BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy4748
         (136 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QYP|A Chain A, Thermococcus Celer Rpb9, Nmr, 25 Structures
          Length = 57

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 99  PIVERKCKRCNNDTMSYATLQLRSADEGQTIFFTCTKC 136
           P  +  C +C NDT  +  +Q R+ DE  TIF+ CTKC
Sbjct: 12  PTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKC 49


>pdb|3QT1|I Chain I, Rna Polymerase Ii Variant Containing A Chimeric Rpb9-C11
           Subunit
          Length = 133

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 27/126 (21%)

Query: 13  FCSKCGTIL-PLFDFKGDVKCYVCKT-SYGTQEQQPLLLGPDILFLKRFKGHFNLFLAVF 70
           FC  C  +L P  D + +   + C+T SY  +   PL+   +++       +      V 
Sbjct: 26  FCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELI------TNIGETAGVV 79

Query: 71  EEIKAEYTIHFNTVEKEKQKDKTEIADGPIVERKCKRCNNDTMSYATLQLRSADEGQTIF 130
           ++I ++ T+                   P  +R+C +C++    +  LQ+RSADE  T F
Sbjct: 80  QDIGSDPTL-------------------PRSDRECPKCHSRENVFFQLQIRSADEPMTTF 120

Query: 131 FTCTKC 136
           + C  C
Sbjct: 121 YKCVNC 126


>pdb|1PQV|S Chain S, Rna Polymerase Ii-Tfiis Complex
          Length = 309

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 96  ADGPIVERK------CKRCNNDTMSYATLQLRSADEGQTIFFTCTKC 136
           A G  +ER       C +C    +SY  LQ RSADE  T F TC  C
Sbjct: 256 AQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEAC 302


>pdb|1Y1V|S Chain S, Refined Rna Polymerase Ii-tfiis Complex
 pdb|1Y1Y|S Chain S, Rna Polymerase Ii-Tfiis-DnaRNA COMPLEX
          Length = 179

 Score = 35.4 bits (80), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 96  ADGPIVERK------CKRCNNDTMSYATLQLRSADEGQTIFFTCTKC 136
           A G  +ER       C +C    +SY  LQ RSADE  T F TC  C
Sbjct: 126 AQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEAC 172


>pdb|3GTM|S Chain S, Co-Complex Of Backtracked Rna Polymerase Ii With Tfiis
          Length = 173

 Score = 33.9 bits (76), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 96  ADGPIVERK------CKRCNNDTMSYATLQLRSADEGQTIFFTCTKC 136
           A G  +ER       C +C    +SY  LQ RSAD   T F TC  C
Sbjct: 120 AQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEAC 166


>pdb|1TFI|A Chain A, A Novel Zn Finger Motif In The Basal Transcriptional
           Machinery: Three-Dimensional Nmr Studies Of The Nucleic-
           Acid Binding Domain Of Transcriptional Elongation Factor
           Tfiis
          Length = 50

 Score = 30.4 bits (67), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 105 CKRCNNDTMSYATLQLRSADEGQTIFFTCTKC 136
           C +C     +Y  +Q RSADE  T F  C +C
Sbjct: 12  CGKCKKKNCTYTQVQTRSADEPMTTFVVCNEC 43


>pdb|3PO3|S Chain S, Arrested Rna Polymerase Ii Reactivation Intermediate
          Length = 178

 Score = 30.4 bits (67), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 6/47 (12%)

Query: 96  ADGPIVERK------CKRCNNDTMSYATLQLRSADEGQTIFFTCTKC 136
           A G  +ER       C +C    +SY  LQ RSA    T F TC  C
Sbjct: 125 AQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEAC 171


>pdb|1I3Q|I Chain I, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution
 pdb|1I50|I Chain I, Rna Polymerase Ii Crystal Form Ii At 2.8 A Resolution
 pdb|1I6H|I Chain I, Rna Polymerase Ii Elongation Complex
 pdb|1K83|I Chain I, Crystal Structure Of Yeast Rna Polymerase Ii Complexed
           With The Inhibitor Alpha Amanitin
 pdb|1NIK|I Chain I, Wild Type Rna Polymerase Ii
 pdb|1NT9|I Chain I, Complete 12-Subunit Rna Polymerase Ii
 pdb|1PQV|I Chain I, Rna Polymerase Ii-Tfiis Complex
 pdb|1R5U|I Chain I, Rna Polymerase Ii Tfiib Complex
 pdb|1SFO|I Chain I, Rna Polymerase Ii Strand Separated Elongation Complex
 pdb|1R9S|I Chain I, Rna Polymerase Ii Strand Separated Elongation Complex,
           Matched Nucleotide
 pdb|1R9T|I Chain I, Rna Polymerase Ii Strand Separated Elongation Complex,
           Mismatched Nucleotide
 pdb|1TWA|I Chain I, Rna Polymerase Ii Complexed With Atp
 pdb|1TWC|I Chain I, Rna Polymerase Ii Complexed With Gtp
 pdb|1TWF|I Chain I, Rna Polymerase Ii Complexed With Utp At 2.3 A Resolution
 pdb|1TWG|I Chain I, Rna Polymerase Ii Complexed With Ctp
 pdb|1TWH|I Chain I, Rna Polymerase Ii Complexed With 2'datp
 pdb|1WCM|I Chain I, Complete 12-Subunit Rna Polymerase Ii At 3.8 Ang
 pdb|1Y1W|I Chain I, Complete Rna Polymerase Ii Elongation Complex
 pdb|1Y77|I Chain I, Complete Rna Polymerase Ii Elongation Complex With
           Substrate Analogue Gmpcpp
 pdb|1Y1V|I Chain I, Refined Rna Polymerase Ii-tfiis Complex
 pdb|1Y1Y|I Chain I, Rna Polymerase Ii-Tfiis-DnaRNA COMPLEX
 pdb|2B63|I Chain I, Complete Rna Polymerase Ii-Rna Inhibitor Complex
 pdb|2B8K|I Chain I, 12-Subunit Rna Polymerase Ii
 pdb|2E2H|I Chain I, Rna Polymerase Ii Elongation Complex At 5 Mm Mg2+ With Gtp
 pdb|2E2I|I Chain I, Rna Polymerase Ii Elongation Complex In 5 Mm Mg+2 With 2'-
           Dgtp
 pdb|2E2J|I Chain I, Rna Polymerase Ii Elongation Complex In 5 Mm Mg+2 With
           Gmpcpp
 pdb|2NVQ|I Chain I, Rna Polymerase Ii Elongation Complex In 150 Mm Mg+2 With
           2'dutp
 pdb|2NVT|I Chain I, Rna Polymerase Ii Elongation Complex In 150 Mm Mg+2 With
           Gmpcpp
 pdb|2NVX|I Chain I, Rna Polymerase Ii Elongation Complex In 5 Mm Mg+2 With 2'-
           Dutp
 pdb|2NVY|I Chain I, Rna Polymerase Ii Form Ii In 150 Mm Mn+2
 pdb|2NVZ|I Chain I, Rna Polymerase Ii Elongation Complex With Utp, Updated
           112006
 pdb|2JA5|I Chain I, Cpd Lesion Containing Rna Polymerase Ii Elongation Complex
           A
 pdb|2JA6|I Chain I, Cpd Lesion Containing Rna Polymerase Ii Elongation Complex
           B
 pdb|2JA7|I Chain I, Cpd Lesion Containing Rna Polymerase Ii Elongation Complex
           C
 pdb|2JA7|U Chain U, Cpd Lesion Containing Rna Polymerase Ii Elongation Complex
           C
 pdb|2JA8|I Chain I, Cpd Lesion Containing Rna Polymerase Ii Elongation Complex
           D
 pdb|2YU9|I Chain I, Rna Polymerase Ii Elongation Complex In 150 Mm Mg+2 With
           Utp
 pdb|2R7Z|I Chain I, Cisplatin Lesion Containing Rna Polymerase Ii Elongation
           Complex
 pdb|2R92|I Chain I, Elongation Complex Of Rna Polymerase Ii With Artificial
           Rdrp Scaffold
 pdb|2R93|I Chain I, Elongation Complex Of Rna Polymerase Ii With A Hepatitis
           Delta Virus-Derived Rna Stem Loop
 pdb|2VUM|I Chain I, Alpha-Amanitin Inhibited Complete Rna Polymerase Ii
           Elongation Complex
 pdb|3CQZ|I Chain I, Crystal Structure Of 10 Subunit Rna Polymerase Ii In
           Complex With The Inhibitor Alpha-Amanitin
 pdb|3FKI|I Chain I, 12-Subunit Rna Polymerase Ii Refined With Zn-Sad Data
 pdb|3GTG|I Chain I, Backtracked Rna Polymerase Ii Complex With 12mer Rna
 pdb|3GTJ|I Chain I, Backtracked Rna Polymerase Ii Complex With 13mer Rna
 pdb|3GTK|I Chain I, Backtracked Rna Polymerase Ii Complex With 18mer Rna
 pdb|3GTL|I Chain I, Backtracked Rna Polymerase Ii Complex With 13mer With G<>u
           Mismatch
 pdb|3GTM|I Chain I, Co-Complex Of Backtracked Rna Polymerase Ii With Tfiis
 pdb|3GTO|I Chain I, Backtracked Rna Polymerase Ii Complex With 15mer Rna
 pdb|3GTP|I Chain I, Backtracked Rna Polymerase Ii Complex With 24mer Rna
 pdb|3GTQ|I Chain I, Backtracked Rna Polymerase Ii Complex Induced By Damage
 pdb|3H3V|J Chain J, Yeast Rnap Ii Containing Poly(A)-Signal Sequence In The
           Active Site
 pdb|3HOU|I Chain I, Complete Rna Polymerase Ii Elongation Complex I With A T-U
           Mismatch
 pdb|3HOU|U Chain U, Complete Rna Polymerase Ii Elongation Complex I With A T-U
           Mismatch
 pdb|3HOV|I Chain I, Complete Rna Polymerase Ii Elongation Complex Ii
 pdb|3HOW|I Chain I, Complete Rna Polymerase Ii Elongation Complex Iii With A
           T-U Mismatch And A Frayed Rna 3'-Uridine
 pdb|3HOX|I Chain I, Complete Rna Polymerase Ii Elongation Complex V
 pdb|3HOY|I Chain I, Complete Rna Polymerase Ii Elongation Complex Vi
 pdb|3HOZ|I Chain I, Complete Rna Polymerase Ii Elongation Complex Iv With A
           T-U Mismatch And A Frayed Rna 3'-Guanine
 pdb|3I4M|I Chain I, 8-oxoguanine Containing Rna Polymerase Ii Elongation
           Complex D
 pdb|3I4N|I Chain I, 8-oxoguanine Containing Rna Polymerase Ii Elongation
           Complex E
 pdb|3K1F|I Chain I, Crystal Structure Of Rna Polymerase Ii In Complex With
           Tfiib
 pdb|3K7A|I Chain I, Crystal Structure Of An Rna Polymerase Ii-Tfiib Complex
 pdb|3M3Y|I Chain I, Rna Polymerase Ii Elongation Complex C
 pdb|3M4O|I Chain I, Rna Polymerase Ii Elongation Complex B
 pdb|3PO2|I Chain I, Arrested Rna Polymerase Ii Elongation Complex
 pdb|3PO3|I Chain I, Arrested Rna Polymerase Ii Reactivation Intermediate
 pdb|3RZD|I Chain I, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
 pdb|3RZO|I Chain I, Rna Polymerase Ii Initiation Complex With A 4-Nt Rna
 pdb|3S14|I Chain I, Rna Polymerase Ii Initiation Complex With A 6-Nt Rna
 pdb|3S15|I Chain I, Rna Polymerase Ii Initiation Complex With A 7-Nt Rna
 pdb|3S16|I Chain I, Rna Polymerase Ii Initiation Complex With An 8-Nt Rna
 pdb|3S17|I Chain I, Rna Polymerase Ii Initiation Complex With A 9-Nt Rna
 pdb|3S1M|I Chain I, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
           (Variant 1)
 pdb|3S1N|I Chain I, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
           (Variant 2)
 pdb|3S1Q|I Chain I, Rna Polymerase Ii Initiation Complex With A 5-Nt 3'-Deoxy
           Rna Soaked With Atp
 pdb|3S1R|I Chain I, Rna Polymerase Ii Initiation Complex With A 5-Nt 3'-Deoxy
           Rna Soaked With Gtp
 pdb|3S2D|I Chain I, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
           Containing A 5br- U
 pdb|3S2H|I Chain I, Rna Polymerase Ii Initiation Complex With A 6-Nt Rna
           Containing A 2[prime]-Iodo Atp
 pdb|3J0K|I Chain I, Orientation Of Rna Polymerase Ii Within The Human
           Vp16-Mediator-Pol Ii-Tfiif Assembly
 pdb|4A3C|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 5nt
           Dna-Rna Hybrid
 pdb|4A3B|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 4nt
           Dna-Rna Hybrid
 pdb|4A3D|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 6nt
           Dna-Rna Hybrid
 pdb|4A3E|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 5nt
           Dna-Rna Hybrid And Soaked With Ampcpp
 pdb|4A3F|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 6nt
           Dna-Rna Hybrid And Soaked With Ampcpp
 pdb|4A3J|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 2nt
           Dna-Rna Hybrid And Soaked With Gmpcpp
 pdb|4A3K|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 7nt
           Dna-Rna Hybrid
 pdb|4A3L|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 7nt
           Dna-Rna Hybrid And Soaked With Ampcpp
 pdb|4A3M|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 4nt
           Dna-Rna Hybrid And Soaked With Ampcpp
 pdb|4A3G|I Chain I, Rna Polymerase Ii Initial Transcribing Complex With A 2nt
           Dna-Rna Hybrid
 pdb|4A3I|I Chain I, Rna Polymerase Ii Binary Complex With Dna
 pdb|4A93|I Chain I, Rna Polymerase Ii Elongation Complex Containing A Cpd
           Lesion
 pdb|4BBR|I Chain I, Structure Of Rna Polymerase Ii-tfiib Complex
 pdb|4BBS|I Chain I, Structure Of An Initially Transcribing Rna Polymerase Ii-
           Tfiib Complex
          Length = 122

 Score = 28.1 bits (61), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 49/126 (38%), Gaps = 27/126 (21%)

Query: 13  FCSKCGTIL-PLFDFKGDVKCYVCKT-SYGTQEQQPLLLGPDILFLKRFKGHFNLFLAVF 70
           FC  C  +L P  D + +   + C+T SY  +   PL+   +++       +      V 
Sbjct: 6   FCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELI------TNIGETAGVV 59

Query: 71  EEIKAEYTIHFNTVEKEKQKDKTEIADGPIVERKCKRCNNDTMSYATLQLRSADEGQTIF 130
           ++I ++ T+                   P  +R+C +C++    +   Q R  D    +F
Sbjct: 60  QDIGSDPTL-------------------PRSDRECPKCHSRENVFFQSQQRRKDTSMVLF 100

Query: 131 FTCTKC 136
           F C  C
Sbjct: 101 FVCLSC 106


>pdb|3US8|A Chain A, Crystal Structure Of An Isocitrate Dehydrogenase From
           Sinorhizobium Meliloti 1021
 pdb|3US8|B Chain B, Crystal Structure Of An Isocitrate Dehydrogenase From
           Sinorhizobium Meliloti 1021
          Length = 427

 Score = 26.6 bits (57), Expect = 5.0,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 38  SYGTQEQQPLLLGPDILFLKRFKGHF-NLFLAVF-EEIKAEY 77
           +YG Q + P+ L      LK + G F ++F  VF EE  A++
Sbjct: 219 NYGLQRKVPVYLSTKNTILKAYDGRFKDIFQKVFDEEFAAQF 260


>pdb|3H0G|I Chain I, Rna Polymerase Ii From Schizosaccharomyces Pombe
 pdb|3H0G|U Chain U, Rna Polymerase Ii From Schizosaccharomyces Pombe
          Length = 113

 Score = 26.2 bits (56), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/73 (19%), Positives = 29/73 (39%), Gaps = 6/73 (8%)

Query: 70  FEEIKAEYTIHFNTVEKEKQKDKTEIADG------PIVERKCKRCNNDTMSYATLQLRSA 123
           + EI A   ++ + ++    ++ T   D       P  +++C RC+     +     R  
Sbjct: 34  YSEIAATSKVYRHELQSSNVENTTVSHDASTDPTLPRSDKECPRCHQHEAVFYQTHSRRG 93

Query: 124 DEGQTIFFTCTKC 136
           D   T+ + C  C
Sbjct: 94  DTMMTLIYVCVHC 106


>pdb|2AXH|A Chain A, Crystal Structures Of T Cell Receptor Beta Chains Related
           To Rheumatoid Arthritis
 pdb|2AXH|B Chain B, Crystal Structures Of T Cell Receptor Beta Chains Related
           To Rheumatoid Arthritis
          Length = 242

 Score = 25.8 bits (55), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%)

Query: 27  KGDVKCYVCKTSYGTQEQQPLLLGPDILFLKRFKGHFNLFLAVFEEIKAE 76
           K     Y+C +S G   +Q    G  +  L+  K  F   +AVFE  +AE
Sbjct: 83  KNPTAFYLCASSIGQXNEQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAE 132


>pdb|2XCI|A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Substrate-Free Form
 pdb|2XCI|B Chain B, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Substrate-Free Form
 pdb|2XCI|C Chain C, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Substrate-Free Form
 pdb|2XCI|D Chain D, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Substrate-Free Form
 pdb|2XCU|A Chain A, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Comlex With Cmp
 pdb|2XCU|B Chain B, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Comlex With Cmp
 pdb|2XCU|C Chain C, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Comlex With Cmp
 pdb|2XCU|D Chain D, Membrane-Embedded Monofunctional Glycosyltransferase
          Waaa Of Aquifex Aeolicus, Comlex With Cmp
          Length = 374

 Score = 25.8 bits (55), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 61 GHFNLFLAVFEEIKAEYTI---HFNTVEKEKQKDKTEIAD 97
          G FN FL + +E+K E+ I   +F+   +E  K K++  D
Sbjct: 51 GEFNTFLPILKELKREHRILLTYFSPRAREYLKTKSDFYD 90


>pdb|3RS1|A Chain A, Mouse C-Type Lectin-Related Protein Clrg
 pdb|3RS1|B Chain B, Mouse C-Type Lectin-Related Protein Clrg
          Length = 122

 Score = 25.8 bits (55), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 9/21 (42%), Positives = 16/21 (76%)

Query: 52 DILFLKRFKGHFNLFLAVFEE 72
          +++FLKRFKG F+ ++ +  E
Sbjct: 51 ELIFLKRFKGDFDSWIGLHRE 71


>pdb|2PCD|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|3PCF|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCH|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCL|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCM|A Chain A, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|B Chain B, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|C Chain C, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|D Chain D, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|E Chain E, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|F Chain F, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCA|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCI|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCJ|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCK|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCN|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCB|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCC|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCD|A Chain A, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|B Chain B, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|C Chain C, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|D Chain D, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|E Chain E, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|F Chain F, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCE|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCG|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|1YKK|A Chain A, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|C Chain C, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|E Chain E, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|G Chain G, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|I Chain I, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|K Chain K, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKL|A Chain A, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|C Chain C, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|E Chain E, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|G Chain G, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|I Chain I, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|K Chain K, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKM|A Chain A, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|C Chain C, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|E Chain E, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|G Chain G, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|I Chain I, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|K Chain K, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKN|A Chain A, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|C Chain C, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|E Chain E, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|G Chain G, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|I Chain I, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|K Chain K, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKO|A Chain A, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|C Chain C, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|E Chain E, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|G Chain G, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|I Chain I, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|K Chain K, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKP|A Chain A, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|C Chain C, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|E Chain E, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|G Chain G, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|I Chain I, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|K Chain K, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|3LMX|A Chain A, Tyrosine 447 Of Protocatechuate 34,-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LMX|B Chain B, Tyrosine 447 Of Protocatechuate 34,-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LMX|C Chain C, Tyrosine 447 Of Protocatechuate 34,-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|A Chain A, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|B Chain B, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|C Chain C, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|D Chain D, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|E Chain E, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|F Chain F, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LXV|A Chain A, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LXV|B Chain B, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LXV|C Chain C, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3MFL|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MFL|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MFL|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI1|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI1|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI1|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|D Chain D, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|E Chain E, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|F Chain F, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV4|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV4|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV4|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV6|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV6|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV6|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T63|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T63|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T63|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T67|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T67|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T67|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
          Length = 200

 Score = 25.4 bits (54), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 51/128 (39%), Gaps = 15/128 (11%)

Query: 7   FNVESEFCSKCGTILPLFDFKGDVKCYVCKTSYGTQEQQPLLLGPDI---LFLKRFKGHF 63
           +N+E+ F S  G     FD  G+   +  K          + + P I   LF +    H 
Sbjct: 83  YNLENAFNS-FGRTATTFD-AGEWTLHTVKPGV-VNNAAGVPMAPHINISLFARGINIHL 139

Query: 64  NLFLAVFEEIKAEYTIHFNTVEKEKQKDKTEIADGPIVERKCKRCNNDTMSYATLQLRSA 123
           +  L   +E +A        + ++ Q+ +T IA         KRC  D  +     +R  
Sbjct: 140 HTRLYFDDEAQANAKCPVLNLIEQPQRRETLIA---------KRCEVDGKTAYRFDIRIQ 190

Query: 124 DEGQTIFF 131
            EG+T+FF
Sbjct: 191 GEGETVFF 198


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.425 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,069,961
Number of Sequences: 62578
Number of extensions: 156523
Number of successful extensions: 253
Number of sequences better than 100.0: 15
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 242
Number of HSP's gapped (non-prelim): 15
length of query: 136
length of database: 14,973,337
effective HSP length: 88
effective length of query: 48
effective length of database: 9,466,473
effective search space: 454390704
effective search space used: 454390704
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)