  340 HFLEVH---EGNNPILYACHCCDRFFTSGKSLSAHLMKKHGF  378 (467)
T ss_pred             HHHHhc---cCCCCCceeeecchhhhccchhHHHHHHHhhcc
Confidence            988888   344457899999999999999999999888763


No 6  
>KOG3608|consensus
Probab=99.94  E-value=7.8e-27  Score=196.31  Aligned_cols=241  Identities=23%  Similarity=0.496  Sum_probs=202.7

Q ss_pred             cCCC--CCcCCcCCCcHHHHHHHHhhcc------------C-CCccccc--cchhcccChhhHHHHHHhhccCCCcCCCC
Q psy4688          41 TKTC--PICNKSYPGARNMRKHLRLVHD------------K-NSTTTCT--MCKKTFRNKATFQKHMQRAHVGLKISVSK  103 (388)
Q Consensus        41 ~~~C--~~C~~~f~~~~~l~~H~~~~h~------------~-~~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~~~  103 (388)
                      .|.|  +.|+..|.+...+..|+.. |.            + ...+.|.  .|-+.|.+++.|++|++ .|.+     ++
T Consensus       134 ~f~C~WedCe~~F~s~~ef~dHV~~-H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r-~Hs~-----eK  206 (467)
T KOG3608|consen  134 NFRCGWEDCEREFVSIVEFQDHVVK-HALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIR-THSN-----EK  206 (467)
T ss_pred             hhccChhhcCCcccCHHHHHHHHHH-hhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHH-hcCC-----Ce
Confidence            4667  5799999999999999854 42            1 1346675  59999999999999986 5544     57


Q ss_pred             ccccccchhccCCchHHHHHHhhcC--CCCCccCCccccccCChHHHHHHHhhhcccccccccCceeeecCCCCCccccc
Q psy4688         104 HFECNYCHAKFSNKSLLSDHISSHT--GLKNYKCHVCDKAYSCRKALKTHTLLHEQEKVIKSSKKEFIIDTGDCTLDEWN  181 (388)
Q Consensus       104 ~~~C~~C~~~f~~~~~L~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~  181 (388)
                      ...|+.||..|.++..|-.|++.-+  ...+|.|..|.+.|.+...|..|+..|-.                        
T Consensus       207 vvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn------------------------  262 (467)
T KOG3608|consen  207 VVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN------------------------  262 (467)
T ss_pred             EEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh------------------------
Confidence            8899999999999999999987644  45789999999999999999999998853                        


Q ss_pred             hhhccCCCcccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccc--cCC
Q psy4688         182 DFIKRRVTVCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDY--CGA  259 (388)
Q Consensus       182 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~--C~~  259 (388)
                            -|+|+.|+......++|..||+..|..++||+|+.|++.|.+.+.|.+|..+|...       .|.|+.  |..
T Consensus       263 ------~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~-------~y~C~h~~C~~  329 (467)
T KOG3608|consen  263 ------CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKT-------VYQCEHPDCHY  329 (467)
T ss_pred             ------cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcccc-------ceecCCCCCcH
Confidence                  46799999999999999999999999999999999999999999999999988732       499998  999


Q ss_pred             cCCChhHHHHHHhhcC-C--CCCccccccccccccccccchhhccccccccCCCCCccccCCCcccccC
Q psy4688         260 KYPNKYTLSDHISGHT-G--IPNHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFE  325 (388)
Q Consensus       260 ~f~~~~~L~~H~~~H~-~--~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~  325 (388)
                      +|++...|.+|++.+. |  +.+|.|..|++.|++-.+|..|.++.|.-....+-+.|.=..|.-.|.+
T Consensus       330 s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~~PsGh~RFtYk~~edG~mR  398 (467)
T KOG3608|consen  330 SVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFRLPSGHKRFTYKVDEDGFMR  398 (467)
T ss_pred             HHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcccCCCCCCceeeeeccCceee
Confidence            9999999999998765 4  4579999999999999999999998886544444445555555555543


No 7  
>KOG3623|consensus
Probab=99.94  E-value=1.7e-26  Score=210.93  Aligned_cols=113  Identities=27%  Similarity=0.656  Sum_probs=99.1

Q ss_pred             cCCCCCcCCcCCCcHHHHHHHHhhccC-CCccccccchhcccChhhHHHHHHhhccCCCc-------CCCCccccccchh
Q psy4688          41 TKTCPICNKSYPGARNMRKHLRLVHDK-NSTTTCTMCKKTFRNKATFQKHMQRAHVGLKI-------SVSKHFECNYCHA  112 (388)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~~h~~-~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~-------~~~~~~~C~~C~~  112 (388)
                      ..+|++|.+.+.....|+.|++..|.. +..|.|.+|..+|..+..|.+||..+-.+...       ...+.|+|..||+
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            479999999999999999999887754 45699999999999999999999866544221       1236799999999


Q ss_pred             ccCCchHHHHHHhhcCCCCCccCCccccccCChHHHHHHHh
Q psy4688         113 KFSNKSLLSDHISSHTGLKNYKCHVCDKAYSCRKALKTHTL  153 (388)
Q Consensus       113 ~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  153 (388)
                      .|..+-.|+.|+++|.|++||.|+.|++.|+....+..||-
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            99999999999999999999999999999999999988874


No 8  
>KOG3576|consensus
Probab=99.76  E-value=1.2e-19  Score=141.55  Aligned_cols=122  Identities=24%  Similarity=0.424  Sum_probs=106.6

Q ss_pred             CCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhHHHHHHhhcCCCCCcccccccccccccc
Q psy4688         214 SVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAA  293 (388)
Q Consensus       214 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~  293 (388)
                      +...|.|.+|+|.|.....|++|++-|...+      .|.|..||+.|.....|++|+++|+|.+||+|..|++.|+..-
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vk------r~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrc  187 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVK------RHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRC  187 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHH------HHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhc
Confidence            3456999999999999999999999988665      5899999999999999999999999999999999999999999


Q ss_pred             ccchhhcccccccc-----CCCCCccccCCCcccccChhhHHhHHhhhcCCCc
Q psy4688         294 SLKIHNIKTHLQFT-----GVPIEKFKCDLCDKEFFEKKKLNKHKNWAHGDKF  341 (388)
Q Consensus       294 ~L~~H~~~~H~~~~-----~~~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~  341 (388)
                      +|..|..++|....     ....+.|.|+.||.+-.....+..|++.||..-|
T Consensus       188 sleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  188 SLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             cHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            99999888885422     1224569999999999999999999999987654


No 9  
>KOG3576|consensus
Probab=99.67  E-value=1.1e-17  Score=130.65  Aligned_cols=111  Identities=31%  Similarity=0.655  Sum_probs=97.8

Q ss_pred             cccccccCCcCCChhHHHHHHhhcCCCCCccccccccccccccccchhhccccccccCCCCCccccCCCcccccChhhHH
Q psy4688         251 EYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLN  330 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~  330 (388)
                      .|.|.+|+|.|.-+..|.+|++-|...+.|-|..||++|.....|++| .++|   +  .++||+|..|+|.|...-.|.
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh-~rth---t--gvrpykc~~c~kaftqrcsle  190 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRH-TRTH---T--GVRPYKCSLCEKAFTQRCSLE  190 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhh-hccc---c--CccccchhhhhHHHHhhccHH
Confidence            599999999999999999999999999999999999999999999999 4555   3  478999999999999999999


Q ss_pred             hHHhhhcCC-----------CcccCCcchhhH--HhHHHHHHHHhcCCCC
Q psy4688         331 KHKNWAHGD-----------KFHLCKVCGAKI--KGSLKQHMITHTGERK  367 (388)
Q Consensus       331 ~H~~~hh~~-----------~~~~C~~C~~~f--~~~L~~H~~~H~~~~~  367 (388)
                      .|++..||.           +.|.|+.||.+-  ...+..|+..|...-|
T Consensus       191 shl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  191 SHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            999999984           679999999865  3457788888765544


No 10 
>KOG3623|consensus
Probab=99.57  E-value=9.4e-16  Score=141.28  Aligned_cols=112  Identities=23%  Similarity=0.576  Sum_probs=99.3

Q ss_pred             CCcccccccccCCchHHHHhHHhhhC-CCCcccCCCCcccCCChhHHHHHHHHhccCCccc-------ccCcccccccCC
Q psy4688         188 VTVCPKCNRDYRNPRNMRKHLRRVHT-SVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVK-------VKYEYECDYCGA  259 (388)
Q Consensus       188 ~~~C~~C~~~f~~~~~l~~H~~~~h~-~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~-------~~~~~~C~~C~~  259 (388)
                      ...|++|.+.+.....|+.|++..|. .+..|.|.+|..+|..+..|.+|+.+|..+....       ..+.|+|..|||
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            45799999999999999999987775 4567999999999999999999999987654321       234699999999


Q ss_pred             cCCChhHHHHHHhhcCCCCCccccccccccccccccchhh
Q psy4688         260 KYPNKYTLSDHISGHTGIPNHICKICNKGYACAASLKIHN  299 (388)
Q Consensus       260 ~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~  299 (388)
                      .|..+..|+.|+|+|+|++||.|+-|+|+|.-..+...|+
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHm  329 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHM  329 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccc
Confidence            9999999999999999999999999999999999998884


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.37  E-value=5.6e-13  Score=124.07  Aligned_cols=138  Identities=21%  Similarity=0.500  Sum_probs=93.8

Q ss_pred             ccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccc--cCCcCCChhHHHHHHhhcCCCCCcccccccccccccccc
Q psy4688         218 YGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDY--CGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAASL  295 (388)
Q Consensus       218 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~--C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L  295 (388)
                      -.|+.|...... ..|..|...-...       .-.|+.  ||..|. +..|..|         +.|+.|++.|. ...|
T Consensus       408 V~C~NC~~~i~l-~~l~lHe~~C~r~-------~V~Cp~~~Cg~v~~-r~el~~H---------~~C~~Cgk~f~-~s~L  468 (567)
T PLN03086        408 VECRNCKHYIPS-RSIALHEAYCSRH-------NVVCPHDGCGIVLR-VEEAKNH---------VHCEKCGQAFQ-QGEM  468 (567)
T ss_pred             EECCCCCCccch-hHHHHHHhhCCCc-------ceeCCcccccceee-ccccccC---------ccCCCCCCccc-hHHH
Confidence            467777765543 3455676433211       235763  887773 3344444         37888888885 5667


Q ss_pred             chhhccccccccCCCCCccccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhHH------------hHHHHHHHHhc
Q psy4688         296 KIHNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKIK------------GSLKQHMITHT  363 (388)
Q Consensus       296 ~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f~------------~~L~~H~~~H~  363 (388)
                      ..|....|        .++.|+ ||+.+ .+..|..|+.+|.+.+++.|+.|++.|.            +.|..|+.+. 
T Consensus       469 ekH~~~~H--------kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-  537 (567)
T PLN03086        469 EKHMKVFH--------EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-  537 (567)
T ss_pred             HHHHHhcC--------CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-
Confidence            77754433        468888 88654 5688888888888888888888888773            2588888875 


Q ss_pred             CCCCccccccchhhH-hhhhhhh
Q psy4688         364 GERKYCCHICGKKLR-GKLKEHM  385 (388)
Q Consensus       364 ~~~~~~C~~C~k~f~-~~l~~H~  385 (388)
                      |.+++.|..||+.|. .-|..|+
T Consensus       538 G~rt~~C~~Cgk~Vrlrdm~~H~  560 (567)
T PLN03086        538 GSRTAPCDSCGRSVMLKEMDIHQ  560 (567)
T ss_pred             CCcceEccccCCeeeehhHHHHH
Confidence            888888888888884 4477775


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.29  E-value=4.1e-12  Score=118.43  Aligned_cols=142  Identities=19%  Similarity=0.477  Sum_probs=108.0

Q ss_pred             CcccccccccCCchHHHHhHHhhhCCCCcccCCC--CcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhH
Q psy4688         189 TVCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDE--CGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYT  266 (388)
Q Consensus       189 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~  266 (388)
                      ..|+.|..... ..+|..|..  +-.-..-.|+.  ||..|. +..+..|               +.|+.|++.|. ...
T Consensus       408 V~C~NC~~~i~-l~~l~lHe~--~C~r~~V~Cp~~~Cg~v~~-r~el~~H---------------~~C~~Cgk~f~-~s~  467 (567)
T PLN03086        408 VECRNCKHYIP-SRSIALHEA--YCSRHNVVCPHDGCGIVLR-VEEAKNH---------------VHCEKCGQAFQ-QGE  467 (567)
T ss_pred             EECCCCCCccc-hhHHHHHHh--hCCCcceeCCcccccceee-ccccccC---------------ccCCCCCCccc-hHH
Confidence            36999988775 456668852  33334567884  999884 3334443               57999999996 678


Q ss_pred             HHHHHhhcCCCCCccccccccccccccccchhhccccccccCCCCCccccCCCccccc----------ChhhHHhHHhhh
Q psy4688         267 LSDHISGHTGIPNHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFF----------EKKKLNKHKNWA  336 (388)
Q Consensus       267 L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~----------~~~~L~~H~~~h  336 (388)
                      |..|+..|+  .++.|+ ||+.+ ....|..|. ..     ..+.+++.|+.|++.|.          ..+.|..|... 
T Consensus       468 LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~-~t-----hCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-  536 (567)
T PLN03086        468 MEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQ-AS-----TCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-  536 (567)
T ss_pred             HHHHHHhcC--CCccCC-CCCCc-chhHHHhhh-hc-----cCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-
Confidence            999999985  789999 99755 567888883 33     34578999999999995          24589999987 


Q ss_pred             cCCCcccCCcchhhH-HhHHHHHHHH
Q psy4688         337 HGDKFHLCKVCGAKI-KGSLKQHMIT  361 (388)
Q Consensus       337 h~~~~~~C~~C~~~f-~~~L~~H~~~  361 (388)
                      .|.+++.|..||+.+ ...|..|+..
T Consensus       537 CG~rt~~C~~Cgk~Vrlrdm~~H~~~  562 (567)
T PLN03086        537 CGSRTAPCDSCGRSVMLKEMDIHQIA  562 (567)
T ss_pred             cCCcceEccccCCeeeehhHHHHHHH
Confidence            599999999999998 4568888763


No 13 
>PHA00733 hypothetical protein
Probab=99.13  E-value=5e-11  Score=90.66  Aligned_cols=80  Identities=19%  Similarity=0.259  Sum_probs=50.4

Q ss_pred             cccccccCCcCCChhHHHHH--Hh---hcCCCCCccccccccccccccccchhhccccccccCCCCCccccCCCcccccC
Q psy4688         251 EYECDYCGAKYPNKYTLSDH--IS---GHTGIPNHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFE  325 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H--~~---~H~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~  325 (388)
                      ++.|.+|++.|.+...|..+  ++   .+.+.+||.|+.||+.|.+...|..|.. .|       ..+|.|+.|++.|..
T Consensus        40 ~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r-~h-------~~~~~C~~CgK~F~~  111 (128)
T PHA00733         40 RLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIR-YT-------EHSKVCPVCGKEFRN  111 (128)
T ss_pred             hHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHh-cC-------CcCccCCCCCCccCC
Confidence            57788887777776666555  11   2233566777777777777777766633 22       124677777777777


Q ss_pred             hhhHHhHHhhhcC
Q psy4688         326 KKKLNKHKNWAHG  338 (388)
Q Consensus       326 ~~~L~~H~~~hh~  338 (388)
                      ...|..|+...|+
T Consensus       112 ~~sL~~H~~~~h~  124 (128)
T PHA00733        112 TDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHHhcC
Confidence            7777777766665


No 14 
>KOG3993|consensus
Probab=99.11  E-value=2.5e-11  Score=105.86  Aligned_cols=201  Identities=19%  Similarity=0.324  Sum_probs=120.7

Q ss_pred             CccccccchhccCCchHHHHHHhhcCCCCCccCCccccccCChHHHHHHHhhhcccccccc--cCc-eeeecCCCCCccc
Q psy4688         103 KHFECNYCHAKFSNKSLLSDHISSHTGLKNYKCHVCDKAYSCRKALKTHTLLHEQEKVIKS--SKK-EFIIDTGDCTLDE  179 (388)
Q Consensus       103 ~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~--~~~-~~~~~~~~~~~~~  179 (388)
                      ..|.|..|...|.+...|.+|.-.-.-...|+|+.|+++|+...+|..|.++|........  ... ...+++++     
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~ra-----  340 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRA-----  340 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhh-----
Confidence            3599999999999999999996433333469999999999999999999999975433221  000 00011000     


Q ss_pred             cchhhccCCCcccccccccCCchHHHHhHH--hhhCCCCcccCCCCcccCCChhHHHHHHHHhccCCccccc--------
Q psy4688         180 WNDFIKRRVTVCPKCNRDYRNPRNMRKHLR--RVHTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVK--------  249 (388)
Q Consensus       180 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~--~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~--------  249 (388)
                                              +.+-..  .....+..|.|.+|++.|.+...|+.|+.+|+.....+..        
T Consensus       341 ------------------------e~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~  396 (500)
T KOG3993|consen  341 ------------------------EVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSR  396 (500)
T ss_pred             ------------------------hhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhh
Confidence                                    000000  0012233577777777777777777777777654333211        


Q ss_pred             ---CcccccccCCcCCChhHHHHHHhhcCC-CCCccccccccccccccccchhhccccccccCCCCCccccCCCcccccC
Q psy4688         250 ---YEYECDYCGAKYPNKYTLSDHISGHTG-IPNHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFE  325 (388)
Q Consensus       250 ---~~~~C~~C~~~f~~~~~L~~H~~~H~~-~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~  325 (388)
                         .-+-|+.|+-.+.....-..+...+.+ .....|++||-.+.++..--.+..      .+.....|.|.+|.-.|.+
T Consensus       397 ~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~r------lg~~~q~f~~ky~~atfys  470 (500)
T KOG3993|consen  397 VIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGR------LGIAEQGFTCKYCPATFYS  470 (500)
T ss_pred             cccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCcccc------ccchhhccccccchHhhhc
Confidence               113455555555443333333322222 123457778877766555444421      1223456889999999999


Q ss_pred             hhhHHhHHhhhcC
Q psy4688         326 KKKLNKHKNWAHG  338 (388)
Q Consensus       326 ~~~L~~H~~~hh~  338 (388)
                      ...|.+|+...|.
T Consensus       471 s~~ltrhin~~Hp  483 (500)
T KOG3993|consen  471 SPGLTRHINKCHP  483 (500)
T ss_pred             CcchHhHhhhcCh
Confidence            9999999876553


No 15 
>PHA00733 hypothetical protein
Probab=99.05  E-value=2.9e-10  Score=86.49  Aligned_cols=98  Identities=15%  Similarity=0.291  Sum_probs=70.6

Q ss_pred             cHHHHHHHHhhccCCCccccccchhcccChhhHHHH--HHhhccCCCcCCCCccccccchhccCCchHHHHHHhhcCCCC
Q psy4688          54 ARNMRKHLRLVHDKNSTTTCTMCKKTFRNKATFQKH--MQRAHVGLKISVSKHFECNYCHAKFSNKSLLSDHISSHTGLK  131 (388)
Q Consensus        54 ~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H--~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~  131 (388)
                      ...|.++-.+ -...+++.|.+|++.|.....|..+  +.++ .  .....++|.|+.|++.|.+...|..|++.|  +.
T Consensus        25 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~-~--~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~   98 (128)
T PHA00733         25 LEELKRYHSL-TPEQKRLIRAVVKTLIYNPQLLDESSYLYKL-L--TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EH   98 (128)
T ss_pred             HHHhhhhhcC-ChhhhhHHHHHHhhhccChhhhcchHHHHhh-c--ccCCCCCccCCCCCCcCCCHHHHHHHHhcC--Cc
Confidence            4445444221 2335678888888888887777766  2221 1  112357899999999999999999998876  35


Q ss_pred             CccCCccccccCChHHHHHHHhhhcc
Q psy4688         132 NYKCHVCDKAYSCRKALKTHTLLHEQ  157 (388)
Q Consensus       132 ~~~C~~C~~~f~~~~~l~~H~~~h~~  157 (388)
                      +|.|+.|++.|.....|..|+...++
T Consensus        99 ~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         99 SKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CccCCCCCCccCCHHHHHHHHHHhcC
Confidence            78999999999999999999876654


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.00  E-value=1.6e-10  Score=61.38  Aligned_cols=25  Identities=52%  Similarity=1.042  Sum_probs=22.7

Q ss_pred             HHHHHHHHhcCCCCccccccchhhH
Q psy4688         354 SLKQHMITHTGERKYCCHICGKKLR  378 (388)
Q Consensus       354 ~L~~H~~~H~~~~~~~C~~C~k~f~  378 (388)
                      +|.+||++|+|++||.|++|+++|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            5889999999999999999999984


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.97  E-value=3.4e-10  Score=70.25  Aligned_cols=44  Identities=23%  Similarity=0.455  Sum_probs=37.1

Q ss_pred             cccccccCCcCCChhHHHHHHhhcCCCCCccccccccccccccccc
Q psy4688         251 EYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAASLK  296 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~  296 (388)
                      .|+|+.||+.|.....|..|+++|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4789999999999899999998888  5888888888888777764


No 18 
>KOG3993|consensus
Probab=98.90  E-value=2e-10  Score=100.36  Aligned_cols=110  Identities=22%  Similarity=0.442  Sum_probs=68.6

Q ss_pred             cCCCCCcCCcCCCcHHHHHHH--HhhccCCCccccccchhcccChhhHHHHHHhhccCCCcC--CCCccccccchhccCC
Q psy4688          41 TKTCPICNKSYPGARNMRKHL--RLVHDKNSTTTCTMCKKTFRNKATFQKHMQRAHVGLKIS--VSKHFECNYCHAKFSN  116 (388)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~--~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~--~~~~~~C~~C~~~f~~  116 (388)
                      .|.|..|...|.+...|.+|.  +++|   ..|+|+.|+|+|.-..+|..|.+.|-......  ...+=+     +.-.+
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~---vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k-----~~~~~  338 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVH---VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPK-----QAVET  338 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEE---eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChh-----hhhhh
Confidence            599999999999999999994  3334   35999999999999999999976543221111  001100     00000


Q ss_pred             chHHHHHHhh--cCCCCCccCCccccccCChHHHHHHHhhhccc
Q psy4688         117 KSLLSDHISS--HTGLKNYKCHVCDKAYSCRKALKTHTLLHEQE  158 (388)
Q Consensus       117 ~~~L~~H~~~--h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  158 (388)
                      ....+.=.+.  ...+.-|.|.+|++.|.+...|+.|+.+|+..
T Consensus       339 rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  339 RAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             hhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhcc
Confidence            0000000000  02234688888888888888888888887654


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=98.87  E-value=1e-09  Score=68.14  Aligned_cols=43  Identities=19%  Similarity=0.434  Sum_probs=36.6

Q ss_pred             ccccccchhccCCchHHHHHHhhcCCCCCccCCccccccCChHHH
Q psy4688         104 HFECNYCHAKFSNKSLLSDHISSHTGLKNYKCHVCDKAYSCRKAL  148 (388)
Q Consensus       104 ~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l  148 (388)
                      .|.|+.||+.|+..+.|..|+++|+  ++|+|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            3789999999999999999999987  688999999988876655


No 20 
>PHA00616 hypothetical protein
Probab=98.69  E-value=6.8e-09  Score=61.19  Aligned_cols=34  Identities=21%  Similarity=0.271  Sum_probs=25.0

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcCCCcccCCc
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKV  346 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~  346 (388)
                      ||+|+.||+.|..++.|.+|++.|||++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4677777777777777777777777777776653


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.68  E-value=1e-08  Score=54.40  Aligned_cols=25  Identities=32%  Similarity=0.663  Sum_probs=22.1

Q ss_pred             HHHHHHhhcCCCCCccccccccccc
Q psy4688         266 TLSDHISGHTGIPNHICKICNKGYA  290 (388)
Q Consensus       266 ~L~~H~~~H~~~~~~~C~~C~k~f~  290 (388)
                      +|..|+++|+|++||.|++|+++|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4788999999999999999999886


No 22 
>PHA00732 hypothetical protein
Probab=98.60  E-value=1.6e-08  Score=69.47  Aligned_cols=46  Identities=28%  Similarity=0.606  Sum_probs=24.3

Q ss_pred             cccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhHHhHHHHHHHHh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKIKGSLKQHMITH  362 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f~~~L~~H~~~H  362 (388)
                      |.|+.||+.|.+...|+.|++.+|.  ++.|+.||+.|. .|..|++++
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~-~l~~H~~~~   47 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR-RLNQHFYSQ   47 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC-Chhhhhccc
Confidence            5556666666666666666553222  235666665554 355555443


No 23 
>PHA00616 hypothetical protein
Probab=98.52  E-value=7.2e-08  Score=56.90  Aligned_cols=32  Identities=19%  Similarity=0.407  Sum_probs=29.7

Q ss_pred             cccCCcchhhH--HhHHHHHHHHhcCCCCccccc
Q psy4688         341 FHLCKVCGAKI--KGSLKQHMITHTGERKYCCHI  372 (388)
Q Consensus       341 ~~~C~~C~~~f--~~~L~~H~~~H~~~~~~~C~~  372 (388)
                      ||+|+.||+.|  +++|..|++.|+|++|+.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            68999999999  678999999999999999975


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.52  E-value=1.9e-07  Score=59.57  Aligned_cols=50  Identities=26%  Similarity=0.595  Sum_probs=35.8

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcCC--CcccCCcchhhHHhHHHHHHHHhc
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHGD--KFHLCKVCGAKIKGSLKQHMITHT  363 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~~--~~~~C~~C~~~f~~~L~~H~~~H~  363 (388)
                      .|.||+|++ ..+...|..|....|..  +.+.|++|...+..+|..||..+.
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVTDNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhhhHHHHHHHHhc
Confidence            477888888 45567788887766542  457788888777777888877654


No 25 
>PHA00732 hypothetical protein
Probab=98.43  E-value=1.8e-07  Score=64.31  Aligned_cols=21  Identities=24%  Similarity=0.513  Sum_probs=10.0

Q ss_pred             ccCCCCcccCCChhHHHHHHH
Q psy4688         218 YGCDECGKMLKSRDSLNTHKK  238 (388)
Q Consensus       218 ~~C~~C~~~f~~~~~l~~H~~  238 (388)
                      |.|++||+.|.+..+|..|++
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r   22 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHAR   22 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhh
Confidence            444444444444444444444


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.36  E-value=7.8e-07  Score=56.79  Aligned_cols=51  Identities=22%  Similarity=0.520  Sum_probs=33.5

Q ss_pred             cCCCCCcCCcCCCcHHHHHHHHhhccCC-CccccccchhcccChhhHHHHHHhhc
Q psy4688          41 TKTCPICNKSYPGARNMRKHLRLVHDKN-STTTCTMCKKTFRNKATFQKHMQRAH   94 (388)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~-~~~~C~~C~~~f~~~~~l~~H~~~~h   94 (388)
                      .|+||+|++ ..+...|..|+...|..+ ..+.|++|...+.  .+|..|+...|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            477777777 445667777776666554 3577777776544  36777776554


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.10  E-value=1.8e-06  Score=44.44  Aligned_cols=23  Identities=35%  Similarity=0.803  Sum_probs=19.8

Q ss_pred             cccCCCcccccChhhHHhHHhhh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWA  336 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~h  336 (388)
                      |+|++|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67999999999999999998873


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.95  E-value=5.5e-06  Score=43.09  Aligned_cols=24  Identities=38%  Similarity=0.805  Sum_probs=19.3

Q ss_pred             cccCCCcccccChhhHHhHHhhhc
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWAH  337 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~hh  337 (388)
                      |.|++|++.|.+...|+.|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            679999999999999999998875


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.82  E-value=1.1e-05  Score=41.39  Aligned_cols=20  Identities=35%  Similarity=0.786  Sum_probs=9.1

Q ss_pred             cCCCCcccCCChhHHHHHHH
Q psy4688         219 GCDECGKMLKSRDSLNTHKK  238 (388)
Q Consensus       219 ~C~~C~~~f~~~~~l~~H~~  238 (388)
                      .|++|++.|.++..|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHh
Confidence            34444444444444444444


No 30 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.82  E-value=5.8e-06  Score=70.19  Aligned_cols=58  Identities=26%  Similarity=0.552  Sum_probs=35.0

Q ss_pred             CCCccccc--cccccccccccchhhcccccc-------------ccCCCCCccccCCCcccccChhhHHhHHh
Q psy4688         277 IPNHICKI--CNKGYACAASLKIHNIKTHLQ-------------FTGVPIEKFKCDLCDKEFFEKKKLNKHKN  334 (388)
Q Consensus       277 ~~~~~C~~--C~k~f~~~~~L~~H~~~~H~~-------------~~~~~~~~~~C~~C~k~F~~~~~L~~H~~  334 (388)
                      ++||+|++  |+|.|+....|+.|++.-|..             .-....+||.|++|+|+|+....|+.|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            36677765  677777777777665544411             01112366777777777777777777654


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.71  E-value=1.8e-05  Score=42.43  Aligned_cols=26  Identities=35%  Similarity=0.612  Sum_probs=22.0

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcC
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHG  338 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~  338 (388)
                      +|+|+.|++.|.+...|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57899999999999999999987753


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.68  E-value=2.3e-05  Score=57.58  Aligned_cols=24  Identities=29%  Similarity=0.776  Sum_probs=12.8

Q ss_pred             CccCCccccccCChHHHHHHHhhh
Q psy4688         132 NYKCHVCDKAYSCRKALKTHTLLH  155 (388)
Q Consensus       132 ~~~C~~C~~~f~~~~~l~~H~~~h  155 (388)
                      .+.|..|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            455555555555555555555543


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.64  E-value=2.6e-05  Score=57.28  Aligned_cols=72  Identities=19%  Similarity=0.468  Sum_probs=17.8

Q ss_pred             ccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhHHHHH
Q psy4688         191 CPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYTLSDH  270 (388)
Q Consensus       191 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H  270 (388)
                      |..|+..|.+...|..||...|.-..+     ....+.....+..+.+..       +...+.|.+|++.|.+...|..|
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~-------~~~~~~C~~C~~~f~s~~~l~~H   69 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKK-------VKESFRCPYCNKTFRSREALQEH   69 (100)
T ss_dssp             -----------------------------------------------------------SSEEBSSSS-EESSHHHHHHH
T ss_pred             ccccccccccccccccccccccccccc-----cccccccccccccccccc-------cCCCCCCCccCCCCcCHHHHHHH
Confidence            777888888888888887766653322     111122333333333221       11147788888888888888888


Q ss_pred             Hhhc
Q psy4688         271 ISGH  274 (388)
Q Consensus       271 ~~~H  274 (388)
                      |+.+
T Consensus        70 m~~~   73 (100)
T PF12756_consen   70 MRSK   73 (100)
T ss_dssp             HHHT
T ss_pred             HcCc
Confidence            8764


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.63  E-value=3.8e-05  Score=39.78  Aligned_cols=22  Identities=32%  Similarity=0.750  Sum_probs=10.2

Q ss_pred             cCCCCcccCCChhHHHHHHHHh
Q psy4688         219 GCDECGKMLKSRDSLNTHKKIQ  240 (388)
Q Consensus       219 ~C~~C~~~f~~~~~l~~H~~~~  240 (388)
                      .|++|++.|.+...|..|+.++
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHHhh
Confidence            4555555555555555555444


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.47  E-value=0.00014  Score=43.96  Aligned_cols=32  Identities=19%  Similarity=0.342  Sum_probs=23.4

Q ss_pred             CCCccccCCCcccccChhhHHhHHhhhcCCCc
Q psy4688         310 PIEKFKCDLCDKEFFEKKKLNKHKNWAHGDKF  341 (388)
Q Consensus       310 ~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~  341 (388)
                      .+.|-.|++|+..+.+..+|++|+...|+.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            35688999999999999999999999998876


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.45  E-value=5.6e-05  Score=40.47  Aligned_cols=23  Identities=43%  Similarity=0.927  Sum_probs=10.8

Q ss_pred             ccCCCCcccCCChhHHHHHHHHh
Q psy4688         218 YGCDECGKMLKSRDSLNTHKKIQ  240 (388)
Q Consensus       218 ~~C~~C~~~f~~~~~l~~H~~~~  240 (388)
                      |.|+.|++.|.+...|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            44444444444444444444433


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.32  E-value=9e-05  Score=63.16  Aligned_cols=24  Identities=29%  Similarity=0.528  Sum_probs=20.2

Q ss_pred             CCCCccccccccccccccccchhh
Q psy4688         276 GIPNHICKICNKGYACAASLKIHN  299 (388)
Q Consensus       276 ~~~~~~C~~C~k~f~~~~~L~~H~  299 (388)
                      ..+||.|++|+|+|+....|+.|.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCCceeccccchhhccCccceecc
Confidence            357899999999999988888883


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.05  E-value=0.00028  Score=55.88  Aligned_cols=34  Identities=32%  Similarity=0.677  Sum_probs=18.1

Q ss_pred             ccCCcchhhHHhHHHHHHHHhcCCCCccccccchhh
Q psy4688         342 HLCKVCGAKIKGSLKQHMITHTGERKYCCHICGKKL  377 (388)
Q Consensus       342 ~~C~~C~~~f~~~L~~H~~~H~~~~~~~C~~C~k~f  377 (388)
                      |.|. |+. ...++++|+++|+|+++|.|..|+..|
T Consensus       120 Y~C~-C~~-~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        120 YRCK-CQE-HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEcC-CCC-eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            4444 444 333455555555555555555555554


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.04  E-value=0.00045  Score=35.68  Aligned_cols=24  Identities=29%  Similarity=0.565  Sum_probs=17.8

Q ss_pred             cccCCCcccccChhhHHhHHhhhcC
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWAHG  338 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~hh~  338 (388)
                      |+|+.|+.... +..|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            67888888887 8888888888774


No 40 
>KOG2231|consensus
Probab=97.03  E-value=0.00075  Score=64.78  Aligned_cols=147  Identities=27%  Similarity=0.467  Sum_probs=90.4

Q ss_pred             CcccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCC---------
Q psy4688         189 TVCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGA---------  259 (388)
Q Consensus       189 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~---------  259 (388)
                      ..|.+|++.|....             ..-.|..| -.|.+...|+.|+...|..        +.|.+|-.         
T Consensus       100 ~~C~~C~~~~~~~~-------------~~~~~~~c-~~~~s~~~Lk~H~~~~H~~--------~~c~lC~~~~kif~~e~  157 (669)
T KOG2231|consen  100 HSCHICDRRFRALY-------------NKKECLHC-TEFKSVENLKNHMRDQHKL--------HLCSLCLQNLKIFINER  157 (669)
T ss_pred             hhcCccccchhhhc-------------ccCCCccc-cchhHHHHHHHHHHHhhhh--------hccccccccceeeeeee
Confidence            56888877763210             11357777 6777888888888766642        44544422         


Q ss_pred             cCCChhHHHHHHhhcCC-CC----CccccccccccccccccchhhccccccccCCCCCccccCCC------cccccChhh
Q psy4688         260 KYPNKYTLSDHISGHTG-IP----NHICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLC------DKEFFEKKK  328 (388)
Q Consensus       260 ~f~~~~~L~~H~~~H~~-~~----~~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C------~k~F~~~~~  328 (388)
                      ...++..|..|+..-.. +.    --.|..|...|-....|..|....|          |.|-.|      +..|.....
T Consensus       158 k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----------~~chfC~~~~~~neyy~~~~d  227 (669)
T KOG2231|consen  158 KLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----------EFCHFCDYKTGQNEYYNDYDD  227 (669)
T ss_pred             ehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce----------eheeecCcccccchhcccchH
Confidence            22345677777653211 11    2358888888888888888866555          445555      456778888


Q ss_pred             HHhHHhhhcCCCcccCC--cchh-hH------HhHHHHHHHHhcCCCCcccc
Q psy4688         329 LNKHKNWAHGDKFHLCK--VCGA-KI------KGSLKQHMITHTGERKYCCH  371 (388)
Q Consensus       329 L~~H~~~hh~~~~~~C~--~C~~-~f------~~~L~~H~~~H~~~~~~~C~  371 (388)
                      |..|.+..|    |.|+  .|.. .|      ...|+.|.+.+.-++-|.|.
T Consensus       228 Le~HfR~~H----flCE~~~C~~~~f~~~~~~ei~lk~~~~~~~~e~~~~~~  275 (669)
T KOG2231|consen  228 LEEHFRKGH----FLCEEEFCRTKKFYVAFELEIELKAHNRFIQHEKCYICR  275 (669)
T ss_pred             HHHHhhhcC----ccccccccccceeeehhHHHHHHHhhccccchheeccCC
Confidence            999988766    6777  6642 23      22355555444445555553


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.00  E-value=0.00059  Score=35.81  Aligned_cols=23  Identities=30%  Similarity=0.611  Sum_probs=17.7

Q ss_pred             cccCCCcccccChhhHHhHHhhh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWA  336 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~h  336 (388)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46888888888888888887754


No 42 
>KOG2231|consensus
Probab=96.91  E-value=0.0019  Score=62.10  Aligned_cols=103  Identities=24%  Similarity=0.513  Sum_probs=65.2

Q ss_pred             ccccccccCCchHHHHhHHhhhCCCCcccCCCCc---------ccCCChhHHHHHHHHhcc-CCcccccCcccccccCCc
Q psy4688         191 CPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECG---------KMLKSRDSLNTHKKIQHE-GKKVKVKYEYECDYCGAK  260 (388)
Q Consensus       191 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~---------~~f~~~~~l~~H~~~~~~-~~~~~~~~~~~C~~C~~~  260 (388)
                      |..| ..|.+...|+.|+...|..   +.|.+|-         ...-+...|..|+..--. ++..++  --.|..|...
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rG--hp~C~~C~~~  191 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRG--HPLCKFCHER  191 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccC--Cccchhhhhh
Confidence            7777 7777888888887766643   4455442         222356677777765433 222111  2368888888


Q ss_pred             CCChhHHHHHHhhcCCCCCcccccc------ccccccccccchhhcccc
Q psy4688         261 YPNKYTLSDHISGHTGIPNHICKIC------NKGYACAASLKIHNIKTH  303 (388)
Q Consensus       261 f~~~~~L~~H~~~H~~~~~~~C~~C------~k~f~~~~~L~~H~~~~H  303 (388)
                      |.....|..|++.++    |.|..|      +.-|.....|..|-...|
T Consensus       192 fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  192 FLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             hccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            888888888887654    345555      445666677887766666


No 43 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.89  E-value=0.0015  Score=56.49  Aligned_cols=24  Identities=21%  Similarity=0.534  Sum_probs=15.4

Q ss_pred             ccccc--chhcccChhhHHHHHHhhc
Q psy4688          71 TTCTM--CKKTFRNKATFQKHMQRAH   94 (388)
Q Consensus        71 ~~C~~--C~~~f~~~~~l~~H~~~~h   94 (388)
                      |.|+.  |..+......|..|.+..|
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H  177 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQH  177 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhc
Confidence            56654  6666666667777766555


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.88  E-value=0.0006  Score=35.61  Aligned_cols=23  Identities=35%  Similarity=0.779  Sum_probs=19.2

Q ss_pred             cccCCCcccccChhhHHhHHhhh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWA  336 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~h  336 (388)
                      |.|++|++.|.+...|+.|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57889999999999999988753


No 45 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.86  E-value=0.00092  Score=35.05  Aligned_cols=21  Identities=29%  Similarity=0.727  Sum_probs=9.7

Q ss_pred             cccccCCcCCChhHHHHHHhh
Q psy4688         253 ECDYCGAKYPNKYTLSDHISG  273 (388)
Q Consensus       253 ~C~~C~~~f~~~~~L~~H~~~  273 (388)
                      .|+.|++.|.+...|..|++.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHH
Confidence            344444444444444444443


No 46 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.55  E-value=0.001  Score=35.49  Aligned_cols=22  Identities=41%  Similarity=0.801  Sum_probs=18.3

Q ss_pred             cccCCCcccccChhhHHhHHhh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNW  335 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~  335 (388)
                      |.|++|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888875


No 47 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.54  E-value=0.0014  Score=39.72  Aligned_cols=33  Identities=27%  Similarity=0.507  Sum_probs=19.2

Q ss_pred             hCCCCcccCCCCcccCCChhHHHHHHHHhccCC
Q psy4688         212 HTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGK  244 (388)
Q Consensus       212 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  244 (388)
                      +.++.|-.|++|+..+.+..+|++|+.+.|..+
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            445567777777777777777777777766543


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.42  E-value=0.0016  Score=33.90  Aligned_cols=17  Identities=35%  Similarity=0.905  Sum_probs=6.4

Q ss_pred             cccchhccCCchHHHHH
Q psy4688         107 CNYCHAKFSNKSLLSDH  123 (388)
Q Consensus       107 C~~C~~~f~~~~~L~~H  123 (388)
                      |++|++.|.+...|..|
T Consensus         3 C~~C~~~f~s~~~~~~H   19 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQH   19 (25)
T ss_dssp             ETTTTEEESSHHHHHHH
T ss_pred             CCCCCCCcCCHHHHHHH
Confidence            33333333333333333


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=96.34  E-value=0.002  Score=51.04  Aligned_cols=40  Identities=20%  Similarity=0.500  Sum_probs=34.0

Q ss_pred             CcccccccCCcCCChhHHHHHHhhcCCCCCcccccccccccccc
Q psy4688         250 YEYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAA  293 (388)
Q Consensus       250 ~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~  293 (388)
                      .+|.|. |+.   ....+.+|.++|+++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            479998 987   6778899999999999999999999886543


No 50 
>KOG2482|consensus
Probab=96.33  E-value=0.026  Score=49.17  Aligned_cols=77  Identities=22%  Similarity=0.288  Sum_probs=44.5

Q ss_pred             CcccccccccCCchHHHHhHHhhhCCCC-cccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhHH
Q psy4688         189 TVCPKCNRDYRNPRNMRKHLRRVHTSVR-KYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYTL  267 (388)
Q Consensus       189 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~-~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L  267 (388)
                      .+|-.|.....+...|..||..+|.-+- +-+ ..=+-.|-.+-.+..=++..        .+.-.|-.|.-.|.....|
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~-sd~~Ln~YqrvrviNyiRkq--------~~~~~c~~cd~~F~~e~~l  350 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQ-SDYSLNFYQRVRVINYIRKQ--------KKKSRCAECDLSFWKEPGL  350 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhc-cccccchhhhhhHHHHHHHH--------hhccccccccccccCcchh
Confidence            5788888888888889999888874210 000 00011111121121111111        1124588888999999999


Q ss_pred             HHHHhhc
Q psy4688         268 SDHISGH  274 (388)
Q Consensus       268 ~~H~~~H  274 (388)
                      ..||..+
T Consensus       351 ~~hm~e~  357 (423)
T KOG2482|consen  351 LIHMVED  357 (423)
T ss_pred             hhhcccc
Confidence            9998654


No 51 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.96  E-value=0.0031  Score=54.69  Aligned_cols=19  Identities=21%  Similarity=0.532  Sum_probs=9.4

Q ss_pred             ccccCCcCCChhHHHHHHh
Q psy4688         254 CDYCGAKYPNKYTLSDHIS  272 (388)
Q Consensus       254 C~~C~~~f~~~~~L~~H~~  272 (388)
                      |..|...|.+-..|..|++
T Consensus       223 C~FC~~~FYdDDEL~~HcR  241 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCR  241 (493)
T ss_pred             hhhccceecChHHHHHHHH
Confidence            4445555554445555544


No 52 
>KOG1146|consensus
Probab=95.90  E-value=0.0012  Score=67.24  Aligned_cols=189  Identities=15%  Similarity=0.185  Sum_probs=107.2

Q ss_pred             CCCCcCCcCCCcHHHHHHHHhhccCCCccccccchhcccChhhHHHHHHhhccCCCcCCCCccccccchhccCCchHHHH
Q psy4688          43 TCPICNKSYPGARNMRKHLRLVHDKNSTTTCTMCKKTFRNKATFQKHMQRAHVGLKISVSKHFECNYCHAKFSNKSLLSD  122 (388)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~L~~  122 (388)
                      .|.-|+..+.+...+..|+...+.-.+.+.|+.|+..|.....|..||+..|.....        .+|.. +.+...+.+
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--------~~c~~-gq~~~~~ar  508 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--------AYCKA-GQNHPRLAR  508 (1406)
T ss_pred             cccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccch--------hHhHh-ccccccccc
Confidence            455566667777777777777777778899999999999999999999877654210        12211 000000000


Q ss_pred             HHhhcCCCCCccCCccccccCChHHHHHHHhhhccccccc---ccCc------------eeeecCCCCCccccchhhccC
Q psy4688         123 HISSHTGLKNYKCHVCDKAYSCRKALKTHTLLHEQEKVIK---SSKK------------EFIIDTGDCTLDEWNDFIKRR  187 (388)
Q Consensus       123 H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~---~~~~------------~~~~~~~~~~~~~~~~~~~~~  187 (388)
                      =...-.+.++|.|..|..+++++.+|..|+..-......+   ....            ......+-.......+-....
T Consensus       509 g~~~~~~~~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP  588 (1406)
T KOG1146|consen  509 GEVYRCPGKPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKP  588 (1406)
T ss_pred             cccccCCCCcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCC
Confidence            0001123467777777777777777777775321110000   0000            000000000000000112234


Q ss_pred             CCcccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHHh
Q psy4688         188 VTVCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKIQ  240 (388)
Q Consensus       188 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  240 (388)
                      .+.|.+|+..-.-..+|+.|+...+....|..+..++-.+.....+..+.+.+
T Consensus       589 ~~~C~vc~yetniarnlrihmtss~~s~~p~~~Lq~~it~~l~~~~~~~~~lp  641 (1406)
T KOG1146|consen  589 SWRCEVCSYETNIARNLRIHMTASPSSSPPSLVLQQNITSSLASLLGGQGRLP  641 (1406)
T ss_pred             CcchhhhcchhhhhhccccccccCCCCCChHHHhhhcchhhccccccCcCCCC
Confidence            56799999999999999999876666555577777777666665555554444


No 53 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.88  E-value=0.0066  Score=31.22  Aligned_cols=21  Identities=24%  Similarity=0.507  Sum_probs=8.6

Q ss_pred             cCCCCcccCCChhHHHHHHHHh
Q psy4688         219 GCDECGKMLKSRDSLNTHKKIQ  240 (388)
Q Consensus       219 ~C~~C~~~f~~~~~l~~H~~~~  240 (388)
                      +|+.|+.... ...|.+|++.+
T Consensus         2 ~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    2 KCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             E-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCcCC-HHHHHHHHHhh
Confidence            4444444443 44444444443


No 54 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.80  E-value=0.0036  Score=33.29  Aligned_cols=22  Identities=23%  Similarity=0.693  Sum_probs=14.4

Q ss_pred             ccccccCCcCCChhHHHHHHhh
Q psy4688         252 YECDYCGAKYPNKYTLSDHISG  273 (388)
Q Consensus       252 ~~C~~C~~~f~~~~~L~~H~~~  273 (388)
                      |.|+.|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5566777777776666666654


No 55 
>KOG2785|consensus
Probab=95.62  E-value=0.038  Score=49.11  Aligned_cols=57  Identities=19%  Similarity=0.266  Sum_probs=42.8

Q ss_pred             cccCCCCcccCCChhHHHHHHHHhccCCccc-----------------ccCcccccccC---CcCCChhHHHHHHhh
Q psy4688         217 KYGCDECGKMLKSRDSLNTHKKIQHEGKKVK-----------------VKYEYECDYCG---AKYPNKYTLSDHISG  273 (388)
Q Consensus       217 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~-----------------~~~~~~C~~C~---~~f~~~~~L~~H~~~  273 (388)
                      |-.|-.|++.+.+...-..||..+|+---+.                 +...|.|-.|+   +.|.+-.+.+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4668888888888888888888877643221                 23457899998   899999999999864


No 56 
>KOG2785|consensus
Probab=95.39  E-value=0.047  Score=48.55  Aligned_cols=53  Identities=19%  Similarity=0.327  Sum_probs=43.4

Q ss_pred             CCcccccccccCCchHHHHhHHhhhCC----------------------CCcccCCCCc---ccCCChhHHHHHHHHh
Q psy4688         188 VTVCPKCNRDYRNPRNMRKHLRRVHTS----------------------VRKYGCDECG---KMLKSRDSLNTHKKIQ  240 (388)
Q Consensus       188 ~~~C~~C~~~f~~~~~l~~H~~~~h~~----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~~  240 (388)
                      +..|-.|++.+.+...-..||...|.-                      ..-+.|-.|+   +.|.+..+.+.||...
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            467999999999999999999776642                      1236788888   9999999999999753


No 57 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.30  E-value=0.014  Score=30.31  Aligned_cols=20  Identities=30%  Similarity=0.919  Sum_probs=13.1

Q ss_pred             cccCCCcccccChhhHHhHHh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKN  334 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~  334 (388)
                      .+|+.||+.| ..+.|.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3577777777 5666666654


No 58 
>KOG4173|consensus
Probab=94.96  E-value=0.0079  Score=48.27  Aligned_cols=42  Identities=17%  Similarity=0.413  Sum_probs=19.2

Q ss_pred             cccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHH
Q psy4688         194 CNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKI  239 (388)
Q Consensus       194 C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  239 (388)
                      |.+.|.+......|....|+    -.|..|.+.|.+..-|..|+..
T Consensus        87 c~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E  128 (253)
T KOG4173|consen   87 CCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILE  128 (253)
T ss_pred             hHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHH
Confidence            44444444444444333332    2355555555555555555443


No 59 
>KOG4173|consensus
Probab=94.90  E-value=0.0066  Score=48.69  Aligned_cols=113  Identities=19%  Similarity=0.396  Sum_probs=74.8

Q ss_pred             cceeeecccccCCCCCceeeeceehhHHHHHhhCCcCCCCC--cCCcCCCcHHHHHHHHhhccCCCccccccchhcccCh
Q psy4688           6 AEVFLSQNVQMSNLSGSCVVDVITADKWRALIKNKTKTCPI--CNKSYPGARNMRKHLRLVHDKNSTTTCTMCKKTFRNK   83 (388)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~   83 (388)
                      ...|-..||+-.-+.....+++...   ...+....|.|++  |...|.+...+..|....|..    .|.+|.+.|.+.
T Consensus        47 ~pFf~~G~v~r~l~~~~V~~d~~d~---~~~~~~~~~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~  119 (253)
T KOG4173|consen   47 HPFFEDGDVQRHLYLQDVIMDVADV---PEKPRVPAFACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTG  119 (253)
T ss_pred             CcchhcccHHHHHhHhhheeecccc---ccccccccccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCch
Confidence            3445555666555555555554222   2244556788887  778899988888888766643    699999999999


Q ss_pred             hhHHHHHHhhccCC----CcCCCCccccc--cchhccCCchHHHHHHh
Q psy4688          84 ATFQKHMQRAHVGL----KISVSKHFECN--YCHAKFSNKSLLSDHIS  125 (388)
Q Consensus        84 ~~l~~H~~~~h~~~----~~~~~~~~~C~--~C~~~f~~~~~L~~H~~  125 (388)
                      ..|..|+...|...    ...+...|+|-  -|+..|.+...-+.|+.
T Consensus       120 hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I  167 (253)
T KOG4173|consen  120 HLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMI  167 (253)
T ss_pred             hhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHH
Confidence            99999987766421    01123457774  47777777777777754


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.86  E-value=0.0091  Score=56.60  Aligned_cols=157  Identities=16%  Similarity=0.149  Sum_probs=101.2

Q ss_pred             CcccCCCCcccCCChhHHHHHHH--HhccCCcccccCccccc--ccCCcCCChhHHHHHHhhcCCCCCcccccc--cccc
Q psy4688         216 RKYGCDECGKMLKSRDSLNTHKK--IQHEGKKVKVKYEYECD--YCGAKYPNKYTLSDHISGHTGIPNHICKIC--NKGY  289 (388)
Q Consensus       216 ~~~~C~~C~~~f~~~~~l~~H~~--~~~~~~~~~~~~~~~C~--~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C--~k~f  289 (388)
                      .++.|..|...|.....|..|.+  .|....    ..++.|+  .|++.|.+...+..|...|.+..++.+..-  ...+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~----~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  363 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGES----LKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKF  363 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccccc----CCceeeeccCCCccccccccccCCcccccCCCccccccccCcccc
Confidence            36788888888888888888888  455441    1368888  799999888888888888888877776553  3333


Q ss_pred             ccccccchhhccccccccCCCCCccccCC--CcccccChhhHHhHHhhhcCCC--cccCCcchhhHH--hHHHHHHHHhc
Q psy4688         290 ACAASLKIHNIKTHLQFTGVPIEKFKCDL--CDKEFFEKKKLNKHKNWAHGDK--FHLCKVCGAKIK--GSLKQHMITHT  363 (388)
Q Consensus       290 ~~~~~L~~H~~~~H~~~~~~~~~~~~C~~--C~k~F~~~~~L~~H~~~hh~~~--~~~C~~C~~~f~--~~L~~H~~~H~  363 (388)
                      .....-..+ ..............+.+..  |-..+.+...+..|...+-..+  .+.+..|.+.+.  ..|..|++.|.
T Consensus       364 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  442 (467)
T COG5048         364 SPLLNNEPP-QSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHT  442 (467)
T ss_pred             ccccCCCCc-cchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccc
Confidence            222221101 0000000111122333333  6777788888888877776655  466778887773  34778888888


Q ss_pred             CCCCccccccchhh
Q psy4688         364 GERKYCCHICGKKL  377 (388)
Q Consensus       364 ~~~~~~C~~C~k~f  377 (388)
                      ...++.|..++...
T Consensus       443 ~~~~~~~~~~~~~~  456 (467)
T COG5048         443 NHAPLLCSILKSFR  456 (467)
T ss_pred             cCCceeeccccccc
Confidence            88887776666554


No 61 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.73  E-value=0.031  Score=29.00  Aligned_cols=20  Identities=30%  Similarity=0.904  Sum_probs=11.5

Q ss_pred             CCCCCcCCcCCCcHHHHHHHH
Q psy4688          42 KTCPICNKSYPGARNMRKHLR   62 (388)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~   62 (388)
                      ..|++||+.| ....|.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4566666666 4455666653


No 62 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.98  E-value=0.035  Score=31.49  Aligned_cols=23  Identities=26%  Similarity=0.600  Sum_probs=19.9

Q ss_pred             ccccCCCcccccChhhHHhHHhh
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNW  335 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~  335 (388)
                      +|.|++|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57899999999999999999874


No 63 
>KOG2893|consensus
Probab=93.95  E-value=0.034  Score=45.81  Aligned_cols=47  Identities=28%  Similarity=0.625  Sum_probs=34.6

Q ss_pred             ccccCCcCCChhHHHHHHhhcCCCCCccccccccccccccccchhhccccc
Q psy4688         254 CDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAASLKIHNIKTHL  304 (388)
Q Consensus       254 C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  304 (388)
                      |-+|++.|.....|.+|++.    +-|+|.+|.|...+--.|.+|-+.+|.
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            77888888888888777653    457888888777777777777666553


No 64 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.56  E-value=0.077  Score=38.85  Aligned_cols=47  Identities=17%  Similarity=0.190  Sum_probs=25.4

Q ss_pred             ccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhH--HhHHHHHHHHhc
Q psy4688         315 KCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKI--KGSLKQHMITHT  363 (388)
Q Consensus       315 ~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f--~~~L~~H~~~H~  363 (388)
                      .|--|...|........  ........|.|+.|...|  .-..-.|...|+
T Consensus        57 ~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhccC
Confidence            37778887765431110  001223457788887777  334555655554


No 65 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.35  E-value=0.063  Score=30.40  Aligned_cols=23  Identities=17%  Similarity=0.758  Sum_probs=16.3

Q ss_pred             cccccccCCcCCChhHHHHHHhh
Q psy4688         251 EYECDYCGAKYPNKYTLSDHISG  273 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~~  273 (388)
                      +|.|++|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777777777777653


No 66 
>KOG2482|consensus
Probab=93.20  E-value=0.13  Score=44.99  Aligned_cols=117  Identities=26%  Similarity=0.489  Sum_probs=82.5

Q ss_pred             CCcCCCCCcCCcCCC-cHHHHHHHHhhccCC---------------------CccccccchhcccChhhHHHHHHhh-cc
Q psy4688          39 NKTKTCPICNKSYPG-ARNMRKHLRLVHDKN---------------------STTTCTMCKKTFRNKATFQKHMQRA-HV   95 (388)
Q Consensus        39 ~~~~~C~~C~~~f~~-~~~l~~H~~~~h~~~---------------------~~~~C~~C~~~f~~~~~l~~H~~~~-h~   95 (388)
                      .....|-.|+..+.. ++....|+-.+|.-+                     ..+.|-+|.+.|.++..|+.||+.. |.
T Consensus       142 ~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hr  221 (423)
T KOG2482|consen  142 IFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHR  221 (423)
T ss_pred             eeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCc
Confidence            345789999988754 556667765445311                     2468999999999999999999743 21


Q ss_pred             CCCc-----------------------------------------------CCCCc--cccccchhccCCchHHHHHHhh
Q psy4688          96 GLKI-----------------------------------------------SVSKH--FECNYCHAKFSNKSLLSDHISS  126 (388)
Q Consensus        96 ~~~~-----------------------------------------------~~~~~--~~C~~C~~~f~~~~~L~~H~~~  126 (388)
                      .+..                                               ....+  ..|-.|.....+...|..||..
T Consensus       222 rinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~  301 (423)
T KOG2482|consen  222 RINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKI  301 (423)
T ss_pred             ccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHH
Confidence            1100                                               00112  5899999999999999999975


Q ss_pred             cCC---------------------------CCCccCCccccccCChHHHHHHHhhh
Q psy4688         127 HTG---------------------------LKNYKCHVCDKAYSCRKALKTHTLLH  155 (388)
Q Consensus       127 h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H~~~h  155 (388)
                      -+.                           ...-.|-.|+-.|.....|..||..+
T Consensus       302 vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  302 VHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             HHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            321                           01236888999999999999999754


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.16  E-value=0.043  Score=51.98  Aligned_cols=154  Identities=19%  Similarity=0.308  Sum_probs=105.3

Q ss_pred             CCCcccccccccCCchHHHHhHHh-hhCCC--CcccCC--CCcccCCChhHHHHHHHHhccCCcccccCccccc--ccCC
Q psy4688         187 RVTVCPKCNRDYRNPRNMRKHLRR-VHTSV--RKYGCD--ECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECD--YCGA  259 (388)
Q Consensus       187 ~~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~--~C~~  259 (388)
                      ..+.|..|...|.....|..|... .|.++  +++.|+  .|++.|.....+..|...+.....      +.+.  .+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~  361 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP------AKEKLLNSSS  361 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc------cccccccCcc
Confidence            367899999999999999999764 89999  999999  899999999999999999886552      2222  2333


Q ss_pred             cCCChhH-----HHHHHhhcCCCCCcccc--ccccccccccccchhhccccccccCCCCCccccCCCcccccChhhHHhH
Q psy4688         260 KYPNKYT-----LSDHISGHTGIPNHICK--ICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLNKH  332 (388)
Q Consensus       260 ~f~~~~~-----L~~H~~~H~~~~~~~C~--~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H  332 (388)
                      .+.....     .......-.....+.+.  .|...+.....+..|. ..|..   .....+.+..|.+.|.....|..|
T Consensus       362 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~  437 (467)
T COG5048         362 KFSPLLNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHI-ITHLS---FRPYNCKNPPCSKSFNRHYNLIPH  437 (467)
T ss_pred             ccccccCCCCccchhhccCccCCccccccccchhhhhcccccccccc-ccccc---cCCcCCCCCcchhhccCccccccc
Confidence            3332222     11111111222333332  2556666666666663 33322   123468899999999999999999


Q ss_pred             HhhhcCCCcccCCcchhh
Q psy4688         333 KNWAHGDKFHLCKVCGAK  350 (388)
Q Consensus       333 ~~~hh~~~~~~C~~C~~~  350 (388)
                      ++.+....++.|..++..
T Consensus       438 ~~~~~~~~~~~~~~~~~~  455 (467)
T COG5048         438 KKIHTNHAPLLCSILKSF  455 (467)
T ss_pred             ccccccCCceeecccccc
Confidence            999887777766655543


No 68 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.26  E-value=0.39  Score=35.29  Aligned_cols=21  Identities=24%  Similarity=0.343  Sum_probs=16.1

Q ss_pred             CcccCCCCcccCCChhHHHHH
Q psy4688         216 RKYGCDECGKMLKSRDSLNTH  236 (388)
Q Consensus       216 ~~~~C~~C~~~f~~~~~l~~H  236 (388)
                      -|..|++||-+..+...|.+-
T Consensus        14 LP~~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARS   34 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHh
Confidence            477888888888887777654


No 69 
>KOG2893|consensus
Probab=92.02  E-value=0.048  Score=44.97  Aligned_cols=47  Identities=21%  Similarity=0.523  Sum_probs=30.8

Q ss_pred             CCCCcCCcCCCcHHHHHHHHhhccCCCccccccchhcccChhhHHHHHHhhc
Q psy4688          43 TCPICNKSYPGARNMRKHLRLVHDKNSTTTCTMCKKTFRNKATFQKHMQRAH   94 (388)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h   94 (388)
                      -|-+|++.|.+..-|..|.+..|     |+|.+|.+...+--.|..|....|
T Consensus        12 wcwycnrefddekiliqhqkakh-----fkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKH-----FKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeeecccccchhhhhhhhhhhcc-----ceeeeehhhhccCCCceeehhhhh
Confidence            47777777777777777765433     677777776666666666654444


No 70 
>KOG1146|consensus
Probab=92.01  E-value=0.06  Score=55.57  Aligned_cols=83  Identities=18%  Similarity=0.294  Sum_probs=64.6

Q ss_pred             cccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCCChhHHHHHHHHhccCCcc-------------------cccC
Q psy4688         190 VCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKV-------------------KVKY  250 (388)
Q Consensus       190 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~-------------------~~~~  250 (388)
                      .|..|+..+.....+..|+...+.-.+.|.|+.|+..|+....|..|++..|.....                   ....
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~  517 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGK  517 (1406)
T ss_pred             cccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCC
Confidence            355666677777777777777788788999999999999999999999985432110                   1234


Q ss_pred             cccccccCCcCCChhHHHHHHh
Q psy4688         251 EYECDYCGAKYPNKYTLSDHIS  272 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~  272 (388)
                      +|.|..|...+..+..|..|+.
T Consensus       518 p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  518 PYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccceeeeeeeecchHHHHHHH
Confidence            7899999999999999999974


No 71 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.71  E-value=0.097  Score=29.27  Aligned_cols=7  Identities=29%  Similarity=1.279  Sum_probs=3.0

Q ss_pred             ccccccc
Q psy4688         281 ICKICNK  287 (388)
Q Consensus       281 ~C~~C~k  287 (388)
                      +|.+||.
T Consensus         3 ~C~~CGy    9 (33)
T cd00350           3 VCPVCGY    9 (33)
T ss_pred             ECCCCCC
Confidence            3444443


No 72 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.31  E-value=0.14  Score=31.64  Aligned_cols=29  Identities=34%  Similarity=0.549  Sum_probs=24.7

Q ss_pred             CCCccccCCCcccccChhhHHhHHhhhcC
Q psy4688         310 PIEKFKCDLCDKEFFEKKKLNKHKNWAHG  338 (388)
Q Consensus       310 ~~~~~~C~~C~k~F~~~~~L~~H~~~hh~  338 (388)
                      ++.-+.||-||..|....++.+|....|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34568899999999999999999988776


No 73 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.27  E-value=0.16  Score=31.42  Aligned_cols=28  Identities=25%  Similarity=0.653  Sum_probs=17.0

Q ss_pred             CCCccccccchhcccChhhHHHHHHhhc
Q psy4688          67 KNSTTTCTMCKKTFRNKATFQKHMQRAH   94 (388)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h   94 (388)
                      ++.-+.|+-|+..|....++.+|+...|
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            3444566666666666666666665555


No 74 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=89.37  E-value=0.38  Score=29.31  Aligned_cols=42  Identities=19%  Similarity=0.481  Sum_probs=20.3

Q ss_pred             ccccccccccccccccchhhccccccccCCCCCccccCCCccc
Q psy4688         280 HICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKE  322 (388)
Q Consensus       280 ~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~  322 (388)
                      |+|.+|+..|.....-..+.+..-..+...+ ..|.|++|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp-~~w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLP-DDWVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS--TT-B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCC-CCCcCcCCCCc
Confidence            6788888777655544333322222222222 34788888753


No 75 
>PF01352 KRAB:  KRAB box;  InterPro: IPR001909 The Krueppel-associated box (KRAB) is a domain of around 75 amino acids that is found in the N-terminal part of about one third of eukaryotic Krueppel-type C2H2 zinc finger proteins (ZFPs) []. It is enriched in charged amino acids and can be divided into subregions A and B, which are predicted to fold into two amphipathic alpha-helices. The KRAB A and B boxes can be separated by variable spacer segments and many KRAB proteins contain only the A box []. The functions currently known for members of the KRAB-containing protein family include transcriptional repression of RNA polymerase I, II, and III promoters, binding and splicing of RNA, and control of nucleolus function. The KRAB domain functions as a transcriptional repressor when tethered to the template DNA by a DNA-binding domain. A sequence of 45 amino acids in the KRAB A subdomain has been shown to be necessary and sufficient for transcriptional repression. The B box does not repress by itself but does potentiate the repression exerted by the KRAB A subdomain [, ]. Gene silencing requires the binding of the KRAB domain to the RING-B box-coiled coil (RBCC) domain of the KAP-1/TIF1-beta corepressor. As KAP-1 binds to the heterochromatin proteins HP1, it has been proposed that the KRAB-ZFP-bound target gene could be silenced following recruitment to heterochromatin [, ]. KRAB-ZFPs probably constitute the single largest class of transcription factors within the human genome []. Although the function of KRAB-ZFPs is largely unknown, they appear to play important roles during cell differentiation and development. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B.; GO: 0003676 nucleic acid binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1V65_A.
Probab=87.50  E-value=0.047  Score=32.24  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=17.7

Q ss_pred             ccccceeeecccccCCCCCceee
Q psy4688           3 FDRAEVFLSQNVQMSNLSGSCVV   25 (388)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~   25 (388)
                      ||++|+.||.+++.+|+.+..++
T Consensus        18 L~~~Qk~ly~dvm~Eny~~l~sl   40 (41)
T PF01352_consen   18 LDPAQKNLYRDVMLENYRNLVSL   40 (41)
T ss_dssp             S-HHHHHHHHHHHHHTTTS---S
T ss_pred             ccceecccchhHHHHhhcccEec
Confidence            99999999999999999886443


No 76 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=87.15  E-value=0.43  Score=29.52  Aligned_cols=12  Identities=33%  Similarity=0.639  Sum_probs=8.1

Q ss_pred             cccccccccccc
Q psy4688         280 HICKICNKGYAC  291 (388)
Q Consensus       280 ~~C~~C~k~f~~  291 (388)
                      |+|.+||..|..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            567777776654


No 77 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=87.01  E-value=0.36  Score=31.23  Aligned_cols=46  Identities=20%  Similarity=0.477  Sum_probs=23.6

Q ss_pred             CccccCC--CcccccChhhHHhHHhhhcCCCcccCCc----chhhH-HhHHHHH
Q psy4688         312 EKFKCDL--CDKEFFEKKKLNKHKNWAHGDKFHLCKV----CGAKI-KGSLKQH  358 (388)
Q Consensus       312 ~~~~C~~--C~k~F~~~~~L~~H~~~hh~~~~~~C~~----C~~~f-~~~L~~H  358 (388)
                      .+..|+.  |...+. +..|..|+...-..++..|++    |+..+ +..|..|
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~~~l~~H   60 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPREDLEEH   60 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEHHHHHHC
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccchhHHhCC
Confidence            4566776  444443 556777777555556666776    66655 3344443


No 78 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.31  E-value=0.47  Score=39.99  Aligned_cols=13  Identities=31%  Similarity=0.764  Sum_probs=9.9

Q ss_pred             cccCCCcccccCh
Q psy4688         314 FKCDLCDKEFFEK  326 (388)
Q Consensus       314 ~~C~~C~k~F~~~  326 (388)
                      ..||.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5788888887754


No 79 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=85.77  E-value=1  Score=33.43  Aligned_cols=26  Identities=31%  Similarity=0.538  Sum_probs=24.1

Q ss_pred             cccc----CCCcccccChhhHHhHHhhhcC
Q psy4688         313 KFKC----DLCDKEFFEKKKLNKHKNWAHG  338 (388)
Q Consensus       313 ~~~C----~~C~k~F~~~~~L~~H~~~hh~  338 (388)
                      -|.|    +.|+..+.+...|.+|.+.+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4899    9999999999999999999886


No 80 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=85.67  E-value=0.45  Score=26.77  Aligned_cols=6  Identities=33%  Similarity=1.248  Sum_probs=2.3

Q ss_pred             ccCCCc
Q psy4688         315 KCDLCD  320 (388)
Q Consensus       315 ~C~~C~  320 (388)
                      .|.+||
T Consensus         4 ~C~~CG    9 (34)
T cd00729           4 VCPVCG    9 (34)
T ss_pred             ECCCCC
Confidence            333333


No 81 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=84.04  E-value=0.67  Score=26.75  Aligned_cols=11  Identities=27%  Similarity=0.890  Sum_probs=6.6

Q ss_pred             ccccCCCcccc
Q psy4688         313 KFKCDLCDKEF  323 (388)
Q Consensus       313 ~~~C~~C~k~F  323 (388)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~~   35 (38)
T TIGR02098        25 KVRCGKCGHVW   35 (38)
T ss_pred             EEECCCCCCEE
Confidence            35666666655


No 82 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=83.74  E-value=1.9  Score=31.97  Aligned_cols=26  Identities=31%  Similarity=0.712  Sum_probs=18.6

Q ss_pred             CCCcccccccccCCchHHHHhHHhhhC
Q psy4688         187 RVTVCPKCNRDYRNPRNMRKHLRRVHT  213 (388)
Q Consensus       187 ~~~~C~~C~~~f~~~~~l~~H~~~~h~  213 (388)
                      +...|..|+..... +++..|++..|.
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~   35 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHH   35 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcc
Confidence            34568888877655 788888876654


No 83 
>PHA00626 hypothetical protein
Probab=83.63  E-value=0.72  Score=28.76  Aligned_cols=14  Identities=14%  Similarity=0.363  Sum_probs=8.4

Q ss_pred             CccccCCCcccccC
Q psy4688         312 EKFKCDLCDKEFFE  325 (388)
Q Consensus       312 ~~~~C~~C~k~F~~  325 (388)
                      ..|.|+.||..|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            34666666666643


No 84 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=83.48  E-value=0.56  Score=37.33  Aligned_cols=11  Identities=55%  Similarity=1.174  Sum_probs=5.4

Q ss_pred             CCCCccccccc
Q psy4688         364 GERKYCCHICG  374 (388)
Q Consensus       364 ~~~~~~C~~C~  374 (388)
                      |+.|-+||+||
T Consensus       146 ge~P~~CPiCg  156 (166)
T COG1592         146 GEAPEVCPICG  156 (166)
T ss_pred             CCCCCcCCCCC
Confidence            34445555554


No 85 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=83.36  E-value=0.88  Score=25.96  Aligned_cols=32  Identities=28%  Similarity=0.792  Sum_probs=18.4

Q ss_pred             cccccccccCCchHHHHhHHhhhCCCCcccCCCCcccC
Q psy4688         190 VCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKML  227 (388)
Q Consensus       190 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  227 (388)
                      .|+.|+..|.-....      +-......+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~------ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK------IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH------CCCCCcEEECCCCCCEe
Confidence            477777777655432      22333456777777665


No 86 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=81.98  E-value=0.67  Score=29.94  Aligned_cols=46  Identities=26%  Similarity=0.519  Sum_probs=31.6

Q ss_pred             CCcccCCc--chhhH-HhHHHHHHHHhcCCCCccccc----cchhh-Hhhhhhh
Q psy4688         339 DKFHLCKV--CGAKI-KGSLKQHMITHTGERKYCCHI----CGKKL-RGKLKEH  384 (388)
Q Consensus       339 ~~~~~C~~--C~~~f-~~~L~~H~~~H~~~~~~~C~~----C~k~f-~~~l~~H  384 (388)
                      ..+-.|+.  |...+ +..|..|+..-=..++-.|++    |+..+ ...|..|
T Consensus         7 ~~~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~~~l~~H   60 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVPREDLEEH   60 (60)
T ss_dssp             TSEEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEEHHHHHHC
T ss_pred             CCEeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccchhHHhCC
Confidence            45678988  65656 778999999766777889999    99998 5567766


No 87 
>KOG2186|consensus
Probab=81.65  E-value=0.7  Score=38.87  Aligned_cols=46  Identities=20%  Similarity=0.589  Sum_probs=21.4

Q ss_pred             ccCCCCcccCCChhHHHHHHHHhccCCcccccCcccccccCCcCCChhHHHHHHh
Q psy4688         218 YGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYECDYCGAKYPNKYTLSDHIS  272 (388)
Q Consensus       218 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~  272 (388)
                      |.|..||....-+ .+.+|+..-++.       -|.|-.|++.|.. .....|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn~-------~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRNA-------YFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccCC-------eeEEeeccccccc-chhhhhhh
Confidence            4555555544332 344455444331       2555555555544 44444443


No 88 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.45  E-value=0.99  Score=33.21  Aligned_cols=12  Identities=33%  Similarity=0.719  Sum_probs=5.4

Q ss_pred             ccccCCCccccc
Q psy4688         313 KFKCDLCDKEFF  324 (388)
Q Consensus       313 ~~~C~~C~k~F~  324 (388)
                      |..|+.||..|.
T Consensus        26 PivCP~CG~~~~   37 (108)
T PF09538_consen   26 PIVCPKCGTEFP   37 (108)
T ss_pred             CccCCCCCCccC
Confidence            344444444443


No 89 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=80.93  E-value=1.1  Score=25.79  Aligned_cols=33  Identities=30%  Similarity=0.893  Sum_probs=19.2

Q ss_pred             cccccccccCCchHHHHhHHhhhCCCCcccCCCCcccCC
Q psy4688         190 VCPKCNRDYRNPRNMRKHLRRVHTSVRKYGCDECGKMLK  228 (388)
Q Consensus       190 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~  228 (388)
                      .||.|+..|.-..+.      .-.+.....|+.|+..|.
T Consensus         4 ~CP~C~~~f~v~~~~------l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDK------LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHH------cccCCcEEECCCCCcEee
Confidence            477777777655431      123344567777776663


No 90 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.44  E-value=0.9  Score=33.43  Aligned_cols=28  Identities=25%  Similarity=0.729  Sum_probs=18.9

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhH
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKI  351 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f  351 (388)
                      +..|+.||++|...           +..|-.|+.||..|
T Consensus         9 KR~Cp~CG~kFYDL-----------nk~PivCP~CG~~~   36 (108)
T PF09538_consen    9 KRTCPSCGAKFYDL-----------NKDPIVCPKCGTEF   36 (108)
T ss_pred             cccCCCCcchhccC-----------CCCCccCCCCCCcc
Confidence            35688888888653           23566777777776


No 91 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=80.24  E-value=0.37  Score=40.58  Aligned_cols=10  Identities=30%  Similarity=0.541  Sum_probs=5.6

Q ss_pred             cccccCCcCC
Q psy4688         253 ECDYCGAKYP  262 (388)
Q Consensus       253 ~C~~C~~~f~  262 (388)
                      .|+.||.+|.
T Consensus        50 vCP~CgyA~~   59 (214)
T PF09986_consen   50 VCPHCGYAAF   59 (214)
T ss_pred             ECCCCCCccc
Confidence            4666665554


No 92 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=79.35  E-value=1.3  Score=26.84  Aligned_cols=12  Identities=17%  Similarity=0.501  Sum_probs=6.7

Q ss_pred             Cccccccccccc
Q psy4688         279 NHICKICNKGYA  290 (388)
Q Consensus       279 ~~~C~~C~k~f~  290 (388)
                      .|.|+.||..|.
T Consensus         3 ~y~C~~CG~~~~   14 (46)
T PRK00398          3 EYKCARCGREVE   14 (46)
T ss_pred             EEECCCCCCEEE
Confidence            356666665553


No 93 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=78.93  E-value=1.4  Score=23.03  Aligned_cols=11  Identities=27%  Similarity=0.534  Sum_probs=7.4

Q ss_pred             cccCCCccccc
Q psy4688         314 FKCDLCDKEFF  324 (388)
Q Consensus       314 ~~C~~C~k~F~  324 (388)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35777777764


No 94 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=78.48  E-value=1.1  Score=35.83  Aligned_cols=29  Identities=24%  Similarity=0.364  Sum_probs=15.5

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcCCCcccCCcchhh
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAK  350 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~  350 (388)
                      -|.|+.|+..|+.-.++.         -.|.|+.||..
T Consensus       109 ~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             eEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            355666665555555553         13556666543


No 95 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=77.88  E-value=2  Score=22.43  Aligned_cols=19  Identities=26%  Similarity=0.697  Sum_probs=12.6

Q ss_pred             ccCCCcccccChhhHHhHHh
Q psy4688         315 KCDLCDKEFFEKKKLNKHKN  334 (388)
Q Consensus       315 ~C~~C~k~F~~~~~L~~H~~  334 (388)
                      .||+|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777777 5566666664


No 96 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=77.21  E-value=1.1  Score=36.40  Aligned_cols=29  Identities=24%  Similarity=0.470  Sum_probs=17.4

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcCCCcccCCcchhh
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAK  350 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~  350 (388)
                      -|.|+.|+..|+.-.++.         -.|.|+.||..
T Consensus       117 ~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             EEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            466666666666665552         24667777653


No 97 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=76.72  E-value=1.8  Score=34.45  Aligned_cols=16  Identities=6%  Similarity=0.320  Sum_probs=8.0

Q ss_pred             ccccccCCcCCChhHH
Q psy4688         252 YECDYCGAKYPNKYTL  267 (388)
Q Consensus       252 ~~C~~C~~~f~~~~~L  267 (388)
                      |.|+.|+..|+...++
T Consensus       110 Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       110 FICPNMCVRFTFNEAM  125 (158)
T ss_pred             EECCCCCcEeeHHHHH
Confidence            4555555555444444


No 98 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=75.21  E-value=1.6  Score=34.37  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=5.4

Q ss_pred             Cccccccccccc
Q psy4688         279 NHICKICNKGYA  290 (388)
Q Consensus       279 ~~~C~~C~k~f~  290 (388)
                      -|.|+.|+..|.
T Consensus        99 ~Y~Cp~C~~~y~  110 (147)
T smart00531       99 YYKCPNCQSKYT  110 (147)
T ss_pred             EEECcCCCCEee
Confidence            344444444444


No 99 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.10  E-value=1.7  Score=25.79  Aligned_cols=11  Identities=18%  Similarity=0.673  Sum_probs=5.6

Q ss_pred             ccccccccccc
Q psy4688         280 HICKICNKGYA  290 (388)
Q Consensus       280 ~~C~~C~k~f~  290 (388)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (42)
T PF09723_consen    6 YRCEECGHEFE   16 (42)
T ss_pred             EEeCCCCCEEE
Confidence            45555555553


No 100
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=75.04  E-value=2.6  Score=25.23  Aligned_cols=24  Identities=29%  Similarity=0.486  Sum_probs=12.7

Q ss_pred             CccccCCCcccccCh----hhHHhHHhh
Q psy4688         312 EKFKCDLCDKEFFEK----KKLNKHKNW  335 (388)
Q Consensus       312 ~~~~C~~C~k~F~~~----~~L~~H~~~  335 (388)
                      ...+|.+|++.+...    +.|.+|++.
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            346677777777653    667777643


No 101
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=74.38  E-value=1.7  Score=32.74  Aligned_cols=22  Identities=27%  Similarity=0.317  Sum_probs=11.3

Q ss_pred             cccCCCcccccChhhHHhHHhhhcC
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWAHG  338 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~hh~  338 (388)
                      ..|-.+||.|++   |++|+.+|+|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccC
Confidence            345555555532   5555555544


No 102
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=73.29  E-value=3.3  Score=32.56  Aligned_cols=35  Identities=20%  Similarity=0.402  Sum_probs=17.6

Q ss_pred             cccccccCCcCCChhHHHHHHhhcCCCCCcccccccccc
Q psy4688         251 EYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGY  289 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f  289 (388)
                      .|.|+.|+..|.....+.. .  .. ...|.||.||...
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~-~--d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQL-L--DM-DGTFTCPRCGEEL  133 (147)
T ss_pred             EEECcCCCCEeeHHHHHHh-c--CC-CCcEECCCCCCEE
Confidence            4667777766664333221 0  11 2236666666544


No 103
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=73.26  E-value=1  Score=35.57  Aligned_cols=16  Identities=19%  Similarity=0.524  Sum_probs=9.3

Q ss_pred             cccccccccccccccc
Q psy4688         280 HICKICNKGYACAASL  295 (388)
Q Consensus       280 ~~C~~C~k~f~~~~~L  295 (388)
                      ++|+-||++|.+...+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            5666666666554443


No 104
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=73.16  E-value=2.2  Score=27.21  Aligned_cols=9  Identities=22%  Similarity=0.800  Sum_probs=4.4

Q ss_pred             ccccCCCcc
Q psy4688         313 KFKCDLCDK  321 (388)
Q Consensus       313 ~~~C~~C~k  321 (388)
                      +|.|+.||.
T Consensus        48 ~Y~CP~CGF   56 (59)
T PRK14890         48 PYTCPKCGF   56 (59)
T ss_pred             ceECCCCCC
Confidence            355555543


No 105
>COG1773 Rubredoxin [Energy production and conversion]
Probab=73.07  E-value=3  Score=26.24  Aligned_cols=13  Identities=23%  Similarity=0.583  Sum_probs=7.4

Q ss_pred             Ccccccccccccc
Q psy4688         279 NHICKICNKGYAC  291 (388)
Q Consensus       279 ~~~C~~C~k~f~~  291 (388)
                      .|+|.+||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            4566666666543


No 106
>KOG2186|consensus
Probab=73.05  E-value=1.2  Score=37.47  Aligned_cols=54  Identities=17%  Similarity=0.334  Sum_probs=33.5

Q ss_pred             ccccccccccccccccchhhccccccccCCCCCccccCCCcccccChhhHHhHHhhhcCCCcc
Q psy4688         280 HICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFFEKKKLNKHKNWAHGDKFH  342 (388)
Q Consensus       280 ~~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~  342 (388)
                      |.|.+||..-.- ..+.+|+-+-+       ..-|.|-.|++.|.. ..+..|..--+....|
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCr-------n~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCR-------NAYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhcc-------CCeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            678888876653 34555643333       245788888888877 6777777655544333


No 107
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=72.61  E-value=2.6  Score=34.36  Aligned_cols=13  Identities=15%  Similarity=0.524  Sum_probs=6.2

Q ss_pred             Ccccccccccccc
Q psy4688         279 NHICKICNKGYAC  291 (388)
Q Consensus       279 ~~~C~~C~k~f~~  291 (388)
                      -|.|+.|+..|+.
T Consensus       117 ~Y~Cp~C~~rytf  129 (178)
T PRK06266        117 FFFCPNCHIRFTF  129 (178)
T ss_pred             EEECCCCCcEEeH
Confidence            3445555544443


No 108
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=72.38  E-value=2.2  Score=34.00  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=6.9

Q ss_pred             CCCCCccccccc
Q psy4688         275 TGIPNHICKICN  286 (388)
Q Consensus       275 ~~~~~~~C~~C~  286 (388)
                      .|+.|-+||+||
T Consensus       145 ~ge~P~~CPiCg  156 (166)
T COG1592         145 EGEAPEVCPICG  156 (166)
T ss_pred             cCCCCCcCCCCC
Confidence            345566666665


No 109
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=72.05  E-value=1.3  Score=32.47  Aligned_cols=9  Identities=22%  Similarity=0.866  Sum_probs=5.2

Q ss_pred             cccCCCccc
Q psy4688         314 FKCDLCDKE  322 (388)
Q Consensus       314 ~~C~~C~k~  322 (388)
                      .+|+.||..
T Consensus        63 ~~Cp~Cg~~   71 (104)
T TIGR01384        63 VECPKCGHK   71 (104)
T ss_pred             CCCCCCCCC
Confidence            566666643


No 110
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=71.11  E-value=1.4  Score=25.76  Aligned_cols=11  Identities=18%  Similarity=0.631  Sum_probs=6.9

Q ss_pred             ccccccccccc
Q psy4688         280 HICKICNKGYA  290 (388)
Q Consensus       280 ~~C~~C~k~f~  290 (388)
                      |.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            56666666664


No 111
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=70.95  E-value=1.6  Score=36.50  Aligned_cols=30  Identities=33%  Similarity=0.544  Sum_probs=23.4

Q ss_pred             CCccccCCCcccccChhhHHhHHhhhcCCC
Q psy4688         311 IEKFKCDLCDKEFFEKKKLNKHKNWAHGDK  340 (388)
Q Consensus       311 ~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~  340 (388)
                      ...|.|++|+|.|.-..-..+|+...|.++
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            457999999999999999999999888764


No 112
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=70.51  E-value=2.4  Score=33.48  Aligned_cols=18  Identities=22%  Similarity=0.560  Sum_probs=14.4

Q ss_pred             ccccCCCcccccChhhHH
Q psy4688         313 KFKCDLCDKEFFEKKKLN  330 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~  330 (388)
                      .++|+.||++|.+...+.
T Consensus        28 ~~~c~~c~~~f~~~e~~~   45 (154)
T PRK00464         28 RRECLACGKRFTTFERVE   45 (154)
T ss_pred             eeeccccCCcceEeEecc
Confidence            489999999998765544


No 113
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=70.10  E-value=2.8  Score=25.14  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=4.5

Q ss_pred             cccccccccc
Q psy4688         280 HICKICNKGY  289 (388)
Q Consensus       280 ~~C~~C~k~f  289 (388)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4444444433


No 114
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=69.22  E-value=1.6  Score=27.18  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=6.4

Q ss_pred             ccccccccccc
Q psy4688         280 HICKICNKGYA  290 (388)
Q Consensus       280 ~~C~~C~k~f~  290 (388)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            55666665554


No 115
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=69.14  E-value=2.9  Score=26.59  Aligned_cols=8  Identities=25%  Similarity=1.144  Sum_probs=3.5

Q ss_pred             ccccCCCc
Q psy4688         313 KFKCDLCD  320 (388)
Q Consensus       313 ~~~C~~C~  320 (388)
                      +|.|+.||
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            34444444


No 116
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=68.63  E-value=4.1  Score=25.15  Aligned_cols=23  Identities=26%  Similarity=0.606  Sum_probs=16.1

Q ss_pred             ccccCCCcccccCh-----hhHHhHHhh
Q psy4688         313 KFKCDLCDKEFFEK-----KKLNKHKNW  335 (388)
Q Consensus       313 ~~~C~~C~k~F~~~-----~~L~~H~~~  335 (388)
                      .-.|..|++.++..     +.|.+|++.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            45688888877655     577777763


No 117
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=68.33  E-value=2.9  Score=31.34  Aligned_cols=10  Identities=20%  Similarity=0.624  Sum_probs=4.8

Q ss_pred             ccCCCccccc
Q psy4688         315 KCDLCDKEFF  324 (388)
Q Consensus       315 ~C~~C~k~F~  324 (388)
                      .|+.||++|.
T Consensus        11 ~Cp~cg~kFY   20 (129)
T TIGR02300        11 ICPNTGSKFY   20 (129)
T ss_pred             cCCCcCcccc
Confidence            4455554443


No 118
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=67.01  E-value=4.3  Score=30.50  Aligned_cols=30  Identities=10%  Similarity=0.192  Sum_probs=19.4

Q ss_pred             ccccccCCcCCChhHHHHHHhhcCCCCCccccccccccccc
Q psy4688         252 YECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACA  292 (388)
Q Consensus       252 ~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~  292 (388)
                      ..|+.||++|...           +..|-.|+.||..|...
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            5677777777542           22467777777777544


No 119
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=65.59  E-value=4.9  Score=22.20  Aligned_cols=10  Identities=20%  Similarity=0.790  Sum_probs=5.6

Q ss_pred             ccccCCCccc
Q psy4688         313 KFKCDLCDKE  322 (388)
Q Consensus       313 ~~~C~~C~k~  322 (388)
                      +.+|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            4567777643


No 120
>KOG2593|consensus
Probab=65.26  E-value=4.4  Score=37.28  Aligned_cols=35  Identities=23%  Similarity=0.633  Sum_probs=21.6

Q ss_pred             cCCCCCcCCcCCCcHHHHHHHHhhccCCCccccccchhc
Q psy4688          41 TKTCPICNKSYPGARNMRKHLRLVHDKNSTTTCTMCKKT   79 (388)
Q Consensus        41 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~   79 (388)
                      .|.|+.|++.|.....++    +.-.....|.|..|+-.
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~----L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQ----LLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccCCccccchhhhHHHH----hhcccCceEEEecCCCc
Confidence            477777777777666553    22333456777777543


No 121
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.81  E-value=5.4  Score=26.76  Aligned_cols=38  Identities=29%  Similarity=0.685  Sum_probs=23.8

Q ss_pred             CCCccccCCCcccccChhhHHhHHhhhcCCCcc-cCCcchhhHHhHH
Q psy4688         310 PIEKFKCDLCDKEFFEKKKLNKHKNWAHGDKFH-LCKVCGAKIKGSL  355 (388)
Q Consensus       310 ~~~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~-~C~~C~~~f~~~L  355 (388)
                      |.-.|.|..|+..|    .+.+||.    +.|+ .|+.||.+++..|
T Consensus         9 PtY~Y~c~~cg~~~----dvvq~~~----ddplt~ce~c~a~~kk~l   47 (82)
T COG2331           9 PTYSYECTECGNRF----DVVQAMT----DDPLTTCEECGARLKKLL   47 (82)
T ss_pred             cceEEeecccchHH----HHHHhcc----cCccccChhhChHHHHhh
Confidence            44568888888766    3444443    3444 5888887775444


No 122
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=64.58  E-value=2.9  Score=28.12  Aligned_cols=42  Identities=17%  Similarity=0.313  Sum_probs=22.2

Q ss_pred             ccccccCCcCCChhHHHHHHhhcCCCCCcccc--cccccccccccc
Q psy4688         252 YECDYCGAKYPNKYTLSDHISGHTGIPNHICK--ICNKGYACAASL  295 (388)
Q Consensus       252 ~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~--~C~k~f~~~~~L  295 (388)
                      +.|+.||..-....+-....  -..+.-+.|.  .||.+|....++
T Consensus         2 m~CP~Cg~~a~irtSr~~s~--~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD--TTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh--hhheeeeecCCCCCCCEEEEEEEE
Confidence            45777776653322221111  1334456776  777777765544


No 123
>PRK04023 DNA polymerase II large subunit; Validated
Probab=63.76  E-value=5.2  Score=41.03  Aligned_cols=8  Identities=38%  Similarity=1.086  Sum_probs=4.6

Q ss_pred             ccCCcchh
Q psy4688         342 HLCKVCGA  349 (388)
Q Consensus       342 ~~C~~C~~  349 (388)
                      +.|+.||.
T Consensus       664 y~CPKCG~  671 (1121)
T PRK04023        664 DECEKCGR  671 (1121)
T ss_pred             CcCCCCCC
Confidence            45666654


No 124
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=63.29  E-value=3.4  Score=22.46  Aligned_cols=8  Identities=25%  Similarity=0.742  Sum_probs=3.8

Q ss_pred             ccccCCCc
Q psy4688         313 KFKCDLCD  320 (388)
Q Consensus       313 ~~~C~~C~  320 (388)
                      .|.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34455554


No 125
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=63.15  E-value=3.8  Score=31.00  Aligned_cols=13  Identities=23%  Similarity=0.715  Sum_probs=6.6

Q ss_pred             cccCCCcccccCh
Q psy4688         314 FKCDLCDKEFFEK  326 (388)
Q Consensus       314 ~~C~~C~k~F~~~  326 (388)
                      ++|..||+.|..-
T Consensus         2 H~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCTKCGRVFEDG   14 (131)
T ss_pred             cccCcCCCCcCCC
Confidence            4455555555443


No 126
>PF12907 zf-met2:  Zinc-binding
Probab=62.34  E-value=4.6  Score=23.60  Aligned_cols=23  Identities=30%  Similarity=0.889  Sum_probs=10.1

Q ss_pred             ccccchhcc---cChhhHHHHHHhhc
Q psy4688          72 TCTMCKKTF---RNKATFQKHMQRAH   94 (388)
Q Consensus        72 ~C~~C~~~f---~~~~~l~~H~~~~h   94 (388)
                      .|.+|-.+|   .+...|..|....|
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~enKH   28 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAENKH   28 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHHccC
Confidence            455554333   22334555544444


No 127
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=61.84  E-value=3.6  Score=25.21  Aligned_cols=11  Identities=36%  Similarity=1.105  Sum_probs=6.3

Q ss_pred             ccccCCCcccc
Q psy4688         313 KFKCDLCDKEF  323 (388)
Q Consensus       313 ~~~C~~C~k~F  323 (388)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            35566666655


No 128
>PF14353 CpXC:  CpXC protein
Probab=61.52  E-value=7.7  Score=29.61  Aligned_cols=24  Identities=17%  Similarity=0.364  Sum_probs=15.7

Q ss_pred             CCccccccccccccccccchhhcc
Q psy4688         278 PNHICKICNKGYACAASLKIHNIK  301 (388)
Q Consensus       278 ~~~~C~~C~k~f~~~~~L~~H~~~  301 (388)
                      ..|.||.||..|.-...+..|...
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~   60 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPE   60 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCC
Confidence            356777777777766666666443


No 129
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=61.14  E-value=5  Score=24.65  Aligned_cols=15  Identities=33%  Similarity=0.525  Sum_probs=7.9

Q ss_pred             CcCCCCCcCCcCCCc
Q psy4688          40 KTKTCPICNKSYPGA   54 (388)
Q Consensus        40 ~~~~C~~C~~~f~~~   54 (388)
                      +++.|..||..|.-.
T Consensus         3 k~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFT   17 (49)
T ss_pred             eeEEcccCCCeEEEe
Confidence            345566666555443


No 130
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=59.91  E-value=5.1  Score=30.67  Aligned_cols=27  Identities=30%  Similarity=0.447  Sum_probs=17.3

Q ss_pred             CccccCCCcccccChhhHHhHHhhhcCCCc
Q psy4688         312 EKFKCDLCDKEFFEKKKLNKHKNWAHGDKF  341 (388)
Q Consensus       312 ~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~  341 (388)
                      ....|-+||+.|..   |++|++.|||-.|
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             CeeEEccCCcccch---HHHHHHHccCCCH
Confidence            35789999999976   5999999988654


No 131
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=59.80  E-value=11  Score=33.00  Aligned_cols=12  Identities=17%  Similarity=0.528  Sum_probs=7.4

Q ss_pred             CcccCCcchhhH
Q psy4688         340 KFHLCKVCGAKI  351 (388)
Q Consensus       340 ~~~~C~~C~~~f  351 (388)
                      ..|.|+.|...|
T Consensus       387 ~rY~Ce~CK~~F  398 (421)
T COG5151         387 GRYQCELCKSTF  398 (421)
T ss_pred             cceechhhhhhh
Confidence            346666666666


No 132
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=58.94  E-value=5.9  Score=24.96  Aligned_cols=9  Identities=44%  Similarity=0.970  Sum_probs=4.0

Q ss_pred             cccCCCccc
Q psy4688         314 FKCDLCDKE  322 (388)
Q Consensus       314 ~~C~~C~k~  322 (388)
                      ..|+.||..
T Consensus        23 V~Cp~CGae   31 (54)
T TIGR01206        23 VICDECGAE   31 (54)
T ss_pred             EeCCCCCCE
Confidence            344444443


No 133
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=58.82  E-value=3.8  Score=20.93  Aligned_cols=8  Identities=38%  Similarity=1.128  Sum_probs=4.8

Q ss_pred             Cccccccc
Q psy4688         367 KYCCHICG  374 (388)
Q Consensus       367 ~~~C~~C~  374 (388)
                      +|.||.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            46666665


No 134
>KOG2272|consensus
Probab=57.35  E-value=7  Score=33.02  Aligned_cols=18  Identities=28%  Similarity=0.588  Sum_probs=13.1

Q ss_pred             cccCCCCcccCCChhHHH
Q psy4688         217 KYGCDECGKMLKSRDSLN  234 (388)
Q Consensus       217 ~~~C~~C~~~f~~~~~l~  234 (388)
                      -|.|++|.+...+...++
T Consensus        99 CF~Cd~Cn~~Lad~gf~r  116 (332)
T KOG2272|consen   99 CFRCDLCNKHLADQGFYR  116 (332)
T ss_pred             cchhHHHHHHHhhhhhHh
Confidence            478888888777666554


No 135
>KOG2807|consensus
Probab=55.54  E-value=20  Score=31.73  Aligned_cols=33  Identities=27%  Similarity=0.413  Sum_probs=22.9

Q ss_pred             cccccccCCcCCChhHHHHHHhhcCCCCCccccccccccccccccch
Q psy4688         251 EYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGYACAASLKI  297 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~  297 (388)
                      .|.|+.|....-              .-|-.|++|+-+......|.+
T Consensus       276 Gy~CP~CkakvC--------------sLP~eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  276 GYFCPQCKAKVC--------------SLPIECPICSLTLVSSPHLAR  308 (378)
T ss_pred             ceeCCcccCeee--------------cCCccCCccceeEecchHHHH
Confidence            588888875432              237788888888777666654


No 136
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=54.48  E-value=15  Score=21.82  Aligned_cols=23  Identities=26%  Similarity=0.592  Sum_probs=16.5

Q ss_pred             CcccccccCCcCCChhHHHHHHh
Q psy4688         250 YEYECDYCGAKYPNKYTLSDHIS  272 (388)
Q Consensus       250 ~~~~C~~C~~~f~~~~~L~~H~~  272 (388)
                      ..|+|-.|..+...++.|-.||.
T Consensus        19 ~~ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   19 FKYKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ccceeecCCcccchHHHHHHHHH
Confidence            34677777777777777777775


No 137
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=54.25  E-value=7.7  Score=26.95  Aligned_cols=13  Identities=31%  Similarity=0.772  Sum_probs=8.4

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      -+.|..||..|.-
T Consensus        53 IW~C~kCg~~fAG   65 (89)
T COG1997          53 IWKCRKCGAKFAG   65 (89)
T ss_pred             eEEcCCCCCeecc
Confidence            4667777776654


No 138
>KOG2593|consensus
Probab=53.71  E-value=9.1  Score=35.29  Aligned_cols=19  Identities=21%  Similarity=0.630  Sum_probs=9.4

Q ss_pred             CCCCccccccccccccccc
Q psy4688         276 GIPNHICKICNKGYACAAS  294 (388)
Q Consensus       276 ~~~~~~C~~C~k~f~~~~~  294 (388)
                      ....|.|+.|++.|+.-..
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             ccccccCCccccchhhhHH
Confidence            3344555555555554333


No 139
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=52.59  E-value=3.1  Score=41.73  Aligned_cols=40  Identities=28%  Similarity=0.601  Sum_probs=24.6

Q ss_pred             cccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhHHhHHHHHHHHhcCCCCccccccchh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKIKGSLKQHMITHTGERKYCCHICGKK  376 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f~~~L~~H~~~H~~~~~~~C~~C~k~  376 (388)
                      ++|+.|+-.+      ..|+.    .....|.+||.             ....|..|+.||..
T Consensus       445 ~~Cp~Cd~~l------t~H~~----~~~L~CH~Cg~-------------~~~~p~~Cp~Cgs~  484 (730)
T COG1198         445 AECPNCDSPL------TLHKA----TGQLRCHYCGY-------------QEPIPQSCPECGSE  484 (730)
T ss_pred             ccCCCCCcce------EEecC----CCeeEeCCCCC-------------CCCCCCCCCCCCCC
Confidence            4677776543      23332    34456777764             34578899999865


No 140
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=52.20  E-value=9.3  Score=32.05  Aligned_cols=29  Identities=24%  Similarity=0.527  Sum_probs=20.5

Q ss_pred             CCccccccchhcccChhhHHHHHHhhccC
Q psy4688          68 NSTTTCTMCKKTFRNKATFQKHMQRAHVG   96 (388)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~   96 (388)
                      +..|.|++|+|.|.-..-..+|+...|..
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            34688888888888888888888877753


No 141
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=52.11  E-value=5.3  Score=22.60  Aligned_cols=31  Identities=23%  Similarity=0.562  Sum_probs=15.2

Q ss_pred             ccccccccccccccchhhccccccccCCCCCccccCCCccccc
Q psy4688         282 CKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDKEFF  324 (388)
Q Consensus       282 C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k~F~  324 (388)
                      |+.|.+.+....+.+.|            ..+..|..||-.++
T Consensus         2 C~~C~~Ey~~p~~RR~~------------~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFDPSNRRFH------------YQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCSTTSTTTT-------------TT--BTTCC-SCC
T ss_pred             CHHHHHHHcCCCCCccc------------CcCccCCCCCCCEE
Confidence            66666666555543333            13456888876654


No 142
>KOG2807|consensus
Probab=50.39  E-value=29  Score=30.81  Aligned_cols=13  Identities=8%  Similarity=0.340  Sum_probs=8.7

Q ss_pred             CcCCcCCCcHHHH
Q psy4688          46 ICNKSYPGARNMR   58 (388)
Q Consensus        46 ~C~~~f~~~~~l~   58 (388)
                      .|+..|+-...|.
T Consensus       138 ~~~g~fSLqNaLe  150 (378)
T KOG2807|consen  138 ECSGDFSLQNALE  150 (378)
T ss_pred             ccCCChHHHHHHH
Confidence            6777777666654


No 143
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=50.11  E-value=9.2  Score=24.03  Aligned_cols=9  Identities=44%  Similarity=1.364  Sum_probs=4.4

Q ss_pred             cccccCCcC
Q psy4688         253 ECDYCGAKY  261 (388)
Q Consensus       253 ~C~~C~~~f  261 (388)
                      .|+.||+.|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            345555444


No 144
>KOG4124|consensus
Probab=49.77  E-value=5  Score=35.62  Aligned_cols=51  Identities=10%  Similarity=-0.024  Sum_probs=31.2

Q ss_pred             CCcccccc--chhccCCchHHHHH-----HhhcCCCCCccCCccccccCChHHHHHHHh
Q psy4688         102 SKHFECNY--CHAKFSNKSLLSDH-----ISSHTGLKNYKCHVCDKAYSCRKALKTHTL  153 (388)
Q Consensus       102 ~~~~~C~~--C~~~f~~~~~L~~H-----~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  153 (388)
                      ++++.|..  |.+.+........|     +..-+..+||+|. |++++.+...|..|..
T Consensus       176 E~~~S~~vp~~~~~~~~~Ns~~~~S~~~~~T~~t~~~p~k~~-~~~~~~T~~~l~~HS~  233 (442)
T KOG4124|consen  176 EYRVSVVVPAAAAAAAAANSSDMSSDEASSTAETTGTPKKMP-ESLVMDTSSPLSDHSM  233 (442)
T ss_pred             cccccccCchhhhhhhccccccccccccccccccccCCccCc-ccccccccchhhhccc
Confidence            45666654  55555444333333     2223345788885 8888888888888854


No 145
>PRK04023 DNA polymerase II large subunit; Validated
Probab=49.48  E-value=17  Score=37.56  Aligned_cols=10  Identities=40%  Similarity=1.002  Sum_probs=6.2

Q ss_pred             cccCCCCccc
Q psy4688         217 KYGCDECGKM  226 (388)
Q Consensus       217 ~~~C~~C~~~  226 (388)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            3567777665


No 146
>KOG4124|consensus
Probab=49.24  E-value=6.6  Score=34.92  Aligned_cols=26  Identities=31%  Similarity=0.676  Sum_probs=18.8

Q ss_pred             CCccccc--cccccccccccchhhcccc
Q psy4688         278 PNHICKI--CNKGYACAASLKIHNIKTH  303 (388)
Q Consensus       278 ~~~~C~~--C~k~f~~~~~L~~H~~~~H  303 (388)
                      ++|+|++  |.+.+.....|+.|+...|
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h  375 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGH  375 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCc
Confidence            5677754  8888888778887766555


No 147
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=49.13  E-value=11  Score=24.04  Aligned_cols=29  Identities=21%  Similarity=0.318  Sum_probs=11.8

Q ss_pred             cccCCcchhhH-HhHHHHHHHHhcCCCCccccc
Q psy4688         341 FHLCKVCGAKI-KGSLKQHMITHTGERKYCCHI  372 (388)
Q Consensus       341 ~~~C~~C~~~f-~~~L~~H~~~H~~~~~~~C~~  372 (388)
                      |+....||-.| +.++...+   .+.+..+||+
T Consensus        24 PV~s~~C~H~fek~aI~~~i---~~~~~~~CPv   53 (57)
T PF11789_consen   24 PVKSKKCGHTFEKEAILQYI---QRNGSKRCPV   53 (57)
T ss_dssp             EEEESSS--EEEHHHHHHHC---TTTS-EE-SC
T ss_pred             CcCcCCCCCeecHHHHHHHH---HhcCCCCCCC
Confidence            44445555555 44444444   2334455655


No 148
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=48.59  E-value=13  Score=37.55  Aligned_cols=10  Identities=30%  Similarity=0.674  Sum_probs=5.5

Q ss_pred             ccccCCCccc
Q psy4688         313 KFKCDLCDKE  322 (388)
Q Consensus       313 ~~~C~~C~k~  322 (388)
                      |..|+.||-.
T Consensus       475 p~~Cp~Cgs~  484 (730)
T COG1198         475 PQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCC
Confidence            4556666543


No 149
>KOG4167|consensus
Probab=48.00  E-value=4.5  Score=39.68  Aligned_cols=26  Identities=35%  Similarity=0.563  Sum_probs=23.8

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcC
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHG  338 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~  338 (388)
                      -|.|..|+|.|.....+..||++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            49999999999999999999999853


No 150
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=47.64  E-value=6.2  Score=20.99  Aligned_cols=9  Identities=33%  Similarity=0.910  Sum_probs=4.4

Q ss_pred             ccccccccc
Q psy4688         281 ICKICNKGY  289 (388)
Q Consensus       281 ~C~~C~k~f  289 (388)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344455555


No 151
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=47.61  E-value=6.5  Score=30.12  Aligned_cols=26  Identities=42%  Similarity=0.814  Sum_probs=16.8

Q ss_pred             cccCCcchhhHHhHHHHHHHHhcCCCC
Q psy4688         341 FHLCKVCGAKIKGSLKQHMITHTGERK  367 (388)
Q Consensus       341 ~~~C~~C~~~f~~~L~~H~~~H~~~~~  367 (388)
                      .-.|-+||+.|+. |++|++.|.|-.|
T Consensus        72 ~i~clecGk~~k~-LkrHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKT-LKRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESB-HHHHHHHTT-S-H
T ss_pred             eeEEccCCcccch-HHHHHHHccCCCH
Confidence            3579999999975 5999999987654


No 152
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=45.23  E-value=12  Score=36.25  Aligned_cols=13  Identities=15%  Similarity=0.319  Sum_probs=7.1

Q ss_pred             CCCCCcccccccc
Q psy4688         275 TGIPNHICKICNK  287 (388)
Q Consensus       275 ~~~~~~~C~~C~k  287 (388)
                      .......|..||.
T Consensus       236 ~~~~~l~Ch~Cg~  248 (505)
T TIGR00595       236 KKEGKLRCHYCGY  248 (505)
T ss_pred             cCCCeEEcCCCcC
Confidence            3344556666664


No 153
>KOG1280|consensus
Probab=44.16  E-value=17  Score=32.50  Aligned_cols=37  Identities=22%  Similarity=0.592  Sum_probs=27.2

Q ss_pred             CccccCCCcccccChhhHHhHHhhhcCCCcc--cCCcch
Q psy4688         312 EKFKCDLCDKEFFEKKKLNKHKNWAHGDKFH--LCKVCG  348 (388)
Q Consensus       312 ~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~--~C~~C~  348 (388)
                      ..|.|++|++.=.+...|..|....|.+-++  .|++|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4578888888888888888888777766543  477775


No 154
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=43.89  E-value=2  Score=38.24  Aligned_cols=9  Identities=33%  Similarity=1.010  Sum_probs=2.6

Q ss_pred             cccCCCccc
Q psy4688         314 FKCDLCDKE  322 (388)
Q Consensus       314 ~~C~~C~k~  322 (388)
                      ..|+.||..
T Consensus       212 ~~Cp~Cg~~  220 (290)
T PF04216_consen  212 IKCPYCGNT  220 (290)
T ss_dssp             TS-TTT---
T ss_pred             CCCcCCCCC
Confidence            345555544


No 155
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=43.54  E-value=11  Score=28.46  Aligned_cols=17  Identities=41%  Similarity=0.442  Sum_probs=11.4

Q ss_pred             ccccccccccccccccchhh
Q psy4688         280 HICKICNKGYACAASLKIHN  299 (388)
Q Consensus       280 ~~C~~C~k~f~~~~~L~~H~  299 (388)
                      ..|-.+|+.|.   +|++|.
T Consensus        77 IicLEDGkkfK---SLKRHL   93 (148)
T COG4957          77 IICLEDGKKFK---SLKRHL   93 (148)
T ss_pred             EEEeccCcchH---HHHHHH
Confidence            45777777775   466773


No 156
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.43  E-value=14  Score=26.83  Aligned_cols=11  Identities=9%  Similarity=0.190  Sum_probs=6.4

Q ss_pred             ccccCCCcccc
Q psy4688         313 KFKCDLCDKEF  323 (388)
Q Consensus       313 ~~~C~~C~k~F  323 (388)
                      |..|++||++|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            45556666655


No 157
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=42.16  E-value=10  Score=21.59  Aligned_cols=30  Identities=13%  Similarity=0.257  Sum_probs=14.7

Q ss_pred             ccccchhccCCchHHHHHHhhcCCCCCccCCccccccC
Q psy4688         106 ECNYCHAKFSNKSLLSDHISSHTGLKNYKCHVCDKAYS  143 (388)
Q Consensus       106 ~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~  143 (388)
                      .|+.||+.|..        ..-....+-.|+.||..+.
T Consensus         3 ~C~~Cg~~Yh~--------~~~pP~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    3 ICPKCGRIYHI--------EFNPPKVEGVCDNCGGELV   32 (36)
T ss_dssp             EETTTTEEEET--------TTB--SSTTBCTTTTEBEB
T ss_pred             CcCCCCCcccc--------ccCCCCCCCccCCCCCeeE
Confidence            46666666632        2222334456666665443


No 158
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=42.07  E-value=25  Score=22.55  Aligned_cols=26  Identities=12%  Similarity=0.340  Sum_probs=13.2

Q ss_pred             chhhH-HhHHHHHHHHhcCCCCccccccchhh
Q psy4688         347 CGAKI-KGSLKQHMITHTGERKYCCHICGKKL  377 (388)
Q Consensus       347 C~~~f-~~~L~~H~~~H~~~~~~~C~~C~k~f  377 (388)
                      ||..| +..+..++..     ...|++|++.+
T Consensus        19 ~G~v~~~~~i~~~~~~-----~~~cP~~~~~~   45 (63)
T smart00504       19 SGQTYERRAIEKWLLS-----HGTDPVTGQPL   45 (63)
T ss_pred             CCCEEeHHHHHHHHHH-----CCCCCCCcCCC
Confidence            34444 4445555443     12566666665


No 159
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=41.95  E-value=14  Score=20.79  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=4.2

Q ss_pred             ccccccccccc
Q psy4688         281 ICKICNKGYAC  291 (388)
Q Consensus       281 ~C~~C~k~f~~  291 (388)
                      .|..|++.|..
T Consensus         5 ~C~eC~~~f~d   15 (34)
T PF01286_consen    5 KCDECGKPFMD   15 (34)
T ss_dssp             E-TTT--EES-
T ss_pred             hHhHhCCHHHH
Confidence            46666666654


No 160
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=41.86  E-value=17  Score=22.54  Aligned_cols=6  Identities=33%  Similarity=1.204  Sum_probs=2.3

Q ss_pred             ccCCCc
Q psy4688         315 KCDLCD  320 (388)
Q Consensus       315 ~C~~C~  320 (388)
                      .|..||
T Consensus        39 ~C~~Cg   44 (50)
T PRK00432         39 HCGKCG   44 (50)
T ss_pred             ECCCcC
Confidence            333333


No 161
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=40.88  E-value=16  Score=35.35  Aligned_cols=9  Identities=33%  Similarity=1.084  Sum_probs=5.1

Q ss_pred             ccccCCCcc
Q psy4688         313 KFKCDLCDK  321 (388)
Q Consensus       313 ~~~C~~C~k  321 (388)
                      ...|..||.
T Consensus       240 ~l~Ch~Cg~  248 (505)
T TIGR00595       240 KLRCHYCGY  248 (505)
T ss_pred             eEEcCCCcC
Confidence            355666664


No 162
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.88  E-value=13  Score=26.22  Aligned_cols=13  Identities=38%  Similarity=0.884  Sum_probs=8.9

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      -+.|..|++.|.-
T Consensus        53 IW~C~~C~~~~AG   65 (90)
T PF01780_consen   53 IWKCKKCGKKFAG   65 (90)
T ss_dssp             EEEETTTTEEEE-
T ss_pred             EeecCCCCCEEeC
Confidence            4778888877754


No 163
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=40.72  E-value=8.3  Score=38.08  Aligned_cols=37  Identities=19%  Similarity=0.567  Sum_probs=18.5

Q ss_pred             CCcccccccccCCchHHHHhHHhhhCCCCcc-cCCCCcccCCChhH
Q psy4688         188 VTVCPKCNRDYRNPRNMRKHLRRVHTSVRKY-GCDECGKMLKSRDS  232 (388)
Q Consensus       188 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~-~C~~C~~~f~~~~~  232 (388)
                      .-.|+.|-+...++.+-+-+        -|| .|..||-.|+--.+
T Consensus       101 ~a~C~~Cl~Ei~dp~~rrY~--------YPF~~CT~CGPRfTIi~a  138 (750)
T COG0068         101 AATCEDCLEEIFDPNSRRYL--------YPFINCTNCGPRFTIIEA  138 (750)
T ss_pred             hhhhHHHHHHhcCCCCccee--------ccccccCCCCcceeeecc
Confidence            34577776655444332221        122 36666666655433


No 164
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=40.38  E-value=13  Score=24.72  Aligned_cols=9  Identities=44%  Similarity=1.298  Sum_probs=2.7

Q ss_pred             ccCCCcccc
Q psy4688         315 KCDLCDKEF  323 (388)
Q Consensus       315 ~C~~C~k~F  323 (388)
                      .|.+|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            355555555


No 165
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=40.36  E-value=12  Score=31.98  Aligned_cols=25  Identities=28%  Similarity=0.331  Sum_probs=15.4

Q ss_pred             CCccCCccccccCChHHHHHHHhhh
Q psy4688         131 KNYKCHVCDKAYSCRKALKTHTLLH  155 (388)
Q Consensus       131 ~~~~C~~C~~~f~~~~~l~~H~~~h  155 (388)
                      +++.|+.|+........|..-.+.|
T Consensus       208 k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCcccccccceeeeecc
Confidence            6777777776665555555444444


No 166
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=40.05  E-value=20  Score=21.22  Aligned_cols=29  Identities=21%  Similarity=0.597  Sum_probs=13.0

Q ss_pred             CCcccCCcchhhH-HhHHHHHHHHhcCCCCcccccc
Q psy4688         339 DKFHLCKVCGAKI-KGSLKQHMITHTGERKYCCHIC  373 (388)
Q Consensus       339 ~~~~~C~~C~~~f-~~~L~~H~~~H~~~~~~~C~~C  373 (388)
                      +.....+ ||-.| .+=|...++.+     ..||+|
T Consensus        14 ~~~~~l~-C~H~fh~~Ci~~~~~~~-----~~CP~C   43 (44)
T PF13639_consen   14 EKVVKLP-CGHVFHRSCIKEWLKRN-----NSCPVC   43 (44)
T ss_dssp             SCEEEET-TSEEEEHHHHHHHHHHS-----SB-TTT
T ss_pred             CeEEEcc-CCCeeCHHHHHHHHHhC-----CcCCcc
Confidence            3334444 55555 33344444432     266666


No 167
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.57  E-value=12  Score=31.37  Aligned_cols=7  Identities=29%  Similarity=1.004  Sum_probs=4.9

Q ss_pred             cCCcchh
Q psy4688         343 LCKVCGA  349 (388)
Q Consensus       343 ~C~~C~~  349 (388)
                      .||.|+.
T Consensus        64 vCP~C~y   70 (267)
T COG1655          64 VCPICYY   70 (267)
T ss_pred             EcchhhH
Confidence            4777775


No 168
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=38.38  E-value=11  Score=37.31  Aligned_cols=56  Identities=21%  Similarity=0.616  Sum_probs=30.8

Q ss_pred             cccccCCcCCChhHHHHHHhhcCCCCCc-cccccccccccccccchhhccccccccCCCCCccccCCCcc
Q psy4688         253 ECDYCGAKYPNKYTLSDHISGHTGIPNH-ICKICNKGYACAASLKIHNIKTHLQFTGVPIEKFKCDLCDK  321 (388)
Q Consensus       253 ~C~~C~~~f~~~~~L~~H~~~H~~~~~~-~C~~C~k~f~~~~~L~~H~~~~H~~~~~~~~~~~~C~~C~k  321 (388)
                      .|..||-+|+--..|=.= |.++.-..| .|+.|.+.|....+.+-|            ..|..|+.||-
T Consensus       125 ~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfH------------AQp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFH------------AQPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccccc------------cccccCcccCC
Confidence            577777777654333211 222333333 377777777666655544            24566777765


No 169
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=38.26  E-value=9.1  Score=24.23  Aligned_cols=37  Identities=27%  Similarity=0.464  Sum_probs=16.8

Q ss_pred             CCCCCcCCcCCCc--HHHHHHHHhhccCCCccccccchhcc
Q psy4688          42 KTCPICNKSYPGA--RNMRKHLRLVHDKNSTTTCTMCKKTF   80 (388)
Q Consensus        42 ~~C~~C~~~f~~~--~~l~~H~~~~h~~~~~~~C~~C~~~f   80 (388)
                      .+|-+|++.+.-.  ..+.+=++  -.....|.|+.|...-
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLr--nrPi~tYmC~eC~~RI   41 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLR--NRPIHTYMCDECKERI   41 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhh--cCCCcceeChhHHHHH
Confidence            3566666655322  11112122  2334456677765543


No 170
>KOG4167|consensus
Probab=38.22  E-value=12  Score=37.03  Aligned_cols=25  Identities=24%  Similarity=0.429  Sum_probs=18.5

Q ss_pred             CccccccchhcccChhhHHHHHHhh
Q psy4688          69 STTTCTMCKKTFRNKATFQKHMQRA   93 (388)
Q Consensus        69 ~~~~C~~C~~~f~~~~~l~~H~~~~   93 (388)
                      ..|.|.+|++.|....++..||++|
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHH
Confidence            4577888888887777777777654


No 171
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=38.00  E-value=28  Score=30.54  Aligned_cols=99  Identities=19%  Similarity=0.451  Sum_probs=53.0

Q ss_pred             CCcCCCCCcCCcCCCcHHHHHHHHhhccCCCccccccchhcccChhhHHHHHHhhcc-CCCc-------CCCCccccccc
Q psy4688          39 NKTKTCPICNKSYPGARNMRKHLRLVHDKNSTTTCTMCKKTFRNKATFQKHMQRAHV-GLKI-------SVSKHFECNYC  110 (388)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~-~~~~-------~~~~~~~C~~C  110 (388)
                      ...|.||.|...-             .  ..|..|+.|.-..-....|.+-.  +|. .++.       ...+.--|-.|
T Consensus       306 ~gGy~CP~CktkV-------------C--sLPi~CP~Csl~LilsthLarSy--hhL~PLk~f~E~p~~~~~ks~~Cf~C  368 (421)
T COG5151         306 GGGYECPVCKTKV-------------C--SLPISCPICSLQLILSTHLARSY--HHLYPLKPFVEKPEGTNPKSTHCFVC  368 (421)
T ss_pred             cCceeCCccccee-------------e--cCCccCcchhHHHHHHHHHHHHH--HhhccCcccccccCCCCCCCccceec
Confidence            4568888884321             1  23677888877665555554432  221 1110       11122337777


Q ss_pred             hhccCCchHHHHHHhhcCCCCCccCCccccccCChHHHHHHHhhhc
Q psy4688         111 HAKFSNKSLLSDHISSHTGLKNYKCHVCDKAYSCRKALKTHTLLHE  156 (388)
Q Consensus       111 ~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  156 (388)
                      .-.|.....-..-  .-+....|.|+.|...|-.--+.-.|...|.
T Consensus       369 Q~~fp~~~~~~~~--~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         369 QGPFPKPPVSPFD--ESTSSGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             cCCCCCCCCCccc--ccccccceechhhhhhhhhhhHHHHHHHHhh
Confidence            7666543211100  0122346888888888887777777776664


No 172
>PRK14873 primosome assembly protein PriA; Provisional
Probab=37.84  E-value=17  Score=36.45  Aligned_cols=9  Identities=22%  Similarity=0.593  Sum_probs=5.5

Q ss_pred             ccccccccc
Q psy4688         281 ICKICNKGY  289 (388)
Q Consensus       281 ~C~~C~k~f  289 (388)
                      .|..||..+
T Consensus       385 ~C~~Cg~~~  393 (665)
T PRK14873        385 ACARCRTPA  393 (665)
T ss_pred             EhhhCcCee
Confidence            577776544


No 173
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=37.83  E-value=9.4  Score=23.29  Aligned_cols=14  Identities=29%  Similarity=0.850  Sum_probs=9.4

Q ss_pred             CccccCCCcccccC
Q psy4688         312 EKFKCDLCDKEFFE  325 (388)
Q Consensus       312 ~~~~C~~C~k~F~~  325 (388)
                      ..|.|++|.-+|+-
T Consensus         6 sry~CDLCn~~~p~   19 (57)
T PF14445_consen    6 SRYSCDLCNSSHPI   19 (57)
T ss_pred             hhHhHHhhcccCcH
Confidence            35777777777654


No 174
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=37.71  E-value=21  Score=33.74  Aligned_cols=28  Identities=25%  Similarity=0.528  Sum_probs=22.7

Q ss_pred             CccccccchhcccChhhHHHHHHhhccC
Q psy4688          69 STTTCTMCKKTFRNKATFQKHMQRAHVG   96 (388)
Q Consensus        69 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~   96 (388)
                      .-+.|+.|.+.|.+...+..|+...|.+
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3467888888888888888888877765


No 175
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=36.95  E-value=17  Score=21.63  Aligned_cols=13  Identities=23%  Similarity=0.905  Sum_probs=9.3

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      .+.|+.||..+.+
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            4678888877654


No 176
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=36.76  E-value=16  Score=27.39  Aligned_cols=14  Identities=21%  Similarity=0.634  Sum_probs=8.7

Q ss_pred             ccccCCCcccccCh
Q psy4688         313 KFKCDLCDKEFFEK  326 (388)
Q Consensus       313 ~~~C~~C~k~F~~~  326 (388)
                      .+.|..|+..|...
T Consensus        70 ~~~C~~Cg~~~~~~   83 (115)
T TIGR00100        70 ECECEDCSEEVSPE   83 (115)
T ss_pred             EEEcccCCCEEecC
Confidence            36677777666543


No 177
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=36.74  E-value=33  Score=26.11  Aligned_cols=58  Identities=22%  Similarity=0.523  Sum_probs=32.9

Q ss_pred             CCCCcccCCCCcccCCChhHHHHHHHHhccCCcccccCcccc---cccCCcCCChhHHHHHHhhcCCCCCcccccccccc
Q psy4688         213 TSVRKYGCDECGKMLKSRDSLNTHKKIQHEGKKVKVKYEYEC---DYCGAKYPNKYTLSDHISGHTGIPNHICKICNKGY  289 (388)
Q Consensus       213 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~C---~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f  289 (388)
                      .+.+-|+|++|..+.....-|+                |-+|   .+|+.-+   ..|.+|-..|.     +||+|..+|
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLK----------------PneCCgY~iCn~Cy---a~LWK~~~~yp-----vCPvCkTSF  131 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLK----------------PNECCGYSICNACY---ANLWKFCNLYP-----VCPVCKTSF  131 (140)
T ss_pred             cCCCceeccCcccccchhhcCC----------------cccccchHHHHHHH---HHHHHHcccCC-----CCCcccccc
Confidence            3456788888877655433221                2233   1233322   45666665543     588888888


Q ss_pred             ccccc
Q psy4688         290 ACAAS  294 (388)
Q Consensus       290 ~~~~~  294 (388)
                      ++.+.
T Consensus       132 Kss~~  136 (140)
T PF05290_consen  132 KSSSS  136 (140)
T ss_pred             ccccc
Confidence            76553


No 178
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=36.33  E-value=38  Score=36.20  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=3.5

Q ss_pred             cccccccc
Q psy4688         280 HICKICNK  287 (388)
Q Consensus       280 ~~C~~C~k  287 (388)
                      |.|+.||.
T Consensus       693 y~CPsCGa  700 (1337)
T PRK14714        693 YVCPDCGA  700 (1337)
T ss_pred             eeCccCCC
Confidence            34444443


No 179
>KOG1280|consensus
Probab=36.24  E-value=31  Score=30.91  Aligned_cols=27  Identities=22%  Similarity=0.356  Sum_probs=18.6

Q ss_pred             ccccccchhcccChhhHHHHHHhhccC
Q psy4688          70 TTTCTMCKKTFRNKATFQKHMQRAHVG   96 (388)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~h~~   96 (388)
                      .|.|++|+..=.+...|..|+...|..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpd  105 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPE  105 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcc
Confidence            467777777766777777777666654


No 180
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=36.05  E-value=18  Score=25.59  Aligned_cols=13  Identities=23%  Similarity=0.692  Sum_probs=8.5

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      .+.|..|++.|.-
T Consensus        53 IW~C~~C~~~~AG   65 (91)
T TIGR00280        53 IWTCRKCGAKFAG   65 (91)
T ss_pred             EEEcCCCCCEEeC
Confidence            4677777776653


No 181
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=35.89  E-value=19  Score=25.84  Aligned_cols=10  Identities=30%  Similarity=1.079  Sum_probs=4.9

Q ss_pred             cccccccCCc
Q psy4688         251 EYECDYCGAK  260 (388)
Q Consensus       251 ~~~C~~C~~~  260 (388)
                      .|.|+.||..
T Consensus        22 ~FtCp~Cghe   31 (104)
T COG4888          22 TFTCPRCGHE   31 (104)
T ss_pred             eEecCccCCe
Confidence            3555555543


No 182
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=35.84  E-value=46  Score=18.99  Aligned_cols=27  Identities=19%  Similarity=0.589  Sum_probs=13.2

Q ss_pred             cchhhH-HhHHHHHHHHhcCCCCccccccchh
Q psy4688         346 VCGAKI-KGSLKQHMITHTGERKYCCHICGKK  376 (388)
Q Consensus       346 ~C~~~f-~~~L~~H~~~H~~~~~~~C~~C~k~  376 (388)
                      .||-.| ..-|...+..    ....|++|...
T Consensus        17 ~C~H~~c~~C~~~~~~~----~~~~Cp~C~~~   44 (45)
T cd00162          17 PCGHVFCRSCIDKWLKS----GKNTCPLCRTP   44 (45)
T ss_pred             CCCChhcHHHHHHHHHh----CcCCCCCCCCc
Confidence            355555 3334443332    23468877653


No 183
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.47  E-value=24  Score=33.44  Aligned_cols=27  Identities=26%  Similarity=0.564  Sum_probs=24.1

Q ss_pred             CCCCCcCCcCCCcHHHHHHHHhhccCC
Q psy4688          42 KTCPICNKSYPGARNMRKHLRLVHDKN   68 (388)
Q Consensus        42 ~~C~~C~~~f~~~~~l~~H~~~~h~~~   68 (388)
                      +.|+.|.+.|.+...+..|+...|.+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            679999999999999999998888654


No 184
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=34.90  E-value=15  Score=28.38  Aligned_cols=11  Identities=18%  Similarity=0.742  Sum_probs=5.4

Q ss_pred             ccccccccccc
Q psy4688         280 HICKICNKGYA  290 (388)
Q Consensus       280 ~~C~~C~k~f~  290 (388)
                      +.|..||..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            44555554443


No 185
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=34.60  E-value=69  Score=19.22  Aligned_cols=10  Identities=30%  Similarity=1.162  Sum_probs=6.6

Q ss_pred             CccccCCCcc
Q psy4688         312 EKFKCDLCDK  321 (388)
Q Consensus       312 ~~~~C~~C~k  321 (388)
                      ..|+|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            4577777764


No 186
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=34.59  E-value=14  Score=21.92  Aligned_cols=10  Identities=20%  Similarity=0.544  Sum_probs=4.5

Q ss_pred             ccccccchhc
Q psy4688          70 TTTCTMCKKT   79 (388)
Q Consensus        70 ~~~C~~C~~~   79 (388)
                      .+.|+.||..
T Consensus        19 ~~vC~~CG~V   28 (43)
T PF08271_consen   19 ELVCPNCGLV   28 (43)
T ss_dssp             EEEETTT-BB
T ss_pred             eEECCCCCCE
Confidence            4455555544


No 187
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=34.52  E-value=25  Score=33.87  Aligned_cols=12  Identities=25%  Similarity=0.653  Sum_probs=6.7

Q ss_pred             Cccccccccccc
Q psy4688         279 NHICKICNKGYA  290 (388)
Q Consensus       279 ~~~C~~C~k~f~  290 (388)
                      .|+|..||..|.
T Consensus       425 ~~~c~~c~~~yd  436 (479)
T PRK05452        425 RMQCSVCQWIYD  436 (479)
T ss_pred             eEEECCCCeEEC
Confidence            455666655554


No 188
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=34.47  E-value=16  Score=33.86  Aligned_cols=27  Identities=26%  Similarity=0.640  Sum_probs=15.9

Q ss_pred             ccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhHH
Q psy4688         315 KCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKIK  352 (388)
Q Consensus       315 ~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f~  352 (388)
                      .|+.||.+..++           |..-|.|+.||.++.
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~  378 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRAR  378 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCC
Confidence            577777654442           333567777776653


No 189
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=34.42  E-value=19  Score=20.93  Aligned_cols=14  Identities=36%  Similarity=0.823  Sum_probs=11.6

Q ss_pred             ccccCCCcccccCh
Q psy4688         313 KFKCDLCDKEFFEK  326 (388)
Q Consensus       313 ~~~C~~C~k~F~~~  326 (388)
                      ||+|+.|++.|=..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78999999988664


No 190
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=34.25  E-value=19  Score=26.87  Aligned_cols=13  Identities=15%  Similarity=0.082  Sum_probs=7.6

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      .+.|..||..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (113)
T PRK12380         70 QAWCWDCSQVVEI   82 (113)
T ss_pred             EEEcccCCCEEec
Confidence            3566666655544


No 191
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=34.15  E-value=29  Score=20.41  Aligned_cols=12  Identities=17%  Similarity=0.462  Sum_probs=7.1

Q ss_pred             cccCCCcccccC
Q psy4688         314 FKCDLCDKEFFE  325 (388)
Q Consensus       314 ~~C~~C~k~F~~  325 (388)
                      -+|+.||..|..
T Consensus        14 ~~C~~CgM~Y~~   25 (41)
T PF13878_consen   14 TTCPTCGMLYSP   25 (41)
T ss_pred             cCCCCCCCEECC
Confidence            456666666543


No 192
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=34.08  E-value=33  Score=29.40  Aligned_cols=12  Identities=25%  Similarity=0.672  Sum_probs=7.2

Q ss_pred             CCCcccCCCCcc
Q psy4688         214 SVRKYGCDECGK  225 (388)
Q Consensus       214 ~~~~~~C~~C~~  225 (388)
                      |.+.|+|..|..
T Consensus       139 GGrif~CsfC~~  150 (314)
T PF06524_consen  139 GGRIFKCSFCDN  150 (314)
T ss_pred             CCeEEEeecCCC
Confidence            445666666654


No 193
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=33.91  E-value=21  Score=25.16  Aligned_cols=13  Identities=23%  Similarity=0.613  Sum_probs=8.2

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      .+.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PTZ00255         54 IWRCKGCKKTVAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4667777766653


No 194
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=33.47  E-value=84  Score=28.32  Aligned_cols=22  Identities=23%  Similarity=0.543  Sum_probs=17.1

Q ss_pred             ccccccchhccCCchHHHHHHh
Q psy4688         104 HFECNYCHAKFSNKSLLSDHIS  125 (388)
Q Consensus       104 ~~~C~~C~~~f~~~~~L~~H~~  125 (388)
                      .+-|..|++-|....-+..|..
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHh
Confidence            4668888888888888877764


No 195
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=33.05  E-value=23  Score=22.26  Aligned_cols=9  Identities=44%  Similarity=0.859  Sum_probs=4.2

Q ss_pred             cCCCccccc
Q psy4688         316 CDLCDKEFF  324 (388)
Q Consensus       316 C~~C~k~F~  324 (388)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444444444


No 196
>KOG3408|consensus
Probab=32.88  E-value=26  Score=26.09  Aligned_cols=27  Identities=33%  Similarity=0.491  Sum_probs=19.8

Q ss_pred             CCCCccCCccccccCChHHHHHHHhhh
Q psy4688         129 GLKNYKCHVCDKAYSCRKALKTHTLLH  155 (388)
Q Consensus       129 ~~~~~~C~~C~~~f~~~~~l~~H~~~h  155 (388)
                      |...|.|-.|.+-|.+...|..|.++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhcc
Confidence            344577888888888888888887654


No 197
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=32.10  E-value=18  Score=19.42  Aligned_cols=9  Identities=33%  Similarity=0.800  Sum_probs=2.8

Q ss_pred             cccCCcchh
Q psy4688         341 FHLCKVCGA  349 (388)
Q Consensus       341 ~~~C~~C~~  349 (388)
                      .|.|..|+.
T Consensus        15 ~Y~C~~Cdf   23 (30)
T PF07649_consen   15 FYRCSECDF   23 (30)
T ss_dssp             EEE-TTT--
T ss_pred             eEECccCCC
Confidence            344555443


No 198
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=31.28  E-value=17  Score=24.14  Aligned_cols=27  Identities=19%  Similarity=0.571  Sum_probs=14.2

Q ss_pred             ccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhH
Q psy4688         315 KCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKI  351 (388)
Q Consensus       315 ~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f  351 (388)
                      .|+.||..-..          --..+.|.|+.||..+
T Consensus        30 ~C~~CG~~~~~----------~~~~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   30 TCPRCGHRNKK----------RRSGRVFTCPNCGFEM   56 (69)
T ss_pred             CccCccccccc----------ccccceEEcCCCCCEE
Confidence            46677654433          1123456666666544


No 200
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=31.26  E-value=45  Score=26.15  Aligned_cols=19  Identities=21%  Similarity=0.627  Sum_probs=13.3

Q ss_pred             ccccCCCcccccChhhHHh
Q psy4688         313 KFKCDLCDKEFFEKKKLNK  331 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~  331 (388)
                      -+.|+.||+.|..-+..++
T Consensus       124 f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             EEECCCCCCEecccccHHH
Confidence            4678888888876655443


No 201
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=30.63  E-value=23  Score=19.75  Aligned_cols=10  Identities=30%  Similarity=0.849  Sum_probs=5.1

Q ss_pred             ccccccchhh
Q psy4688         368 YCCHICGKKL  377 (388)
Q Consensus       368 ~~C~~C~k~f  377 (388)
                      +.|+.|++.+
T Consensus         5 ~~C~nC~R~v   14 (33)
T PF08209_consen    5 VECPNCGRPV   14 (33)
T ss_dssp             EE-TTTSSEE
T ss_pred             EECCCCcCCc
Confidence            4566666554


No 202
>KOG3214|consensus
Probab=30.63  E-value=17  Score=25.87  Aligned_cols=41  Identities=17%  Similarity=0.529  Sum_probs=19.2

Q ss_pred             CCcCCCCCcCCcCCCcHHHHHHHHhhccCCCccccccchhcccChh
Q psy4688          39 NKTKTCPICNKSYPGARNMRKHLRLVHDKNSTTTCTMCKKTFRNKA   84 (388)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~   84 (388)
                      ...|.|+.|+-.-.-.-.|.+     -...+...|.+|+.+|.+..
T Consensus        21 dt~FnClfcnHek~v~~~~Dk-----~~~iG~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   21 DTQFNCLFCNHEKSVSCTLDK-----KHNIGKASCRICEESFQTTI   61 (109)
T ss_pred             heeeccCccccccceeeeehh-----hcCcceeeeeehhhhhccch
Confidence            445777777643322222211     01123456666666665543


No 203
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=30.24  E-value=25  Score=24.79  Aligned_cols=13  Identities=23%  Similarity=0.720  Sum_probs=8.4

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      .+.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PRK03976         54 IWECRKCGAKFAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4667777776653


No 204
>KOG3408|consensus
Probab=30.08  E-value=41  Score=25.07  Aligned_cols=29  Identities=21%  Similarity=0.436  Sum_probs=23.5

Q ss_pred             CcCCCCccccccchhccCCchHHHHHHhh
Q psy4688          98 KISVSKHFECNYCHAKFSNKSLLSDHISS  126 (388)
Q Consensus        98 ~~~~~~~~~C~~C~~~f~~~~~L~~H~~~  126 (388)
                      ...+...|.|-.|.+-|.+...|..|.++
T Consensus        51 dlPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   51 DLPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            34455678999999999999999999764


No 205
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=29.88  E-value=46  Score=21.00  Aligned_cols=31  Identities=23%  Similarity=0.558  Sum_probs=13.9

Q ss_pred             CCCCcCCcCCCcHHHHHHHHhhccCCCccccccchh
Q psy4688          43 TCPICNKSYPGARNMRKHLRLVHDKNSTTTCTMCKK   78 (388)
Q Consensus        43 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~   78 (388)
                      .|.-|+...+......  ++   ..+....|+.|++
T Consensus        24 ~C~gC~~~l~~~~~~~--i~---~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNE--IR---KGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHH--HH---cCCCeEECcCCCc
Confidence            4555655554332221  11   1234556666654


No 206
>KOG0717|consensus
Probab=29.28  E-value=27  Score=32.73  Aligned_cols=22  Identities=36%  Similarity=0.765  Sum_probs=19.4

Q ss_pred             cccCCCcccccChhhHHhHHhh
Q psy4688         314 FKCDLCDKEFFEKKKLNKHKNW  335 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~~H~~~  335 (388)
                      +-|.+|+|+|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999999999765


No 207
>KOG1842|consensus
Probab=29.19  E-value=28  Score=32.28  Aligned_cols=29  Identities=28%  Similarity=0.559  Sum_probs=25.7

Q ss_pred             CcCCCCCcCCcCCCcHHHHHHHHhhccCC
Q psy4688          40 KTKTCPICNKSYPGARNMRKHLRLVHDKN   68 (388)
Q Consensus        40 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~   68 (388)
                      ..|.||+|...|.+...|..|+...|..+
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            35899999999999999999998888654


No 208
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=29.18  E-value=20  Score=21.25  Aligned_cols=15  Identities=47%  Similarity=0.855  Sum_probs=9.3

Q ss_pred             CccccCCCcccccCh
Q psy4688         312 EKFKCDLCDKEFFEK  326 (388)
Q Consensus       312 ~~~~C~~C~k~F~~~  326 (388)
                      -+|.|+.|++.|=.+
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            378899999988654


No 209
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=29.06  E-value=24  Score=26.52  Aligned_cols=13  Identities=23%  Similarity=0.674  Sum_probs=7.8

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      .+.|..||..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3566666665544


No 210
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=28.79  E-value=37  Score=28.86  Aligned_cols=15  Identities=13%  Similarity=0.603  Sum_probs=9.1

Q ss_pred             CcccCCCCcccCCCh
Q psy4688         216 RKYGCDECGKMLKSR  230 (388)
Q Consensus       216 ~~~~C~~C~~~f~~~  230 (388)
                      ..|.|+.|+..|...
T Consensus       154 aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  154 AEFHCPKCRHNFRGF  168 (278)
T ss_pred             eeeecccccccchhh
Confidence            346666666666644


No 211
>KOG0717|consensus
Probab=28.38  E-value=28  Score=32.63  Aligned_cols=25  Identities=24%  Similarity=0.628  Sum_probs=21.7

Q ss_pred             CCcCCCCCcCCcCCCcHHHHHHHHh
Q psy4688          39 NKTKTCPICNKSYPGARNMRKHLRL   63 (388)
Q Consensus        39 ~~~~~C~~C~~~f~~~~~l~~H~~~   63 (388)
                      +..+.|.+|+++|.+...|..|...
T Consensus       290 ge~lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  290 GEVLYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             CCceEEeeccccccchHHHHhhHHH
Confidence            4448999999999999999999764


No 212
>PRK05580 primosome assembly protein PriA; Validated
Probab=28.31  E-value=33  Score=34.76  Aligned_cols=9  Identities=33%  Similarity=0.881  Sum_probs=5.2

Q ss_pred             cccCCcchh
Q psy4688         341 FHLCKVCGA  349 (388)
Q Consensus       341 ~~~C~~C~~  349 (388)
                      |..|+.||.
T Consensus       421 ~~~Cp~Cg~  429 (679)
T PRK05580        421 PKACPECGS  429 (679)
T ss_pred             CCCCCCCcC
Confidence            445666654


No 213
>KOG0978|consensus
Probab=28.24  E-value=29  Score=34.58  Aligned_cols=11  Identities=18%  Similarity=0.480  Sum_probs=9.3

Q ss_pred             ccccccchhhH
Q psy4688         368 YCCHICGKKLR  378 (388)
Q Consensus       368 ~~C~~C~k~f~  378 (388)
                      =+||.|+.+|.
T Consensus       679 RKCP~Cn~aFg  689 (698)
T KOG0978|consen  679 RKCPKCNAAFG  689 (698)
T ss_pred             CCCCCCCCCCC
Confidence            37999999994


No 214
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=27.96  E-value=40  Score=21.18  Aligned_cols=13  Identities=31%  Similarity=0.813  Sum_probs=6.9

Q ss_pred             cccCCCcccccCh
Q psy4688         314 FKCDLCDKEFFEK  326 (388)
Q Consensus       314 ~~C~~C~k~F~~~  326 (388)
                      ++|+.||-.|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            4555555555443


No 215
>PRK12496 hypothetical protein; Provisional
Probab=27.65  E-value=30  Score=27.76  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=6.9

Q ss_pred             cccCCCcccc
Q psy4688         314 FKCDLCDKEF  323 (388)
Q Consensus       314 ~~C~~C~k~F  323 (388)
                      |.|+-|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            6677777665


No 216
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=27.53  E-value=64  Score=25.41  Aligned_cols=10  Identities=30%  Similarity=0.730  Sum_probs=2.3

Q ss_pred             CcccCCcchh
Q psy4688         340 KFHLCKVCGA  349 (388)
Q Consensus       340 ~~~~C~~C~~  349 (388)
                      ....|-.||.
T Consensus        59 t~leCy~Cg~   68 (152)
T PF09416_consen   59 TVLECYNCGS   68 (152)
T ss_dssp             -B---TTT--
T ss_pred             cEEEEEecCC
Confidence            3455666653


No 217
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=27.49  E-value=35  Score=20.13  Aligned_cols=17  Identities=29%  Similarity=0.581  Sum_probs=12.6

Q ss_pred             cccCCCcccccChhhHH
Q psy4688         314 FKCDLCDKEFFEKKKLN  330 (388)
Q Consensus       314 ~~C~~C~k~F~~~~~L~  330 (388)
                      -.|++||+.|+......
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            46889999888766554


No 218
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=27.48  E-value=27  Score=27.28  Aligned_cols=32  Identities=25%  Similarity=0.544  Sum_probs=15.3

Q ss_pred             cccccccCCcCCChhHHHHHHhhcCCCCCcccccccc
Q psy4688         251 EYECDYCGAKYPNKYTLSDHISGHTGIPNHICKICNK  287 (388)
Q Consensus       251 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k  287 (388)
                      +|.|. |+..|.+.   .+|-..-.|+ .|.|..|+-
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-eEEeccCCc
Confidence            56666 66555433   2333333333 455555553


No 219
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=27.42  E-value=29  Score=24.94  Aligned_cols=14  Identities=21%  Similarity=0.729  Sum_probs=9.5

Q ss_pred             cccccccCCcCCCh
Q psy4688         251 EYECDYCGAKYPNK  264 (388)
Q Consensus       251 ~~~C~~C~~~f~~~  264 (388)
                      |++|.-||..|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45677777777664


No 220
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=27.20  E-value=21  Score=30.50  Aligned_cols=19  Identities=26%  Similarity=0.634  Sum_probs=0.0

Q ss_pred             ccCCcchhhH-HhHHHHHHH
Q psy4688         342 HLCKVCGAKI-KGSLKQHMI  360 (388)
Q Consensus       342 ~~C~~C~~~f-~~~L~~H~~  360 (388)
                      ..|++||... -+.|..||+
T Consensus       169 ~~cPitGe~IP~~e~~eHmR  188 (229)
T PF12230_consen  169 IICPITGEMIPADEMDEHMR  188 (229)
T ss_dssp             --------------------
T ss_pred             cccccccccccccccccccc
Confidence            4455555544 233445544


No 221
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=27.16  E-value=47  Score=26.92  Aligned_cols=15  Identities=20%  Similarity=0.487  Sum_probs=7.3

Q ss_pred             CCCCccccccccccc
Q psy4688         276 GIPNHICKICNKGYA  290 (388)
Q Consensus       276 ~~~~~~C~~C~k~f~  290 (388)
                      +..-|.|+.|.-.|+
T Consensus       110 ~~~~y~C~~~~~r~s  124 (176)
T COG1675         110 ENNYYVCPNCHVKYS  124 (176)
T ss_pred             cCCceeCCCCCCccc
Confidence            334455555554443


No 223
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=26.49  E-value=39  Score=26.91  Aligned_cols=35  Identities=17%  Similarity=0.382  Sum_probs=22.0

Q ss_pred             ccccCCCcccccChhhHHhHHhhhcCCCcccCCcchhhHHhHHHH
Q psy4688         313 KFKCDLCDKEFFEKKKLNKHKNWAHGDKFHLCKVCGAKIKGSLKQ  357 (388)
Q Consensus       313 ~~~C~~C~k~F~~~~~L~~H~~~hh~~~~~~C~~C~~~f~~~L~~  357 (388)
                      ...|+.|+.+|.....          .+.|-|..|=+.|.+.|..
T Consensus        74 ~l~C~~C~~Tfk~f~~----------~g~fGCaeCY~tf~~~i~p  108 (176)
T COG3880          74 LLGCHNCGMTFKEFIQ----------SGLFGCAECYKTFESQISP  108 (176)
T ss_pred             HhcCccccccHHHHHH----------hcccchHHHHHHHHHHhhH
Confidence            3568888887755321          2457788888877655443


No 224
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=26.13  E-value=37  Score=19.79  Aligned_cols=18  Identities=22%  Similarity=0.434  Sum_probs=9.6

Q ss_pred             cccCCCCcccCCChhHHH
Q psy4688         217 KYGCDECGKMLKSRDSLN  234 (388)
Q Consensus       217 ~~~C~~C~~~f~~~~~l~  234 (388)
                      -+.|+.|+-.+-....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            345666665555554443


No 225
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=26.08  E-value=29  Score=20.07  Aligned_cols=11  Identities=18%  Similarity=0.655  Sum_probs=8.2

Q ss_pred             ccccCCCcccc
Q psy4688         313 KFKCDLCDKEF  323 (388)
Q Consensus       313 ~~~C~~C~k~F  323 (388)
                      -|.|..|+..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            37888888765


No 226
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=25.79  E-value=27  Score=21.88  Aligned_cols=13  Identities=31%  Similarity=0.736  Sum_probs=6.7

Q ss_pred             ccCCCcccccChh
Q psy4688         315 KCDLCDKEFFEKK  327 (388)
Q Consensus       315 ~C~~C~k~F~~~~  327 (388)
                      .||+|++.|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            7999999887643


No 227
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=25.76  E-value=23  Score=22.40  Aligned_cols=10  Identities=60%  Similarity=1.438  Sum_probs=2.8

Q ss_pred             Cccccccchh
Q psy4688         367 KYCCHICGKK  376 (388)
Q Consensus       367 ~~~C~~C~k~  376 (388)
                      .|.|++||.+
T Consensus        33 ~y~Cp~CgAt   42 (55)
T PF05741_consen   33 KYVCPICGAT   42 (55)
T ss_dssp             G---TTT---
T ss_pred             cCcCCCCcCc
Confidence            4677777765


No 228
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=25.47  E-value=20  Score=24.08  Aligned_cols=13  Identities=23%  Similarity=0.411  Sum_probs=4.7

Q ss_pred             ccccCCCcccccC
Q psy4688         313 KFKCDLCDKEFFE  325 (388)
Q Consensus       313 ~~~C~~C~k~F~~  325 (388)
                      ...|..|+..++-
T Consensus        41 ~v~Cg~C~~~~~~   53 (71)
T PF05495_consen   41 RVICGKCRTEQPI   53 (71)
T ss_dssp             EEEETTT--EEES
T ss_pred             CeECCCCCCccCh
Confidence            3444444444433


No 229
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.29  E-value=41  Score=21.60  Aligned_cols=12  Identities=25%  Similarity=0.670  Sum_probs=5.7

Q ss_pred             CCCccccccccc
Q psy4688         277 IPNHICKICNKG  288 (388)
Q Consensus       277 ~~~~~C~~C~k~  288 (388)
                      .+.|.|+.|.-.
T Consensus        29 IrtymC~eC~~R   40 (68)
T COG4896          29 IRTYMCPECEHR   40 (68)
T ss_pred             ceeEechhhHhh
Confidence            344555555433


No 230
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=25.07  E-value=22  Score=35.52  Aligned_cols=12  Identities=25%  Similarity=0.611  Sum_probs=7.7

Q ss_pred             ccccchhccCCc
Q psy4688         106 ECNYCHAKFSNK  117 (388)
Q Consensus       106 ~C~~C~~~f~~~  117 (388)
                      .|..|++.|...
T Consensus       462 tC~~C~kkFfSl  473 (1374)
T PTZ00303        462 SCPSCGRAFISL  473 (1374)
T ss_pred             cccCcCCccccc
Confidence            477777777543


No 231
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=24.76  E-value=33  Score=20.23  Aligned_cols=6  Identities=33%  Similarity=1.353  Sum_probs=1.8

Q ss_pred             cccccc
Q psy4688         368 YCCHIC  373 (388)
Q Consensus       368 ~~C~~C  373 (388)
                      +.|+.|
T Consensus        37 ~~CP~C   42 (42)
T PF15227_consen   37 FSCPEC   42 (42)
T ss_dssp             ---SSS
T ss_pred             CCCcCC
Confidence            666655


No 232
>KOG0562|consensus
Probab=24.65  E-value=54  Score=26.05  Aligned_cols=30  Identities=23%  Similarity=0.350  Sum_probs=20.1

Q ss_pred             hhCCcCCCCCcCCcCCCcHHHHHHHHhhcc
Q psy4688          37 IKNKTKTCPICNKSYPGARNMRKHLRLVHD   66 (388)
Q Consensus        37 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~   66 (388)
                      +.+....|-.|+..-+....|+.|++..++
T Consensus       149 llk~dLrC~~Cq~~~~~~~kLK~Hl~~~~~  178 (184)
T KOG0562|consen  149 LLKEDLRCWRCQTFGPHFPKLKAHLREEYD  178 (184)
T ss_pred             hhccceeehhhhhcccccHHHHHHHHHHHh
Confidence            345667888888444666778888776543


No 233
>KOG1842|consensus
Probab=24.52  E-value=38  Score=31.53  Aligned_cols=29  Identities=28%  Similarity=0.505  Sum_probs=22.2

Q ss_pred             CCccccCCCcccccChhhHHhHHhhhcCC
Q psy4688         311 IEKFKCDLCDKEFFEKKKLNKHKNWAHGD  339 (388)
Q Consensus       311 ~~~~~C~~C~k~F~~~~~L~~H~~~hh~~  339 (388)
                      .+.|-||+|.+.|.+-..|..|...-|++
T Consensus        13 ~egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   13 LEGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             hhcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            35688888888888888888888776653


No 234
>KOG2636|consensus
Probab=24.46  E-value=50  Score=30.78  Aligned_cols=26  Identities=19%  Similarity=0.698  Sum_probs=17.1

Q ss_pred             ccCCCccccccch-hcccChhhHHHHH
Q psy4688          65 HDKNSTTTCTMCK-KTFRNKATFQKHM   90 (388)
Q Consensus        65 h~~~~~~~C~~C~-~~f~~~~~l~~H~   90 (388)
                      |.-+..|.|.+|| .++.....+.+|.
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHh
Confidence            4555567777776 6666666677665


No 235
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=24.41  E-value=52  Score=19.18  Aligned_cols=12  Identities=17%  Similarity=0.625  Sum_probs=8.2

Q ss_pred             ccccCCCccccc
Q psy4688         313 KFKCDLCDKEFF  324 (388)
Q Consensus       313 ~~~C~~C~k~F~  324 (388)
                      -|.|..|+..|.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            477777777654


No 236
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=24.29  E-value=27  Score=25.99  Aligned_cols=12  Identities=33%  Similarity=0.722  Sum_probs=5.9

Q ss_pred             cccCCCcccccC
Q psy4688         314 FKCDLCDKEFFE  325 (388)
Q Consensus       314 ~~C~~C~k~F~~  325 (388)
                      +.|..||..|.-
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            455555555543


No 237
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.92  E-value=53  Score=18.19  Aligned_cols=11  Identities=45%  Similarity=1.017  Sum_probs=7.1

Q ss_pred             ccccCCCcccc
Q psy4688         313 KFKCDLCDKEF  323 (388)
Q Consensus       313 ~~~C~~C~k~F  323 (388)
                      =|.|..|++.+
T Consensus        27 Cf~C~~C~~~L   37 (39)
T smart00132       27 CFKCSKCGKPL   37 (39)
T ss_pred             CCCCcccCCcC
Confidence            36777777655


No 238
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=23.87  E-value=26  Score=35.58  Aligned_cols=8  Identities=38%  Similarity=0.920  Sum_probs=0.0

Q ss_pred             cccccccc
Q psy4688         280 HICKICNK  287 (388)
Q Consensus       280 ~~C~~C~k  287 (388)
                      +.|+.||.
T Consensus       656 r~Cp~Cg~  663 (900)
T PF03833_consen  656 RRCPKCGK  663 (900)
T ss_dssp             --------
T ss_pred             ccCcccCC
Confidence            44555553


No 239
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=23.28  E-value=28  Score=21.10  Aligned_cols=12  Identities=25%  Similarity=0.789  Sum_probs=6.1

Q ss_pred             cccCC--CcccccC
Q psy4688         314 FKCDL--CDKEFFE  325 (388)
Q Consensus       314 ~~C~~--C~k~F~~  325 (388)
                      ++|..  ||..|..
T Consensus        26 ~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen   26 CQCTNPECGHTFVA   39 (47)
T ss_pred             EEECCCcCCCEEEE
Confidence            45544  5555543


No 240
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=23.14  E-value=30  Score=25.83  Aligned_cols=10  Identities=20%  Similarity=0.664  Sum_probs=5.5

Q ss_pred             cccCCCcccc
Q psy4688         314 FKCDLCDKEF  323 (388)
Q Consensus       314 ~~C~~C~k~F  323 (388)
                      +.|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            5566665544


No 241
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=22.95  E-value=28  Score=28.74  Aligned_cols=24  Identities=33%  Similarity=0.798  Sum_probs=0.0

Q ss_pred             CCcCCCCCcC-CcCCCcHHHHHHHH
Q psy4688          39 NKTKTCPICN-KSYPGARNMRKHLR   62 (388)
Q Consensus        39 ~~~~~C~~C~-~~f~~~~~l~~H~~   62 (388)
                      +..|+|.+|| .+|..+..+.+|..
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcC
Confidence            4568899997 56677777877753


No 242
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=22.87  E-value=35  Score=23.63  Aligned_cols=10  Identities=30%  Similarity=1.168  Sum_probs=3.5

Q ss_pred             cccCCCcccc
Q psy4688         314 FKCDLCDKEF  323 (388)
Q Consensus       314 ~~C~~C~k~F  323 (388)
                      ..|..||..|
T Consensus        47 ~~C~~Cg~~~   56 (81)
T PF05129_consen   47 LSCRVCGESF   56 (81)
T ss_dssp             EEESSS--EE
T ss_pred             EEecCCCCeE
Confidence            3444444444


No 243
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=22.85  E-value=28  Score=29.70  Aligned_cols=29  Identities=10%  Similarity=0.157  Sum_probs=0.0

Q ss_pred             CccccCCCcccccChhhHHhHHhhhcCCCc
Q psy4688         312 EKFKCDLCDKEFFEKKKLNKHKNWAHGDKF  341 (388)
Q Consensus       312 ~~~~C~~C~k~F~~~~~L~~H~~~hh~~~~  341 (388)
                      ....|++||.... .+.|..|||+...+-.
T Consensus       167 ~~~~cPitGe~IP-~~e~~eHmRi~LlDP~  195 (229)
T PF12230_consen  167 KMIICPITGEMIP-ADEMDEHMRIELLDPR  195 (229)
T ss_dssp             ------------------------------
T ss_pred             ccccccccccccc-cccccccccccccccc
Confidence            4578999998875 4789999998766543


No 244
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.07  E-value=30  Score=25.79  Aligned_cols=12  Identities=25%  Similarity=0.689  Sum_probs=5.6

Q ss_pred             ccccccchhccc
Q psy4688          70 TTTCTMCKKTFR   81 (388)
Q Consensus        70 ~~~C~~C~~~f~   81 (388)
                      |--|..||..|.
T Consensus        68 psfchncgs~fp   79 (160)
T COG4306          68 PSFCHNCGSRFP   79 (160)
T ss_pred             cchhhcCCCCCC
Confidence            334444554444


No 245
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=21.94  E-value=51  Score=18.49  Aligned_cols=12  Identities=25%  Similarity=0.539  Sum_probs=7.4

Q ss_pred             CCccccCCCccc
Q psy4688         311 IEKFKCDLCDKE  322 (388)
Q Consensus       311 ~~~~~C~~C~k~  322 (388)
                      ...+.|+.||..
T Consensus        20 r~R~vC~~Cg~I   31 (34)
T PF14803_consen   20 RERLVCPACGFI   31 (34)
T ss_dssp             S-EEEETTTTEE
T ss_pred             ccceECCCCCCE
Confidence            455777777754


No 246
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=21.83  E-value=50  Score=24.85  Aligned_cols=22  Identities=14%  Similarity=0.563  Sum_probs=16.0

Q ss_pred             CccccCCCcccccChhhHHhHH
Q psy4688         312 EKFKCDLCDKEFFEKKKLNKHK  333 (388)
Q Consensus       312 ~~~~C~~C~k~F~~~~~L~~H~  333 (388)
                      .-+.|+.||..|.+......-.
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~~~   51 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKRNS   51 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHHHH
Confidence            4578999998888877665543


No 247
>KOG2817|consensus
Probab=21.66  E-value=62  Score=29.72  Aligned_cols=24  Identities=38%  Similarity=0.635  Sum_probs=18.1

Q ss_pred             ceehhHHHHHhhCCc--CCCCCcCCc
Q psy4688          27 VITADKWRALIKNKT--KTCPICNKS   50 (388)
Q Consensus        27 ~~~~~~~~~~~~~~~--~~C~~C~~~   50 (388)
                      ||+.|....+.++..  |+||+|+..
T Consensus       358 VISkdAlnrLS~ng~~sfKCPYCP~e  383 (394)
T KOG2817|consen  358 VISKDALNRLSKNGSQSFKCPYCPVE  383 (394)
T ss_pred             eecHHHHHHHhhCCCeeeeCCCCCcc
Confidence            577777777777776  888888764


No 248
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=21.49  E-value=14  Score=33.50  Aligned_cols=14  Identities=29%  Similarity=0.645  Sum_probs=6.2

Q ss_pred             CccccCCCcccccC
Q psy4688         312 EKFKCDLCDKEFFE  325 (388)
Q Consensus       312 ~~~~C~~C~k~F~~  325 (388)
                      +-|+|..|++...+
T Consensus       284 RFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  284 RFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEE-T-TS-EEEE
T ss_pred             eeEECCCCCCeeee
Confidence            44666666665544


No 249
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=20.86  E-value=1.3e+02  Score=17.66  Aligned_cols=11  Identities=36%  Similarity=0.794  Sum_probs=7.3

Q ss_pred             CCCccccccch
Q psy4688         365 ERKYCCHICGK  375 (388)
Q Consensus       365 ~~~~~C~~C~k  375 (388)
                      .....|++|++
T Consensus        34 ~~~~~CP~C~k   44 (44)
T PF14634_consen   34 GKSVKCPICRK   44 (44)
T ss_pred             CCCCCCcCCCC
Confidence            45567888764


No 250
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=20.35  E-value=88  Score=31.40  Aligned_cols=11  Identities=18%  Similarity=0.446  Sum_probs=6.1

Q ss_pred             ccccccccccc
Q psy4688         281 ICKICNKGYAC  291 (388)
Q Consensus       281 ~C~~C~k~f~~  291 (388)
                      .|+.||.....
T Consensus        43 fC~~CG~~~~~   53 (645)
T PRK14559         43 HCPNCGAETGT   53 (645)
T ss_pred             cccccCCcccc
Confidence            46666655443


No 251
>PRK05978 hypothetical protein; Provisional
Probab=20.30  E-value=55  Score=25.69  Aligned_cols=7  Identities=43%  Similarity=1.289  Sum_probs=3.2

Q ss_pred             cccccCC
Q psy4688         253 ECDYCGA  259 (388)
Q Consensus       253 ~C~~C~~  259 (388)
                      .|+.||+
T Consensus        35 rCP~CG~   41 (148)
T PRK05978         35 RCPACGE   41 (148)
T ss_pred             cCCCCCC
Confidence            3444443


No 252
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.24  E-value=77  Score=18.24  Aligned_cols=11  Identities=36%  Similarity=1.102  Sum_probs=3.9

Q ss_pred             ccccCCCcccc
Q psy4688         313 KFKCDLCDKEF  323 (388)
Q Consensus       313 ~~~C~~C~k~F  323 (388)
                      .|-|+.|+..|
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            35677777766


No 253
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=20.17  E-value=70  Score=18.58  Aligned_cols=10  Identities=20%  Similarity=1.006  Sum_probs=5.0

Q ss_pred             CccccCCCcc
Q psy4688         312 EKFKCDLCDK  321 (388)
Q Consensus       312 ~~~~C~~C~k  321 (388)
                      +.+.|++|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            4566666664


No 254
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=20.08  E-value=38  Score=19.31  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=4.9

Q ss_pred             Cccccccchh
Q psy4688         367 KYCCHICGKK  376 (388)
Q Consensus       367 ~~~C~~C~k~  376 (388)
                      -|+|.+||.-
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4788888753


Done!