Diaphorina citri psyllid: psy472


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MGLPTFEDNLEGYKIAALNNKVDRIRDKQYLLVHGTMDDNVHFQQSMMLAKSLQHADIMFQSQECYRR
cccccccccHHHHHHcHHHHHHHccccccEEEEEcccccccHHHcHHHHHHHHHHccccccEEcEEcc
***PTFEDNLEGYKIAALNNKVDRIRDKQYLLVHGTMDDNVHFQQSMMLAKSLQHADIMFQSQECYR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLPTFEDNLEGYKIAALNNKVDRIRDKQYLLVHGTMDDNVHFQQSMMLAKSLQHADIMFQSQECYRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Seprase In association with DPP4 is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM (By similarity). May have a role in tissue remodeling during development and wound healing, and contribute to invasiveness in malignant cancers.confidentP97321
Venom dipeptidyl peptidase 4 Venom dipeptidyl-peptidase which removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. May process promelittin into its activ form and/or modulate the chemotactic activity of immune cells after the insect sting.confidentB2D0J4
Seprase In association with DPP4 is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May have a role in tissue remodeling during development and wound healing, and may contribute to invasiveness in malignant cancers.confidentQ12884

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043542 [BP]endothelial cell migrationprobableGO:0040011, GO:0032501, GO:0010631, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0010716 [BP]negative regulation of extracellular matrix disassemblyprobableGO:0010715, GO:0009987, GO:0051129, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0051128, GO:0050789, GO:0048523
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008239 [MF]dipeptidyl-peptidase activityprobableGO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0008236 [MF]serine-type peptidase activityprobableGO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0002020 [MF]protease bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A5S, chain A
Confidence level:very confident
Coverage over the Query: 2-68
View the alignment between query and template
View the model in PyMOL