Query         psy4692
Match_columns 162
No_of_seqs    129 out of 191
Neff          4.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:27:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4692.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4692hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11923 DUF3441:  Domain of un 100.0 5.9E-43 1.3E-47  265.4   8.2   94   59-152    10-112 (112)
  2 KOG2030|consensus               99.9 4.2E-28   9E-33  229.4   8.5   81   73-155   829-909 (911)
  3 KOG2030|consensus               97.0 4.2E-06 9.2E-11   81.1 -10.5   90   59-148   339-440 (911)
  4 PRK05264 transcriptional repre  46.9     7.5 0.00016   29.5   0.4   17   62-78     61-77  (105)
  5 cd00490 Met_repressor_MetJ Met  46.5     7.8 0.00017   29.2   0.4   17   62-78     60-76  (103)
  6 PF01340 MetJ:  Met Apo-repress  39.0     7.6 0.00016   29.4  -0.7   17   62-78     60-76  (104)
  7 PF13867 SAP30_Sin3_bdg:  Sin3   38.6     4.7  0.0001   26.7  -1.7   40   88-131     4-45  (53)
  8 COG0676 Uncharacterized enzyme  35.1      18  0.0004   32.1   1.0   13   76-88     70-82  (287)
  9 COG3060 MetJ Transcriptional r  28.4      22 0.00048   26.7   0.3   16   62-77     61-76  (105)
 10 PF10890 DUF2741:  Protein of u  19.9      25 0.00055   25.3  -0.7   25   75-99     44-68  (72)

No 1  
>PF11923 DUF3441:  Domain of unknown function (DUF3441);  InterPro: IPR021846  This presumed domain is functionally uncharacterised. This domain is found in archaea and eukaryotes. This domain is typically between 104 to 119 amino acids in length. This domain is found associated with PF05833 from PFAM, PF05670 from PFAM. This domain has two conserved residues (P and G) that may be functionally important. 
Probab=100.00  E-value=5.9e-43  Score=265.36  Aligned_cols=94  Identities=56%  Similarity=0.920  Sum_probs=91.2

Q ss_pred             hhhhhcccccCCCCCCCeEEeeceecccchhhccceeeEEeecCCcchhhHHHHHHHHH--------HhCcCCChhHHHH
Q psy4692          59 AEVDMLDSLTGQPCNEDELLFAVPVVAPYVTLTNYKYKVKLMPGTGKRGKASKTAQNIF--------LKDKNASSREKDL  130 (162)
Q Consensus        59 ~~~~~ld~Ltg~P~~~D~Il~AVPVcAPysAL~~yKYKVKL~PG~~KKGKaak~al~~F--------~~~~~~~~rE~eL  130 (162)
                      +++.+|++|||+|.++|+|+|||||||||+||++||||||||||++|||||++++|+||        +++.++|++|++|
T Consensus        10 e~~~~l~~ltg~P~~~D~il~aVPVcAP~sal~~yKYkvKl~PG~~KKGKaak~il~~f~~~~~d~~~~~~~~~~~e~~l   89 (112)
T PF11923_consen   10 EYLSELDSLTGTPLPEDEILYAVPVCAPYSALSKYKYKVKLQPGNAKKGKAAKEILEYFTARKVDESMKDKDDWPREREL   89 (112)
T ss_pred             HHHHHHHHhcCCCCCCCEEEEEEEeecCHHHHhhCceeEEEcCCCcchHHHHHHHHHHHHhcccchhhcCccCCHHHHHH
Confidence            78899999999999999999999999999999999999999999999999999999999        6677789999999


Q ss_pred             HhcCChHHHHhhcC-CceEEecc
Q psy4692         131 IKSVKDEVLARNIP-GKVKLSAP  152 (162)
Q Consensus       131 IK~ik~~el~~~lp-gkvKv~~p  152 (162)
                      ||+|+++|++++|+ |+|||++|
T Consensus        90 ik~~~~~e~~~~~~v~kvKi~~P  112 (112)
T PF11923_consen   90 IKSIKDNELINTLPVGKVKISSP  112 (112)
T ss_pred             HccCCHHHHHhhccccCEEEeCC
Confidence            99999999999999 99999987


No 2  
>KOG2030|consensus
Probab=99.95  E-value=4.2e-28  Score=229.39  Aligned_cols=81  Identities=63%  Similarity=0.953  Sum_probs=78.1

Q ss_pred             CCCeEEeeceecccchhhccceeeEEeecCCcchhhHHHHHHHHHHhCcCCChhHHHHHhcCChHHHHhhcCCceEEecc
Q psy4692          73 NEDELLFAVPVVAPYVTLTNYKYKVKLMPGTGKRGKASKTAQNIFLKDKNASSREKDLIKSVKDEVLARNIPGKVKLSAP  152 (162)
Q Consensus        73 ~~D~Il~AVPVcAPysAL~~yKYKVKL~PG~~KKGKaak~al~~F~~~~~~~~rE~eLIK~ik~~el~~~lpgkvKv~~p  152 (162)
                      ++|+|+|||||||||+||++||||||++||++|||||+++||++|.++.  |+||++||++++++.++++++|+|||++|
T Consensus       829 ~~D~ll~avPv~aPy~Al~~ykykVKi~PGsgK~gKaak~al~~F~~~~--s~re~~lik~lk~~~~~~~~v~kvkit~~  906 (911)
T KOG2030|consen  829 KGDTLLFAVPVVAPYNALQKYKYKVKITPGSGKKGKAAKEALNLFTKRP--SPREKELIKSLKDDSLARNLVGKVKITAA  906 (911)
T ss_pred             CCceeEEeeccccChHHHHhhceeEEecCCcCcccHHHHHHHHHHhcCC--ChhHHHHHHhcchhHHHhhcccceEEehh
Confidence            9999999999999999999999999999999999999999999999877  99999999999999999999999999999


Q ss_pred             chh
Q psy4692         153 QTL  155 (162)
Q Consensus       153 ~~~  155 (162)
                      ++.
T Consensus       907 q~k  909 (911)
T KOG2030|consen  907 QLK  909 (911)
T ss_pred             hhc
Confidence            654


No 3  
>KOG2030|consensus
Probab=97.03  E-value=4.2e-06  Score=81.10  Aligned_cols=90  Identities=18%  Similarity=0.158  Sum_probs=72.7

Q ss_pred             hhhhhcccccCCCCCCCeEEeeceecccchhhccceeeEEeecCCcchhh-HHHHHHHHHHhCcCCChhHHHHHh-----
Q psy4692          59 AEVDMLDSLTGQPCNEDELLFAVPVVAPYVTLTNYKYKVKLMPGTGKRGK-ASKTAQNIFLKDKNASSREKDLIK-----  132 (162)
Q Consensus        59 ~~~~~ld~Ltg~P~~~D~Il~AVPVcAPysAL~~yKYKVKL~PG~~KKGK-aak~al~~F~~~~~~~~rE~eLIK-----  132 (162)
                      .......+.+..|.++|+..++++||+||.-..+|+|.+||+++-+|||. +|+.++..|+....+|-+..+...     
T Consensus       339 qe~~~~kAelIe~N~eLVe~~il~I~s~la~~m~W~dieKLik~eqKkGn~vAk~i~~l~l~~n~~t~~L~d~~dd~~de  418 (911)
T KOG2030|consen  339 QELNRRKAELIEPNPELVEAAILAIQSALAQQMDWKDIEKLIKSEQKKGNPVAKSIDKLKLEKNEATLRLKDPEDDNDDE  418 (911)
T ss_pred             HHHHHHHHHhccCCHHHHHHHHHHHHHHHHccCCcHhHHHHHHHHHhcCchHhhhhhHHHHhhhhheeecCCcccccchh
Confidence            55667889999999999999999999999999999999999999999999 889999999987766655555444     


Q ss_pred             ------cCChHHHHhhcCCceE
Q psy4692         133 ------SVKDEVLARNIPGKVK  148 (162)
Q Consensus       133 ------~ik~~el~~~lpgkvK  148 (162)
                            ...+-||..+.++|++
T Consensus       419 ~k~~e~~~VeiDLslsA~aNAr  440 (911)
T KOG2030|consen  419 KKSSEVIVVEIDLSLSAFANAR  440 (911)
T ss_pred             hccccceeeeeeccccchhhHH
Confidence                  2234455555555543


No 4  
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=46.92  E-value=7.5  Score=29.48  Aligned_cols=17  Identities=47%  Similarity=0.722  Sum_probs=14.4

Q ss_pred             hhcccccCCCCCCCeEE
Q psy4692          62 DMLDSLTGQPCNEDELL   78 (162)
Q Consensus        62 ~~ld~Ltg~P~~~D~Il   78 (162)
                      .+|..|||+|.|+|.=|
T Consensus        61 AFLHA~TGQPLP~D~Dl   77 (105)
T PRK05264         61 AFLHAFTGQPLPDDEDL   77 (105)
T ss_pred             HHHHHHcCCCCCChhhh
Confidence            68999999999998643


No 5  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=46.48  E-value=7.8  Score=29.22  Aligned_cols=17  Identities=41%  Similarity=0.651  Sum_probs=14.4

Q ss_pred             hhcccccCCCCCCCeEE
Q psy4692          62 DMLDSLTGQPCNEDELL   78 (162)
Q Consensus        62 ~~ld~Ltg~P~~~D~Il   78 (162)
                      .+|..|||+|.|+|.=|
T Consensus        60 AFLHAfTGQPLP~D~Dl   76 (103)
T cd00490          60 AFLHAFTGQPLPDDADL   76 (103)
T ss_pred             HHHHHhcCCCCCChhhh
Confidence            68999999999998643


No 6  
>PF01340 MetJ:  Met Apo-repressor, MetJ;  InterPro: IPR002084 Binding of a specific DNA fragment and S-adenosyl methionine (SAM) co-repressor molecules to the Escherichia coli methionine repressor (MetJ) leads to a significant reduction in dynamic flexibility of the ternary complex, with considerable entropy-enthalpy compensation, not necessarily involving any overall conformational change []. MetJ is a regulatory protein which when combined with S-adenosylmethionine (SAM) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis. It is also autoregulated. The crystal structure of the met repressor-operator complex shows two dimeric repressor molecules bound to adjacent sites 8 base pairs apart on an 18-base-pair DNA fragment. Sequence specificity is achieved by insertion of double-stranded antiparallel protein beta-ribbons into the major groove of B-form DNA, with direct hydrogen-bonding between amino-acid side chains and the base pairs. The repressor also recognises sequence-dependent distortion or flexibility of the operator phosphate backbone, conferring specificity even for inaccessible base pairs [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0006555 methionine metabolic process; PDB: 1MJO_D 1CMB_A 1MJQ_C 1CMC_B 1MJK_A 1MJ2_A 1MJP_A 1MJM_B 1CMA_B 1MJL_A ....
Probab=38.97  E-value=7.6  Score=29.35  Aligned_cols=17  Identities=41%  Similarity=0.649  Sum_probs=8.4

Q ss_pred             hhcccccCCCCCCCeEE
Q psy4692          62 DMLDSLTGQPCNEDELL   78 (162)
Q Consensus        62 ~~ld~Ltg~P~~~D~Il   78 (162)
                      .+|..|||+|.|+|.=|
T Consensus        60 AFLHAfTGQPLP~D~dl   76 (104)
T PF01340_consen   60 AFLHAFTGQPLPTDDDL   76 (104)
T ss_dssp             HHHHHHH------TTGG
T ss_pred             HHHHHhcCCCCCChhhh
Confidence            67999999999988533


No 7  
>PF13867 SAP30_Sin3_bdg:  Sin3 binding region of histone deacetylase complex subunit SAP30; PDB: 2LD7_A.
Probab=38.61  E-value=4.7  Score=26.69  Aligned_cols=40  Identities=25%  Similarity=0.430  Sum_probs=21.6

Q ss_pred             hhhccce--eeEEeecCCcchhhHHHHHHHHHHhCcCCChhHHHHH
Q psy4692          88 VTLTNYK--YKVKLMPGTGKRGKASKTAQNIFLKDKNASSREKDLI  131 (162)
Q Consensus        88 sAL~~yK--YKVKL~PG~~KKGKaak~al~~F~~~~~~~~rE~eLI  131 (162)
                      .+|.+|+  |++.-.|+ .-|-.-+..+..||....   -.|.+.|
T Consensus         4 ~tLrrY~~~~~l~~~~~-~sK~qLa~~V~kHF~s~~---v~E~evI   45 (53)
T PF13867_consen    4 PTLRRYKKHYKLPERPR-SSKEQLANAVRKHFNSQP---VDENEVI   45 (53)
T ss_dssp             HHHHHHHHHTT----SS---HHHHHHHHHHHHTT-------HHHHH
T ss_pred             HHHHHHHHHhCCCCCCC-CCHHHHHHHHHHHHhcCC---CCHHHHH
Confidence            4677776  46666684 566889999999996644   3444444


No 8  
>COG0676 Uncharacterized enzymes related to aldose 1-epimerase [Carbohydrate transport and metabolism]
Probab=35.09  E-value=18  Score=32.05  Aligned_cols=13  Identities=15%  Similarity=0.460  Sum_probs=10.5

Q ss_pred             eEEeeceecccch
Q psy4692          76 ELLFAVPVVAPYV   88 (162)
Q Consensus        76 ~Il~AVPVcAPys   88 (162)
                      -|=..||||.||-
T Consensus        70 aIRGGIPICwPWF   82 (287)
T COG0676          70 AIRGGIPICWPWF   82 (287)
T ss_pred             cccCCCcEEEecc
Confidence            4457899999986


No 9  
>COG3060 MetJ Transcriptional regulator of met regulon [Transcription / Amino acid transport and metabolism]
Probab=28.42  E-value=22  Score=26.72  Aligned_cols=16  Identities=38%  Similarity=0.551  Sum_probs=13.8

Q ss_pred             hhcccccCCCCCCCeE
Q psy4692          62 DMLDSLTGQPCNEDEL   77 (162)
Q Consensus        62 ~~ld~Ltg~P~~~D~I   77 (162)
                      .+|..|||+|.|.|+=
T Consensus        61 aflhaftgqplptd~d   76 (105)
T COG3060          61 AFLHAFTGQPLPTDAD   76 (105)
T ss_pred             HHHHHHcCCCCCCcHH
Confidence            6799999999999853


No 10 
>PF10890 DUF2741:  Protein of unknown function (DUF2741);  InterPro: IPR020101 This entry represents subunit 8 of the Cytochrome b-c1 complex. The ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone. In plants, the b-c1 complex contains 10 subunits: 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins.
Probab=19.90  E-value=25  Score=25.28  Aligned_cols=25  Identities=44%  Similarity=0.623  Sum_probs=20.2

Q ss_pred             CeEEeeceecccchhhccceeeEEe
Q psy4692          75 DELLFAVPVVAPYVTLTNYKYKVKL   99 (162)
Q Consensus        75 D~Il~AVPVcAPysAL~~yKYKVKL   99 (162)
                      |..++++|+++.|..-.+|+-+-||
T Consensus        44 ~a~~~~~p~~Gt~~Ya~~y~e~EKL   68 (72)
T PF10890_consen   44 SATLFLVPLVGTYWYAENYKEQEKL   68 (72)
T ss_pred             eeEEEeeeehhhHHHHHHHHHHHhh
Confidence            5677888999999999999866554


Done!