Diaphorina citri psyllid: psy4761


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MVYQPPEKFQVVSVGLYFRWKGSHLRELFHPTTVPIPSVYFPWYISLLNGLPDPNSLCGQVSGGQQRRISVAVTMMHSPLLLILDEPTAGLDPLISDTIWQHLRTLSATGVTCIITTHYIEEARHAHKVPI
ccccccccccHHHHccccCCccHHHHHHHcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHcccccc
MVYQPPEKFQVVSVGLYFRWKGSHLRELFHPTTVPIPSVYFPWYISLLNGLPDPNSLCGQVSGGQQRRISVAVTMMHSPLLLILDEPTAGLDPLISDTIWQHLRTLSATGVTCIITTHYIEEARHAHKVPI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYQPPEKFQVVSVGLYFRWKGSHLRELFHPTTVPIPSVYFPWYISLLNGLPDPNSLCGQVSGGQQRRISVAVTMMHSPLLLILDEPTAGLDPLISDTIWQHLRTLSATGVTCIITTHYIEEARHAHKVPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter G family member 20 confidentQ8T674

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0022892 [MF]substrate-specific transporter activityprobableGO:0005215, GO:0003674
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 54-130
View the alignment between query and template
View the model in PyMOL
Template: 4HLU, chain A
Confidence level:probable
Coverage over the Query: 29-121
View the alignment between query and template
View the model in PyMOL