Diaphorina citri psyllid: psy4692

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MKSAGNKENKKSKKGKREKGGIAKLTREIDSRHPPRPQPAVDPDEREGDEIETEPVVSAEVDMLDSLTGQPCNEDELLFAVPVVAPYVTLTNYKYKVKLMPGTGKRGKASKTAQNIFLKDKNASSREKDLIKSVKDEVLARNIPGKVKLSAPQTLLLKAKKH
ccccccccHHcccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccccccccEEEEEEEccccHHHHHccccEEEECcccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHccccEEEEccccHHHHHHcc
******************************************************PVVSAEVDMLDSLTGQPCNEDELLFAVPVVAPYVTLTNYKYKVKLMPGTGKRGKASKTAQNIFLKDK***SREKDLIKSVKDEVLARNIPGKVKLS************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSAGNKENKKSKKGKREKGGIAKLTREIDSRHPPRPQPAVDPDEREGDEIETEPVVSAEVDMLDSLTGQPCNEDELLFAVPVVAPYVTLTNYKYKVKLMPGTGKRGKASKTAQNIFLKDKNASSREKDLIKSVKDEVLARNIPGKVKLSAPQTLLLKAKKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear export mediator factor NEMF homolog Plays a role in regulating nuclear transport possibly through directly binding to both emb and cargo proteins.confidentQ9VBX1
Nuclear export mediator factor Nemf Plays a role in nuclear export.confidentQ8CCP0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051168 [BP]nuclear exportprobableGO:0051169, GO:0051234, GO:0046907, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted