Query         psy4796
Match_columns 274
No_of_seqs    173 out of 2166
Neff          10.9
Searched_HMMs 46136
Date          Fri Aug 16 17:51:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4796.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4796hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 3.1E-30 6.8E-35  193.6   4.2  133   91-269   129-264 (279)
  2 KOG2462|consensus               99.9 3.6E-28 7.7E-33  182.6   6.6  136   61-242   127-265 (279)
  3 KOG1074|consensus               99.9 3.3E-28 7.3E-33  206.3   5.1  169   93-273   606-932 (958)
  4 KOG3608|consensus               99.9 3.8E-26 8.2E-31  176.3   8.7  229   26-273   132-377 (467)
  5 KOG3623|consensus               99.9 3.8E-26 8.2E-31  191.1   6.1   81  189-269   891-971 (1007)
  6 KOG3608|consensus               99.9 1.5E-24 3.1E-29  167.6   8.3  191   65-272   135-345 (467)
  7 KOG1074|consensus               99.9   2E-22 4.3E-27  171.6   5.5  219   21-248   598-935 (958)
  8 KOG3623|consensus               99.8   3E-21 6.6E-26  162.0   2.6   80  157-242   893-972 (1007)
  9 KOG3576|consensus               99.8 2.9E-19 6.3E-24  128.2   5.2  113   25-145   114-237 (267)
 10 KOG3576|consensus               99.7 3.8E-19 8.3E-24  127.6   2.5  114  154-273   113-237 (267)
 11 PHA00733 hypothetical protein   99.4 3.1E-13 6.7E-18   93.9   4.4  100  167-273    20-124 (128)
 12 PLN03086 PRLI-interacting fact  99.4 3.9E-12 8.4E-17  108.1   9.7  146   93-273   408-565 (567)
 13 PLN03086 PRLI-interacting fact  99.3 1.2E-11 2.6E-16  105.1  11.0  148   24-213   403-561 (567)
 14 PHA02768 hypothetical protein;  99.1 2.7E-11 5.9E-16   69.2   1.9   42  221-264     6-47  (55)
 15 KOG3993|consensus               99.1 8.3E-12 1.8E-16   99.8  -0.5  111   27-145   266-381 (500)
 16 KOG3993|consensus               99.1   4E-11 8.6E-16   96.0   1.9   26   92-117   356-381 (500)
 17 PHA00733 hypothetical protein   99.1 2.3E-10 4.9E-15   79.6   5.4   83   59-143    35-122 (128)
 18 PHA02768 hypothetical protein;  98.9 5.7E-10 1.2E-14   63.8   2.4   43  192-236     5-47  (55)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.6E-09 3.4E-14   53.0   2.3   25  235-259     1-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.7 1.1E-08 2.4E-13   50.0   2.1   26  207-232     1-26  (26)
 21 PHA00616 hypothetical protein   98.6 9.7E-09 2.1E-13   55.8   1.1   33  220-252     1-33  (44)
 22 PF05605 zf-Di19:  Drought indu  98.6   1E-07 2.2E-12   55.8   3.8   51  220-273     2-54  (54)
 23 PHA00616 hypothetical protein   98.5 3.4E-08 7.3E-13   53.7   1.0   27  248-274     1-27  (44)
 24 PHA00732 hypothetical protein   98.5 7.8E-08 1.7E-12   60.6   2.6   48  192-245     1-49  (79)
 25 PHA00732 hypothetical protein   98.4 2.8E-07   6E-12   58.1   3.6   45  220-270     1-46  (79)
 26 PF05605 zf-Di19:  Drought indu  98.2 4.6E-06   1E-10   48.8   4.7   50  192-244     2-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.1 1.5E-06 3.3E-11   41.1   1.7   22  249-270     1-22  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.1   2E-06 4.3E-11   41.2   2.0   24  249-272     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  98.1 2.1E-06 4.5E-11   40.6   1.4   23  221-243     1-23  (23)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.9 6.6E-06 1.4E-10   40.6   1.7   25  248-272     1-25  (27)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.2E-05 2.7E-10   53.9   2.4   23  248-270    50-72  (100)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.7E-05 3.7E-10   37.8   1.8   23  221-243     1-23  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.8E-05 3.8E-10   39.0   1.5   25  220-244     1-25  (27)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.7 2.3E-05 4.9E-10   52.5   2.3   73   30-115     1-73  (100)
 35 COG5189 SFP1 Putative transcri  97.7 1.6E-05 3.5E-10   62.1   1.2   53  218-270   347-420 (423)
 36 PF13909 zf-H2C2_5:  C2H2-type   97.6   5E-05 1.1E-09   36.2   1.9   24  249-273     1-24  (24)
 37 COG5189 SFP1 Putative transcri  97.6 2.2E-05 4.7E-10   61.4   0.7   24   62-85    347-372 (423)
 38 smart00355 ZnF_C2H2 zinc finge  97.2 0.00031 6.6E-09   33.9   2.1   20  250-269     2-21  (26)
 39 PF09237 GAGA:  GAGA factor;  I  97.2 0.00033 7.1E-09   39.1   2.3   28  218-245    22-49  (54)
 40 smart00355 ZnF_C2H2 zinc finge  97.2 0.00032 6.8E-09   33.8   1.9   23  221-243     1-23  (26)
 41 PRK04860 hypothetical protein;  97.1 0.00046   1E-08   50.0   2.7   37  220-260   119-155 (160)
 42 KOG2231|consensus               97.0  0.0021 4.6E-08   56.5   7.0   48  193-244   183-236 (669)
 43 KOG1146|consensus               97.0 0.00062 1.3E-08   63.4   3.9  108   29-143   437-612 (1406)
 44 PF09237 GAGA:  GAGA factor;  I  97.0 0.00051 1.1E-08   38.3   2.0   37  237-273    12-49  (54)
 45 PF12874 zf-met:  Zinc-finger o  96.9 0.00044 9.5E-09   33.2   1.2   18  223-240     3-20  (25)
 46 PF12874 zf-met:  Zinc-finger o  96.9 0.00061 1.3E-08   32.7   1.6   23  249-271     1-23  (25)
 47 PF13909 zf-H2C2_5:  C2H2-type   96.6  0.0011 2.5E-08   31.4   1.2   23  221-244     1-23  (24)
 48 KOG2785|consensus               96.5    0.01 2.2E-07   48.3   6.9   51  192-242   166-242 (390)
 49 PRK04860 hypothetical protein;  96.5  0.0014   3E-08   47.6   1.5   40  191-234   118-157 (160)
 50 KOG2785|consensus               96.5  0.0085 1.8E-07   48.7   5.9   52  219-270   165-242 (390)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3  0.0012 2.6E-08   32.3   0.2   21  249-269     2-22  (27)
 52 COG5236 Uncharacterized conser  96.3   0.008 1.7E-07   48.1   4.7   72  194-273   222-306 (493)
 53 PF12171 zf-C2H2_jaz:  Zinc-fin  95.9  0.0033 7.1E-08   30.7   0.8   21  193-213     2-22  (27)
 54 KOG2482|consensus               95.9   0.067 1.5E-06   42.9   8.3   78  121-215   280-357 (423)
 55 PF13913 zf-C2HC_2:  zinc-finge  95.9  0.0049 1.1E-07   29.5   1.3   20   29-50      3-22  (25)
 56 PF13913 zf-C2HC_2:  zinc-finge  95.6    0.01 2.3E-07   28.3   1.7   19  250-269     4-22  (25)
 57 KOG1146|consensus               95.6   0.009   2E-07   56.1   2.7  168   67-243   439-641 (1406)
 58 KOG2231|consensus               95.4   0.027 5.9E-07   49.9   5.0   45   94-142   184-234 (669)
 59 KOG2482|consensus               95.4   0.021 4.7E-07   45.7   3.8   90   28-117   144-304 (423)
 60 PF12013 DUF3505:  Protein of u  95.2   0.036 7.8E-07   37.7   4.0   85  188-273     7-109 (109)
 61 KOG2893|consensus               95.1  0.0056 1.2E-07   46.3  -0.1   42   30-83     12-53  (341)
 62 cd00350 rubredoxin_like Rubred  94.9   0.018 3.8E-07   29.7   1.5   24  221-256     2-25  (33)
 63 COG5236 Uncharacterized conser  94.8   0.055 1.2E-06   43.5   4.5   19   31-50    223-241 (493)
 64 smart00451 ZnF_U1 U1-like zinc  94.4   0.037 7.9E-07   28.8   2.0   22  248-269     3-24  (35)
 65 smart00451 ZnF_U1 U1-like zinc  93.7   0.047   1E-06   28.3   1.6   23  220-242     3-25  (35)
 66 COG4049 Uncharacterized protei  93.6   0.028 6.1E-07   32.0   0.6   26  217-242    14-39  (65)
 67 COG5048 FOG: Zn-finger [Genera  93.0   0.029 6.3E-07   48.1   0.1  151   92-257   289-455 (467)
 68 TIGR00622 ssl1 transcription f  92.8    0.32   7E-06   32.8   4.8   54  194-255    57-110 (112)
 69 KOG2893|consensus               92.8   0.028   6E-07   42.7  -0.3   47  194-244    12-59  (341)
 70 cd00729 rubredoxin_SM Rubredox  92.2   0.093   2E-06   27.1   1.3   24  221-256     3-26  (34)
 71 COG5048 FOG: Zn-finger [Genera  92.1    0.14   3E-06   43.9   3.1  153   64-227   289-453 (467)
 72 PF09538 FYDLN_acid:  Protein o  91.5    0.12 2.6E-06   34.8   1.6   14  219-232    25-38  (108)
 73 KOG4173|consensus               91.1   0.075 1.6E-06   39.4   0.4   47  194-240   108-166 (253)
 74 TIGR00622 ssl1 transcription f  91.0    0.88 1.9E-05   30.7   5.3   50  159-216    56-105 (112)
 75 TIGR00373 conserved hypothetic  91.0    0.23 4.9E-06   36.2   2.8   36  216-260   105-140 (158)
 76 PHA00626 hypothetical protein   90.9    0.14 3.1E-06   29.3   1.3   17  189-205    20-36  (59)
 77 COG2888 Predicted Zn-ribbon RN  90.8    0.36 7.9E-06   28.1   2.8   33  191-228    26-58  (61)
 78 COG4049 Uncharacterized protei  90.7   0.097 2.1E-06   29.9   0.5   31  187-217    12-42  (65)
 79 PF10571 UPF0547:  Uncharacteri  90.3    0.21 4.5E-06   24.1   1.4   10  250-259    16-25  (26)
 80 PRK06266 transcription initiat  89.7     0.3 6.6E-06   36.3   2.6   35  217-260   114-148 (178)
 81 PF12013 DUF3505:  Protein of u  89.5    0.77 1.7E-05   31.1   4.3   25  221-245    81-109 (109)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  89.4    0.26 5.7E-06   26.1   1.6   11  248-258    25-35  (38)
 83 PF04959 ARS2:  Arsenite-resist  89.0    0.15 3.3E-06   38.9   0.6   28  247-274    76-103 (214)
 84 PF06524 NOA36:  NOA36 protein;  88.9     0.2 4.3E-06   38.8   1.1   97  114-243   136-232 (314)
 85 PF09986 DUF2225:  Uncharacteri  88.8    0.14   3E-06   39.4   0.2   24   26-50      3-26  (214)
 86 smart00531 TFIIE Transcription  88.7    0.47   1E-05   34.2   2.9   38  217-258    96-133 (147)
 87 PRK14890 putative Zn-ribbon RN  88.4    0.72 1.6E-05   27.0   2.9   11  191-201    24-34  (59)
 88 PF13719 zinc_ribbon_5:  zinc-r  88.1    0.42 9.2E-06   25.2   1.8   11  194-204     4-14  (37)
 89 KOG2186|consensus               87.7    0.32   7E-06   37.5   1.6   45   65-112     4-48  (276)
 90 PF02892 zf-BED:  BED zinc fing  87.6    0.43 9.2E-06   26.4   1.7   27  246-272    14-44  (45)
 91 PF13717 zinc_ribbon_4:  zinc-r  87.4    0.51 1.1E-05   24.7   1.8    6  222-227    27-32  (36)
 92 smart00659 RPOLCX RNA polymera  87.4    0.46   1E-05   26.2   1.7   11  193-203     3-13  (44)
 93 COG1592 Rubrerythrin [Energy p  87.4    0.36 7.9E-06   35.2   1.6   24  220-256   134-157 (166)
 94 PF09538 FYDLN_acid:  Protein o  87.1    0.34 7.5E-06   32.6   1.3   30  221-261    10-39  (108)
 95 KOG2186|consensus               86.9    0.34 7.5E-06   37.4   1.3   46  193-241     4-49  (276)
 96 KOG4173|consensus               86.6    0.31 6.6E-06   36.3   0.9   75   65-142    80-168 (253)
 97 smart00734 ZnF_Rad18 Rad18-lik  85.4    0.76 1.7E-05   22.1   1.7   19  250-269     3-21  (26)
 98 TIGR02300 FYDLN_acid conserved  85.1     0.6 1.3E-05   32.1   1.6   30  193-233    10-39  (129)
 99 PF02176 zf-TRAF:  TRAF-type zi  85.0    0.78 1.7E-05   27.1   2.0   47  219-267     8-60  (60)
100 TIGR02605 CxxC_CxxC_SSSS putat  84.9    0.28 6.1E-06   28.1   0.0   11  221-231     6-16  (52)
101 PRK00398 rpoP DNA-directed RNA  83.7    0.43 9.4E-06   26.6   0.4   11  221-231     4-14  (46)
102 PF03604 DNA_RNApol_7kD:  DNA d  83.2    0.86 1.9E-05   23.1   1.4    8  221-228    18-25  (32)
103 smart00614 ZnF_BED BED zinc fi  82.3     1.1 2.5E-05   25.4   1.8   24  249-272    19-47  (50)
104 PF09723 Zn-ribbon_8:  Zinc rib  82.0    0.54 1.2E-05   25.6   0.4   12  159-170     6-17  (42)
105 PF09986 DUF2225:  Uncharacteri  80.9    0.25 5.5E-06   38.0  -1.6   11  221-231    49-59  (214)
106 TIGR00373 conserved hypothetic  80.7     1.9 4.1E-05   31.5   2.9   34   88-130   105-138 (158)
107 PF05443 ROS_MUCR:  ROS/MUCR tr  80.6    0.88 1.9E-05   31.9   1.1   22  249-273    73-94  (132)
108 smart00834 CxxC_CXXC_SSSS Puta  79.5    0.84 1.8E-05   24.5   0.6   11  159-169     6-16  (41)
109 smart00531 TFIIE Transcription  79.5     3.7   8E-05   29.5   4.1   38   89-130    96-133 (147)
110 COG1996 RPC10 DNA-directed RNA  79.1    0.98 2.1E-05   25.4   0.8   10  221-230     7-16  (49)
111 PRK04023 DNA polymerase II lar  78.4     3.2 6.9E-05   39.1   4.2   12  249-260   664-675 (1121)
112 COG5188 PRP9 Splicing factor 3  78.3     3.1 6.7E-05   34.0   3.6   28  241-268   367-395 (470)
113 TIGR02300 FYDLN_acid conserved  77.9     1.6 3.4E-05   30.1   1.6   31   65-106    10-40  (129)
114 PF02176 zf-TRAF:  TRAF-type zi  77.4     1.6 3.5E-05   25.7   1.5   10   41-50     22-31  (60)
115 COG1592 Rubrerythrin [Energy p  76.9     1.7 3.7E-05   31.8   1.7   23  192-227   134-156 (166)
116 PRK06266 transcription initiat  76.6     2.8 6.1E-05   31.2   2.9   34   89-131   114-147 (178)
117 PF04959 ARS2:  Arsenite-resist  75.6     3.1 6.8E-05   31.9   2.9   30  120-149    77-106 (214)
118 PRK00464 nrdR transcriptional   75.1     1.6 3.5E-05   31.5   1.2   12  193-204    29-40  (154)
119 PRK09678 DNA-binding transcrip  75.0    0.66 1.4E-05   28.6  -0.7   15  218-232    25-41  (72)
120 PF08274 PhnA_Zn_Ribbon:  PhnA   74.9     1.5 3.3E-05   21.9   0.7   11  246-256    17-27  (30)
121 PF13240 zinc_ribbon_2:  zinc-r  73.5       2 4.3E-05   19.9   0.9    6  251-256    16-21  (23)
122 PF02148 zf-UBP:  Zn-finger in   72.4     2.7 5.9E-05   25.2   1.6   49   25-74      8-59  (63)
123 PF14353 CpXC:  CpXC protein     72.1     4.6  0.0001   28.2   2.9   15  221-235    39-53  (128)
124 PF06524 NOA36:  NOA36 protein;  71.4     2.9 6.4E-05   32.6   1.9   22  118-139   207-228 (314)
125 COG2331 Uncharacterized protei  69.6       2 4.4E-05   26.5   0.6   10   29-38     13-22  (82)
126 KOG3408|consensus               68.5       6 0.00013   27.0   2.6   33   18-51     47-79  (129)
127 PRK14714 DNA polymerase II lar  67.5     7.8 0.00017   37.7   4.0   29  220-259   692-720 (1337)
128 PRK04023 DNA polymerase II lar  67.0     7.5 0.00016   36.8   3.8   10  193-202   664-673 (1121)
129 PF12907 zf-met2:  Zinc-binding  67.0       3 6.5E-05   22.4   0.8   25  249-273     2-29  (40)
130 PF15269 zf-C2H2_7:  Zinc-finge  66.6     3.8 8.3E-05   22.3   1.2   22  221-242    21-42  (54)
131 COG4530 Uncharacterized protei  66.6     3.4 7.3E-05   27.5   1.1   13  218-230    24-36  (129)
132 PF13878 zf-C2H2_3:  zinc-finge  66.3     5.6 0.00012   21.5   1.8   23  221-243    14-38  (41)
133 PF05443 ROS_MUCR:  ROS/MUCR tr  65.8     3.5 7.5E-05   29.0   1.2   25  220-247    72-96  (132)
134 COG4957 Predicted transcriptio  64.2     5.2 0.00011   27.8   1.8   20  221-243    77-96  (148)
135 PF08209 Sgf11:  Sgf11 (transcr  64.2     3.9 8.4E-05   20.9   0.9   22   28-51      4-25  (33)
136 KOG4602|consensus               63.0      12 0.00025   29.3   3.6   56   20-76    225-280 (318)
137 COG1997 RPL43A Ribosomal prote  62.6     6.5 0.00014   25.1   1.8   12  192-203    53-64  (89)
138 PF15135 UPF0515:  Uncharacteri  62.1     6.1 0.00013   30.7   2.0   14  191-204   154-167 (278)
139 PRK03824 hypA hydrogenase nick  62.0     3.1 6.6E-05   29.5   0.4   13   26-38     68-80  (135)
140 PRK00432 30S ribosomal protein  61.6     5.5 0.00012   22.6   1.3    9  221-229    38-46  (50)
141 PF12760 Zn_Tnp_IS1595:  Transp  61.4      12 0.00025   20.7   2.6   11  246-256    35-45  (46)
142 PF07754 DUF1610:  Domain of un  61.3     4.6 9.9E-05   19.0   0.8    7  249-255    17-23  (24)
143 PF08790 zf-LYAR:  LYAR-type C2  60.2     2.8 6.1E-05   20.5  -0.0   19   29-49      1-19  (28)
144 COG3091 SprT Zn-dependent meta  60.1     4.5 9.8E-05   28.9   0.9   33  220-257   117-149 (156)
145 PF08271 TF_Zn_Ribbon:  TFIIB z  60.0     6.3 0.00014   21.4   1.4    9   65-73     20-28  (43)
146 KOG2593|consensus               59.8     6.8 0.00015   33.2   2.0   41   59-102   123-163 (436)
147 PF14446 Prok-RING_1:  Prokaryo  59.5     7.5 0.00016   22.5   1.6   10  194-203     7-16  (54)
148 COG5151 SSL1 RNA polymerase II  58.4     4.2 9.2E-05   32.6   0.6   23  221-243   389-411 (421)
149 KOG1280|consensus               57.9       9 0.00019   31.4   2.3   41  216-256    75-117 (381)
150 smart00440 ZnF_C2C2 C2C2 Zinc   57.8     2.4 5.1E-05   22.8  -0.6   10  249-258    29-38  (40)
151 COG1198 PriA Primosomal protei  57.8     8.1 0.00018   35.7   2.3   11  218-228   473-483 (730)
152 cd00730 rubredoxin Rubredoxin;  56.6      10 0.00022   21.6   1.8    8  193-200    35-42  (50)
153 PF05191 ADK_lid:  Adenylate ki  56.3     5.4 0.00012   20.9   0.6   29   66-102     3-31  (36)
154 KOG2636|consensus               56.1      13 0.00028   31.7   3.0   23   62-84    399-422 (497)
155 TIGR00686 phnA alkylphosphonat  54.6     7.7 0.00017   25.9   1.3   11  249-259    20-30  (109)
156 PF13453 zf-TFIIB:  Transcripti  54.6     9.3  0.0002   20.5   1.4   20  247-266    18-37  (41)
157 PRK10220 hypothetical protein;  54.5     9.1  0.0002   25.6   1.6   11  249-259    21-31  (111)
158 COG1198 PriA Primosomal protei  54.3     4.9 0.00011   37.0   0.4   15  243-257   470-484 (730)
159 PF09845 DUF2072:  Zn-ribbon co  53.9      11 0.00023   26.3   1.9   11  121-131     2-12  (131)
160 COG4888 Uncharacterized Zn rib  53.2     4.6  0.0001   26.5   0.1   12  190-201    20-31  (104)
161 KOG2593|consensus               52.9      15 0.00033   31.2   3.0   41   87-130   123-163 (436)
162 PRK00464 nrdR transcriptional   52.6     7.5 0.00016   28.2   1.1   15   65-79     29-43  (154)
163 KOG2071|consensus               52.3      12 0.00025   33.2   2.3   17  118-134   511-527 (579)
164 TIGR01206 lysW lysine biosynth  51.7      11 0.00025   21.8   1.5   10  193-202    23-32  (54)
165 KOG4124|consensus               50.2     2.7 5.9E-05   34.3  -1.6   50  219-268   348-418 (442)
166 KOG2807|consensus               50.2      29 0.00063   28.4   4.0   20  249-268   346-365 (378)
167 KOG3507|consensus               50.1      25 0.00053   20.6   2.6   15   24-38     16-30  (62)
168 PF01927 Mut7-C:  Mut7-C RNAse   49.5      11 0.00024   27.1   1.6   16  220-235   124-139 (147)
169 KOG2807|consensus               49.2      28  0.0006   28.5   3.8   20  121-140   346-365 (378)
170 PTZ00255 60S ribosomal protein  48.6      23  0.0005   23.0   2.7   12  192-203    54-65  (90)
171 PF05290 Baculo_IE-1:  Baculovi  47.7      21 0.00046   25.0   2.5   13  250-262   123-135 (140)
172 PRK12380 hydrogenase nickel in  47.4     9.7 0.00021   26.0   0.9   11  193-203    71-81  (113)
173 smart00661 RPOL9 RNA polymeras  47.3      17 0.00038   20.4   1.9   12  192-203    20-31  (52)
174 PF00301 Rubredoxin:  Rubredoxi  46.9      11 0.00024   21.1   0.9    8  193-200    35-42  (47)
175 COG3364 Zn-ribbon containing p  46.8      14 0.00031   24.3   1.6   13  158-170     2-14  (112)
176 PF13248 zf-ribbon_3:  zinc-rib  46.4      13 0.00028   17.7   1.0    7  222-228     4-10  (26)
177 KOG1280|consensus               46.3      21 0.00045   29.4   2.7   42  187-228    74-117 (381)
178 TIGR00100 hypA hydrogenase nic  46.0      10 0.00022   25.9   0.9   13  192-204    70-82  (115)
179 TIGR00280 L37a ribosomal prote  45.7      22 0.00048   23.1   2.3   12  192-203    53-64  (91)
180 KOG2907|consensus               45.1      11 0.00025   25.3   0.9   11  221-231   103-113 (116)
181 KOG2272|consensus               45.1      16 0.00035   28.5   1.9   20   91-110    98-117 (332)
182 PF14311 DUF4379:  Domain of un  45.0      14  0.0003   21.3   1.2   12  193-204    29-40  (55)
183 KOG4167|consensus               44.8      15 0.00033   33.5   1.9   27   23-50    787-813 (907)
184 COG5151 SSL1 RNA polymerase II  44.6      39 0.00084   27.4   3.9   50  159-216   363-412 (421)
185 KOG3408|consensus               44.3      14  0.0003   25.3   1.3   27  188-214    53-79  (129)
186 PF14369 zf-RING_3:  zinc-finge  44.1      19  0.0004   18.7   1.5   10   65-74      3-12  (35)
187 PF01363 FYVE:  FYVE zinc finge  44.1      13 0.00028   22.6   1.0   11  193-203    10-20  (69)
188 PF01780 Ribosomal_L37ae:  Ribo  43.8     8.2 0.00018   25.0   0.1   11  193-203    54-64  (90)
189 KOG1701|consensus               43.6     4.8  0.0001   33.9  -1.2   43   66-108   276-318 (468)
190 COG0068 HypF Hydrogenase matur  43.4     2.7 5.8E-05   37.9  -2.8   88   22-130    95-183 (750)
191 COG3357 Predicted transcriptio  43.3      43 0.00092   21.7   3.2   13  192-204    58-70  (97)
192 KOG4167|consensus               43.0       6 0.00013   35.8  -0.8   26  191-216   791-816 (907)
193 KOG3002|consensus               42.8      43 0.00094   27.4   4.1   79  190-273    78-164 (299)
194 COG0068 HypF Hydrogenase matur  42.3       4 8.7E-05   36.9  -1.9   58   94-167   125-182 (750)
195 PF05495 zf-CHY:  CHY zinc fing  42.0     9.2  0.0002   23.6   0.1   13   92-104    41-53  (71)
196 PF04780 DUF629:  Protein of un  41.5      18 0.00039   31.4   1.9   21  221-241    58-78  (466)
197 PRK00564 hypA hydrogenase nick  40.7      14  0.0003   25.4   0.9   12  192-203    71-82  (117)
198 COG1655 Uncharacterized protei  40.5     8.2 0.00018   29.7  -0.3   24   26-50     17-40  (267)
199 PRK04351 hypothetical protein;  40.2      18 0.00038   26.1   1.4   30  221-258   113-142 (149)
200 CHL00174 accD acetyl-CoA carbo  40.2      35 0.00075   27.8   3.1   40   28-84     38-77  (296)
201 cd00065 FYVE FYVE domain; Zinc  39.8      21 0.00045   20.6   1.4   11  194-204     4-14  (57)
202 COG1656 Uncharacterized conser  39.7      20 0.00044   26.2   1.6   14  221-234   131-144 (165)
203 PRK03976 rpl37ae 50S ribosomal  39.5      31 0.00068   22.4   2.3   12  192-203    54-65  (90)
204 PRK03681 hypA hydrogenase nick  38.0      20 0.00043   24.5   1.3   12   64-75     70-81  (114)
205 PRK00420 hypothetical protein;  37.9      22 0.00049   24.2   1.5   27   66-103    25-51  (112)
206 KOG2636|consensus               37.9      25 0.00053   30.1   2.0   31  212-242   393-424 (497)
207 PF14803 Nudix_N_2:  Nudix N-te  37.7      14 0.00031   19.0   0.4   14  188-201    18-31  (34)
208 PF07282 OrfB_Zn_ribbon:  Putat  37.6      48   0.001   20.0   2.9   11  120-130    46-56  (69)
209 PF01096 TFIIS_C:  Transcriptio  37.6     4.5 9.8E-05   21.6  -1.5   10   65-74     29-38  (39)
210 PF03833 PolC_DP2:  DNA polymer  37.4      11 0.00024   35.0   0.0   12  220-231   680-691 (900)
211 PF06220 zf-U1:  U1 zinc finger  37.1      33 0.00072   18.1   1.8   11  192-202     3-13  (38)
212 PF12773 DZR:  Double zinc ribb  37.0      43 0.00093   18.6   2.4   10  194-203    14-23  (50)
213 PF03145 Sina:  Seven in absent  36.9      31 0.00068   26.1   2.4   52  192-246    14-73  (198)
214 PF07503 zf-HYPF:  HypF finger;  36.8     3.9 8.5E-05   21.2  -1.7    9   66-74     23-31  (35)
215 PF03811 Zn_Tnp_IS1:  InsA N-te  36.7      11 0.00023   19.8  -0.1   11  244-254    25-35  (36)
216 PRK03564 formate dehydrogenase  36.4      29 0.00064   28.4   2.2   75  158-260   187-264 (309)
217 COG5112 UFD2 U1-like Zn-finger  36.4      26 0.00056   23.3   1.6   32   18-50     45-76  (126)
218 COG1594 RPB9 DNA-directed RNA   36.4     7.1 0.00015   26.7  -1.1   11  221-231   101-111 (113)
219 smart00154 ZnF_AN1 AN1-like Zi  36.3      21 0.00045   19.0   1.0   14  248-261    12-25  (39)
220 PF13824 zf-Mss51:  Zinc-finger  36.2      32 0.00069   20.0   1.7   10   92-101    14-23  (55)
221 PF10263 SprT-like:  SprT-like   36.0      11 0.00025   27.2  -0.1    8  249-256   144-151 (157)
222 PF01155 HypA:  Hydrogenase exp  35.8      14 0.00029   25.3   0.2   14  192-205    70-83  (113)
223 COG1998 RPS31 Ribosomal protei  35.7      24 0.00051   19.9   1.1   10   64-73     37-46  (51)
224 TIGR00244 transcriptional regu  35.7     6.3 0.00014   28.1  -1.4   19   92-110    28-46  (147)
225 PF09788 Tmemb_55A:  Transmembr  35.4      46 0.00099   26.3   3.0   35   25-75     62-96  (256)
226 KOG0717|consensus               34.4      23 0.00049   30.6   1.3   21   29-50    293-313 (508)
227 PRK14559 putative protein seri  34.3      57  0.0012   30.0   3.9    7  122-128     3-9   (645)
228 COG3677 Transposase and inacti  34.0      49  0.0011   23.2   2.8   15  190-204    51-65  (129)
229 TIGR00595 priA primosomal prot  33.8      42 0.00091   29.8   3.0   28  186-228   234-261 (505)
230 KOG0978|consensus               33.4      14  0.0003   33.7  -0.0   11   28-38    643-653 (698)
231 PF08792 A2L_zn_ribbon:  A2L zi  33.2      28  0.0006   17.8   1.1   13   62-74     19-31  (33)
232 PF13451 zf-trcl:  Probable zin  33.0      21 0.00046   20.2   0.7   12   27-38      3-14  (49)
233 PF10013 DUF2256:  Uncharacteri  32.7      31 0.00068   18.7   1.3   17  193-209     9-25  (42)
234 COG1327 Predicted transcriptio  32.3      12 0.00025   26.8  -0.5   16   93-108    29-44  (156)
235 PRK14873 primosome assembly pr  32.3      37 0.00081   31.3   2.4    9  160-168   385-393 (665)
236 PF07800 DUF1644:  Protein of u  32.0      65  0.0014   23.4   3.1   57  191-248    79-137 (162)
237 COG1675 TFA1 Transcription ini  31.9      57  0.0012   24.3   2.9   35   87-130   108-142 (176)
238 PRK12496 hypothetical protein;  31.7      29 0.00063   25.5   1.4   11  221-231   128-138 (164)
239 PF07975 C1_4:  TFIIH C1-like d  31.1      28  0.0006   19.9   1.0   23   27-50     20-42  (51)
240 COG4896 Uncharacterized protei  30.9      30 0.00064   20.5   1.0   37  194-230     4-41  (68)
241 PF05741 zf-nanos:  Nanos RNA b  30.9      17 0.00038   21.1   0.1   11   64-74     33-43  (55)
242 PF01428 zf-AN1:  AN1-like Zinc  30.9      19 0.00042   19.5   0.3   15  247-261    12-26  (43)
243 PF04423 Rad50_zn_hook:  Rad50   30.3      19 0.00041   20.7   0.2   11  250-260    22-32  (54)
244 KOG4727|consensus               30.3      37 0.00081   24.8   1.7   27  187-213    70-96  (193)
245 PF11781 RRN7:  RNA polymerase   30.1      33 0.00071   17.9   1.1   12  189-200    22-33  (36)
246 PF04810 zf-Sec23_Sec24:  Sec23  29.7      39 0.00085   18.0   1.4   13  189-201    21-33  (40)
247 COG1571 Predicted DNA-binding   29.4      37 0.00081   29.1   1.8   11  221-231   368-378 (421)
248 COG1773 Rubredoxin [Energy pro  29.2      25 0.00053   20.5   0.5   10   29-38      4-13  (55)
249 PF05129 Elf1:  Transcription e  28.9      11 0.00023   24.0  -1.1   14   64-77     46-59  (81)
250 PF11931 DUF3449:  Domain of un  28.9      19  0.0004   27.3   0.0   20   29-49    102-122 (196)
251 PF14205 Cys_rich_KTR:  Cystein  28.1      19 0.00041   20.8  -0.0   10  219-228    27-36  (55)
252 PF14690 zf-ISL3:  zinc-finger   27.9      10 0.00023   20.8  -1.2   10   28-37      2-11  (47)
253 PF10276 zf-CHCC:  Zinc-finger   27.7      22 0.00048   19.1   0.2   11  248-258    29-39  (40)
254 PF09963 DUF2197:  Uncharacteri  27.4      15 0.00033   21.4  -0.5    7  221-227    32-38  (56)
255 PF07295 DUF1451:  Protein of u  27.4      30 0.00064   24.9   0.8    9  221-229   113-121 (146)
256 smart00731 SprT SprT homologue  27.3      41 0.00089   24.1   1.5   33  192-231   112-144 (146)
257 KOG4727|consensus               27.2      35 0.00075   25.0   1.1   22  247-268    74-95  (193)
258 smart00064 FYVE Protein presen  27.1      55  0.0012   19.6   1.9   10  160-169    12-21  (68)
259 TIGR03830 CxxCG_CxxCG_HTH puta  26.7      37 0.00081   23.3   1.2   14   65-78     32-45  (127)
260 PF04216 FdhE:  Protein involve  26.6     8.9 0.00019   31.1  -2.2   56  189-259   194-249 (290)
261 PF04780 DUF629:  Protein of un  26.5      90  0.0019   27.3   3.6   31  187-217    52-83  (466)
262 cd00924 Cyt_c_Oxidase_Vb Cytoc  26.4      34 0.00075   22.6   0.9   16  217-232    76-91  (97)
263 KOG4377|consensus               26.3      44 0.00095   28.4   1.7   23  249-271   402-426 (480)
264 TIGR01562 FdhE formate dehydro  26.3      64  0.0014   26.5   2.6   54  188-260   206-264 (305)
265 PF10083 DUF2321:  Uncharacteri  26.0      57  0.0012   23.6   2.0   19  189-207    65-83  (158)
266 TIGR01384 TFS_arch transcripti  25.9      47   0.001   22.1   1.6   27  194-232     2-28  (104)
267 PRK00762 hypA hydrogenase nick  25.7      33 0.00071   23.9   0.8   10   28-38     70-79  (124)
268 KOG2906|consensus               25.5       5 0.00011   26.2  -3.0   12  120-131    21-32  (105)
269 KOG0717|consensus               25.4      42  0.0009   29.0   1.4   21  249-269   293-313 (508)
270 PRK05452 anaerobic nitric oxid  25.1      60  0.0013   28.7   2.4   17   22-38    419-435 (479)
271 COG5188 PRP9 Splicing factor 3  25.1      81  0.0017   26.2   2.9   27   59-85    369-396 (470)
272 PLN02294 cytochrome c oxidase   24.9      38 0.00083   24.9   1.0   18  216-233   137-154 (174)
273 TIGR00515 accD acetyl-CoA carb  24.7      78  0.0017   25.7   2.8   41   28-85     26-66  (285)
274 KOG1842|consensus               24.5      48   0.001   28.5   1.6   30   23-53     10-39  (505)
275 KOG4118|consensus               24.5      33 0.00072   20.5   0.5   25  249-273    39-63  (74)
276 KOG2071|consensus               24.4      48   0.001   29.6   1.7   27  218-244   416-442 (579)
277 PHA02998 RNA polymerase subuni  23.8      25 0.00053   26.0  -0.1   11  221-231   172-182 (195)
278 PRK05654 acetyl-CoA carboxylas  23.8      79  0.0017   25.8   2.7   41   28-85     27-67  (292)
279 PF04606 Ogr_Delta:  Ogr/Delta-  23.3      27 0.00058   19.4  -0.0    8   31-38      2-9   (47)
280 PF09416 UPF1_Zn_bind:  RNA hel  23.1      52  0.0011   23.8   1.4   14   25-38     11-24  (152)
281 PF06397 Desulfoferrod_N:  Desu  22.9      41 0.00089   17.6   0.6   10  248-257     6-15  (36)
282 KOG1994|consensus               22.4      42  0.0009   25.9   0.8   23  190-212   237-259 (268)
283 COG1439 Predicted nucleic acid  21.7      38 0.00083   25.1   0.5   11   28-38    139-149 (177)
284 PRK05580 primosome assembly pr  21.5      51  0.0011   30.6   1.3    7   94-100   423-429 (679)
285 KOG3214|consensus               20.7      46 0.00099   21.9   0.6   13   65-77     48-60  (109)
286 KOG2747|consensus               20.6      53  0.0012   27.9   1.2   29   24-53    154-182 (396)
287 PF13696 zf-CCHC_2:  Zinc knuck  20.6      89  0.0019   15.9   1.5   12   26-37      6-17  (32)
288 PRK05978 hypothetical protein;  20.6      39 0.00084   24.4   0.3   11   66-76     54-64  (148)
289 PTZ00448 hypothetical protein;  20.1      69  0.0015   26.9   1.7   23  248-270   314-336 (373)

No 1  
>KOG2462|consensus
Probab=99.96  E-value=3.1e-30  Score=193.59  Aligned_cols=133  Identities=29%  Similarity=0.573  Sum_probs=117.0

Q ss_pred             CcccCCCCCcccCChhHHHHHHhhhcC---CCCccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCC
Q psy4796          91 KPYKCPHCDHCFTQKVVLQRHLLTHTG---EKPFACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEP  167 (274)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~  167 (274)
                      ..|+|..|++.|.+..+|.+|.++|..   .+.+.|+.|++.|.+-..|+.|+++                         
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-------------------------  183 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-------------------------  183 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhc-------------------------
Confidence            458899999999999999999888744   4567888888888877777777665                         


Q ss_pred             CCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHhhhCCCC
Q psy4796         168 ISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLRIHKTER  247 (274)
Q Consensus       168 ~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  247 (274)
                                         |+  -+.+|.+||+.|...+.|+.|+++|+|||||.|+.|++.|.++++|+.||++|.+.|
T Consensus       184 -------------------H~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K  242 (279)
T KOG2462|consen  184 -------------------HT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVK  242 (279)
T ss_pred             -------------------cC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCc
Confidence                               22  347899999999999999999999999999999999999999999999999999999


Q ss_pred             ceecCCCCccCCChhHHHHHHh
Q psy4796         248 EYACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       248 ~~~C~~C~~~f~~~~~l~~H~~  269 (274)
                      +|+|+.|+|+|..++.|.+|..
T Consensus       243 ~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  243 KHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cccCcchhhHHHHHHHHHHhhh
Confidence            9999999999999999999975


No 2  
>KOG2462|consensus
Probab=99.95  E-value=3.6e-28  Score=182.56  Aligned_cols=136  Identities=25%  Similarity=0.480  Sum_probs=123.8

Q ss_pred             CCcceecccccccccChHHHHHHHhhcCC---CCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCccccHHHHH
Q psy4796          61 AKLQFLCLFCSYVATARIAIKNHLSSHLG---WKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRASRKYYIT  137 (274)
Q Consensus        61 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  137 (274)
                      ....|+|+.||+.+.+..+|.+|...|-.   .+.+.|+.|+++|.+...|+.|+++|.  -+++|.+||+.|...+.|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhh
Confidence            34468999999999999999999998853   467999999999999999999999997  6799999999999999988


Q ss_pred             HHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccC
Q psy4796         138 AHLNSLLSALLLQHFLASQPRRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTG  217 (274)
Q Consensus       138 ~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  217 (274)
                      -|+                                            ++|++++||.|+.|++.|.++++|+.|+++|.+
T Consensus       205 GHi--------------------------------------------RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  205 GHI--------------------------------------------RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             ccc--------------------------------------------ccccCCCCccCCcccchhcchHHHHHHHHhhcC
Confidence            884                                            457899999999999999999999999999999


Q ss_pred             CCCcccCcCccccCCchhHHHHHhh
Q psy4796         218 DKPFACSYCDYTCNQSSNLQTHLRI  242 (274)
Q Consensus       218 ~~~~~C~~C~~~f~~~~~l~~H~~~  242 (274)
                      .|+|+|..|+++|...+.|.+|...
T Consensus       241 ~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  241 VKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             CccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999765


No 3  
>KOG1074|consensus
Probab=99.94  E-value=3.3e-28  Score=206.25  Aligned_cols=169  Identities=21%  Similarity=0.401  Sum_probs=139.3

Q ss_pred             ccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCC---CCCCCCC
Q psy4796          93 YKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCV---HCSEPIS  169 (274)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~---~c~~~~~  169 (274)
                      -.|-+|.++......|+-|.++|++++||+|.+|++.|.++.+|+.|+-.|...    +  ....+++|+   +|-+.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~----p--~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAK----P--PARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccC----c--cccccccCCchhhhccccc
Confidence            689999999999999999999999999999999999999999999999773210    1  222568898   8999998


Q ss_pred             CChhhhhhhccCCCCCcccC-------------CCccccCCCCccccCHHHHHHHHhhccCC------------------
Q psy4796         170 SDMSEIIEHCLVCPNATRTD-------------KKKFVCFACPYATQYACYIKTHVMTHTGD------------------  218 (274)
Q Consensus       170 ~~~~~l~~h~~~~~~~~~~~-------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~------------------  218 (274)
                      . .-.|-.|     ...|.+             ...-.|..|.+.|.....+..++..|.+.                  
T Consensus       680 n-~V~lpQh-----IriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~  753 (958)
T KOG1074|consen  680 N-AVTLPQH-----IRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELD  753 (958)
T ss_pred             c-cccccce-----EEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccc
Confidence            8 6666666     444331             11246888888888887777777776210                  


Q ss_pred             --------------------------------------------------------------------------------
Q psy4796         219 --------------------------------------------------------------------------------  218 (274)
Q Consensus       219 --------------------------------------------------------------------------------  218 (274)
                                                                                                      
T Consensus       754 ~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~  833 (958)
T KOG1074|consen  754 VTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQE  833 (958)
T ss_pred             cCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccc
Confidence                                                                                            


Q ss_pred             --------------------------------------------CCcccCcCccccCCchhHHHHHhhhCCCCceecCCC
Q psy4796         219 --------------------------------------------KPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKC  254 (274)
Q Consensus       219 --------------------------------------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C  254 (274)
                                                                  ....|.+||+.|...++|..|+++|+++|||.|.+|
T Consensus       834 ~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC  913 (958)
T KOG1074|consen  834 TSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFC  913 (958)
T ss_pred             ccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhh
Confidence                                                        116799999999999999999999999999999999


Q ss_pred             CccCCChhHHHHHHhhhcC
Q psy4796         255 AYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       255 ~~~f~~~~~l~~H~~~~H~  273 (274)
                      ++.|..+.+|+.|+..|+.
T Consensus       914 ~~aFttrgnLKvHMgtH~w  932 (958)
T KOG1074|consen  914 EEAFTTRGNLKVHMGTHMW  932 (958)
T ss_pred             hhhhhhhhhhhhhhccccc
Confidence            9999999999999998874


No 4  
>KOG3608|consensus
Probab=99.93  E-value=3.8e-26  Score=176.31  Aligned_cols=229  Identities=22%  Similarity=0.395  Sum_probs=193.9

Q ss_pred             CCCeeecc--ccCCcchhhHHHHHhhhcc----ccccccccC-Cc-ceeccc--ccccccChHHHHHHHhhcCCCCcccC
Q psy4796          26 PADVTCLH--CSLTTPCVMKDMIRHGRLC----EFNSVVTSA-KL-QFLCLF--CSYVATARIAIKNHLSSHLGWKPYKC   95 (274)
Q Consensus        26 ~~~~~C~~--C~~~f~~~~~~l~~H~~~~----~~~~~~h~~-~~-~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C   95 (274)
                      +..|.|..  |+..| .++..|..|+..+    +-+.....+ ++ .+.|.+  |-+.+.++..|++|++.|++++...|
T Consensus       132 g~~f~C~WedCe~~F-~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvAC  210 (467)
T KOG3608|consen  132 GQNFRCGWEDCEREF-VSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVAC  210 (467)
T ss_pred             hhhhccChhhcCCcc-cCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEec
Confidence            34478865  99999 9999999998622    111111111 21 255666  88999999999999999999999999


Q ss_pred             CCCCcccCChhHHHHHHhh--hcCCCCccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCCChh
Q psy4796          96 PHCDHCFTQKVVLQRHLLT--HTGEKPFACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEPISSDMS  173 (274)
Q Consensus        96 ~~C~~~f~~~~~l~~H~~~--h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~  173 (274)
                      +.|+.-|.++..|..|.+.  -....+|.|..|.+.|.++..|..|+..|            ..-|+|+.|+.+.+. .+
T Consensus       211 p~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH------------vn~ykCplCdmtc~~-~s  277 (467)
T KOG3608|consen  211 PHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH------------VNCYKCPLCDMTCSS-AS  277 (467)
T ss_pred             chHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh------------hhcccccccccCCCC-hH
Confidence            9999999999999999864  34456899999999999999999998862            356999999999999 99


Q ss_pred             hhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCc--CccccCCchhHHHHHhhhC-CC--Cc
Q psy4796         174 EIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSY--CDYTCNQSSNLQTHLRIHK-TE--RE  248 (274)
Q Consensus       174 ~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~~--~~  248 (274)
                      +|..|+    +..|...++|+|..|.+.|...+.|.+|...|. +..|+|..  |...|.+..++++|++.++ +.  .+
T Consensus       278 sL~~H~----r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~  352 (467)
T KOG3608|consen  278 SLTTHI----RYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPIL  352 (467)
T ss_pred             HHHHHH----HhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCc
Confidence            999995    456778999999999999999999999999998 77799988  9999999999999998754 44  45


Q ss_pred             eecCCCCccCCChhHHHHHHhhhcC
Q psy4796         249 YACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      |.|-.|.+.|.+-.+|.+|+.+.|+
T Consensus       353 Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  353 YACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             eeeecchhhhccchhHHHHHHHhhc
Confidence            9999999999999999999998886


No 5  
>KOG3623|consensus
Probab=99.92  E-value=3.8e-26  Score=191.06  Aligned_cols=81  Identities=25%  Similarity=0.577  Sum_probs=77.5

Q ss_pred             CCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCCChhHHHHHH
Q psy4796         189 DKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTAALPDLKLHL  268 (274)
Q Consensus       189 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  268 (274)
                      ....|.|+.|++.|...+.|.+|.-.|+|.+||+|.+|.+.|.-+..|..|+|.|.|+|||+|..|+|.|....+...||
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            45579999999999999999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             h
Q psy4796         269 K  269 (274)
Q Consensus       269 ~  269 (274)
                      .
T Consensus       971 N  971 (1007)
T KOG3623|consen  971 N  971 (1007)
T ss_pred             c
Confidence            3


No 6  
>KOG3608|consensus
Probab=99.91  E-value=1.5e-24  Score=167.61  Aligned_cols=191  Identities=25%  Similarity=0.515  Sum_probs=170.0

Q ss_pred             eeccc--ccccccChHHHHHHHhhcCC------------CC-cccCCC--CCcccCChhHHHHHHhhhcCCCCccCCCCC
Q psy4796          65 FLCLF--CSYVATARIAIKNHLSSHLG------------WK-PYKCPH--CDHCFTQKVVLQRHLLTHTGEKPFACHLCP  127 (274)
Q Consensus        65 ~~C~~--C~~~f~~~~~l~~H~~~h~~------------~~-~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  127 (274)
                      |.|.+  |+..|.+...+..|+..|.-            ++ -+.|.+  |-+.|.++..|+.|++.|.+++...|+.|+
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg  214 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCG  214 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHH
Confidence            55655  99999999999999887742            12 256776  999999999999999999999999999999


Q ss_pred             CccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHH
Q psy4796         128 YRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACY  207 (274)
Q Consensus       128 ~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~  207 (274)
                      .-|.++..|-+|++.        .......+|.|..|.+.|.. ...|..|     ...|.  +-|+|+.|..+....+.
T Consensus       215 ~~F~~~tkl~DH~rR--------qt~l~~n~fqC~~C~KrFaT-eklL~~H-----v~rHv--n~ykCplCdmtc~~~ss  278 (467)
T KOG3608|consen  215 ELFRTKTKLFDHLRR--------QTELNTNSFQCAQCFKRFAT-EKLLKSH-----VVRHV--NCYKCPLCDMTCSSASS  278 (467)
T ss_pred             HHhccccHHHHHHHh--------hhhhcCCchHHHHHHHHHhH-HHHHHHH-----HHHhh--hcccccccccCCCChHH
Confidence            999999999999987        44466779999999999999 8888888     44444  45999999999999999


Q ss_pred             HHHHHh-hccCCCCcccCcCccccCCchhHHHHHhhhCCCCceecCC--CCccCCChhHHHHHHhhhc
Q psy4796         208 IKTHVM-THTGDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGK--CAYRTAALPDLKLHLKNMH  272 (274)
Q Consensus       208 l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~H  272 (274)
                      |..|++ .|...|||.|..|++.|...++|.+|+.+|. +-.|.|..  |..+|..+..|.+|++.+|
T Consensus       279 L~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  279 LTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             HHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            999998 7889999999999999999999999999999 66799977  9999999999999999998


No 7  
>KOG1074|consensus
Probab=99.86  E-value=2e-22  Score=171.57  Aligned_cols=219  Identities=22%  Similarity=0.362  Sum_probs=157.7

Q ss_pred             CCCCCCCCeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHhhcCCC----CcccCC
Q psy4796          21 SPGPPPADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLSSHLGW----KPYKCP   96 (274)
Q Consensus        21 ~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----~~~~C~   96 (274)
                      .......+-+|.+|.++. .-+..|+.|++       .|+++++|+|.+||+.|.++.+|+.||..|...    .+|.|+
T Consensus       598 ~~~~~TdPNqCiiC~rVl-SC~saLqmHyr-------tHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP  669 (958)
T KOG1074|consen  598 SENKRTDPNQCIICLRVL-SCPSALQMHYR-------THTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCP  669 (958)
T ss_pred             cccccCCccceeeeeecc-cchhhhhhhhh-------cccCcCccccccccchhccccchhhcccccccCccccccccCC
Confidence            344555678999999999 99999999999       999999999999999999999999999988543    458999


Q ss_pred             ---CCCcccCChhHHHHHHhhhcCC-CC------------ccCCCCCCccccHHHHHHHHHHHHHHHHHHh---------
Q psy4796          97 ---HCDHCFTQKVVLQRHLLTHTGE-KP------------FACHLCPYRASRKYYITAHLNSLLSALLLQH---------  151 (274)
Q Consensus        97 ---~C~~~f~~~~~l~~H~~~h~~~-~~------------~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~---------  151 (274)
                         +|.+.|.....|..|++.|.+. .+            =.|..|.+.|.....+..++..+........         
T Consensus       670 ~~~ic~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t  749 (958)
T KOG1074|consen  670 STFICQKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTET  749 (958)
T ss_pred             chhhhcccccccccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccc
Confidence               9999999999999999999843 21            3588899988777777777655411000000         


Q ss_pred             -HhhcCCCccCCCCCCCCCCChhhhhhh----------------------------------------------------
Q psy4796         152 -FLASQPRRKCVHCSEPISSDMSEIIEH----------------------------------------------------  178 (274)
Q Consensus       152 -~~~~~~~~~c~~c~~~~~~~~~~l~~h----------------------------------------------------  178 (274)
                       ......+..+..|+..+.. ...+..+                                                    
T Consensus       750 ~~~~~tp~~~e~~~~~~~~~-e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pv  828 (958)
T KOG1074|consen  750 EELDVTPPPPENSCGRELEG-EMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPV  828 (958)
T ss_pred             cccccCCCccccccccccCc-ccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCch
Confidence             0000011122222222211 0000000                                                    


Q ss_pred             -------ccC-----------------------------C-CCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCc
Q psy4796         179 -------CLV-----------------------------C-PNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPF  221 (274)
Q Consensus       179 -------~~~-----------------------------~-~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  221 (274)
                             ++.                             + ....-...+...|..||+.|...+.|.+|+++|+++|||
T Consensus       829 l~~~~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF  908 (958)
T KOG1074|consen  829 LWNQETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPF  908 (958)
T ss_pred             hhcccccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCc
Confidence                   000                             0 000001123478999999999999999999999999999


Q ss_pred             ccCcCccccCCchhHHHHHhhhCCCCc
Q psy4796         222 ACSYCDYTCNQSSNLQTHLRIHKTERE  248 (274)
Q Consensus       222 ~C~~C~~~f~~~~~l~~H~~~h~~~~~  248 (274)
                      .|.+|++.|+.+.+|+.||..|....+
T Consensus       909 ~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  909 FCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             cchhhhhhhhhhhhhhhhhccccccCC
Confidence            999999999999999999999987654


No 8  
>KOG3623|consensus
Probab=99.82  E-value=3e-21  Score=162.01  Aligned_cols=80  Identities=21%  Similarity=0.494  Sum_probs=76.5

Q ss_pred             CCccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhH
Q psy4796         157 PRRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNL  236 (274)
Q Consensus       157 ~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  236 (274)
                      ..|.|+.|++.|.. .+.|.+|     .-.|++.+||.|.+|.++|..+..|..|.+.|.|+|||+|..|+++|+-...+
T Consensus       893 gmyaCDqCDK~FqK-qSSLaRH-----KYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSY  966 (1007)
T KOG3623|consen  893 GMYACDQCDKAFQK-QSSLARH-----KYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSY  966 (1007)
T ss_pred             ccchHHHHHHHHHh-hHHHHHh-----hhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccch
Confidence            45899999999999 9999999     99999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhh
Q psy4796         237 QTHLRI  242 (274)
Q Consensus       237 ~~H~~~  242 (274)
                      .+||..
T Consensus       967 SQHMNH  972 (1007)
T KOG3623|consen  967 SQHMNH  972 (1007)
T ss_pred             Hhhhcc
Confidence            999853


No 9  
>KOG3576|consensus
Probab=99.77  E-value=2.9e-19  Score=128.18  Aligned_cols=113  Identities=29%  Similarity=0.542  Sum_probs=103.1

Q ss_pred             CCCCeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHhhcCCCCcccCCCCCcccCC
Q psy4796          25 PPADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFTQ  104 (274)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  104 (274)
                      +...|.|.+|++.| ....-|.+|++       -|+.-+.+.|..||+.|.+..+|.+|+++|++.+||+|..|++.|+.
T Consensus       114 d~d~ftCrvCgK~F-~lQRmlnrh~k-------ch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKF-GLQRMLNRHLK-------CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             CCCeeeeehhhhhh-hHHHHHHHHhh-------hccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh
Confidence            34569999999999 99999999999       99999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhhhcC-----------CCCccCCCCCCccccHHHHHHHHHHHHH
Q psy4796         105 KVVLQRHLLTHTG-----------EKPFACHLCPYRASRKYYITAHLNSLLS  145 (274)
Q Consensus       105 ~~~l~~H~~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~~~~  145 (274)
                      .-.|..|.+.-++           .+.|.|+.||..-.....+..|++.++.
T Consensus       186 rcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  186 RCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             hccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            9999999875444           4669999999999999999999988654


No 10 
>KOG3576|consensus
Probab=99.75  E-value=3.8e-19  Score=127.56  Aligned_cols=114  Identities=28%  Similarity=0.527  Sum_probs=103.4

Q ss_pred             hcCCCccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCc
Q psy4796         154 ASQPRRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQS  233 (274)
Q Consensus       154 ~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  233 (274)
                      .+.-.+.|.+|++.|.- ..+|.+|     .+-|..-+.|.|..||+.|.+...|.+|+++|+|.+||.|..|++.|+.+
T Consensus       113 sd~d~ftCrvCgK~F~l-QRmlnrh-----~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqr  186 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGL-QRMLNRH-----LKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQR  186 (267)
T ss_pred             CCCCeeeeehhhhhhhH-HHHHHHH-----hhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhh
Confidence            34556889999999988 8999999     89999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHhh-hCC----------CCceecCCCCccCCChhHHHHHHhhhcC
Q psy4796         234 SNLQTHLRI-HKT----------EREYACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       234 ~~l~~H~~~-h~~----------~~~~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      -.|..|++. |..          .+.|+|..||.+-.....+..|++.+|+
T Consensus       187 csleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  187 CSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             ccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            999999865 542          3569999999999999999999999986


No 11 
>PHA00733 hypothetical protein
Probab=99.39  E-value=3.1e-13  Score=93.90  Aligned_cols=100  Identities=16%  Similarity=0.269  Sum_probs=79.4

Q ss_pred             CCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHH--Hh---hccCCCCcccCcCccccCCchhHHHHHh
Q psy4796         167 PISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTH--VM---THTGDKPFACSYCDYTCNQSSNLQTHLR  241 (274)
Q Consensus       167 ~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~  241 (274)
                      .|.-..+.|.++     .......+++.|.+|+..|.....|..+  +.   .+.+.+||.|+.|++.|.+...|..|++
T Consensus        20 ~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r   94 (128)
T PHA00733         20 FIHVTLEELKRY-----HSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIR   94 (128)
T ss_pred             EEecCHHHhhhh-----hcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHh
Confidence            333335555554     3344456789999999998887777666  22   3345889999999999999999999999


Q ss_pred             hhCCCCceecCCCCccCCChhHHHHHHhhhcC
Q psy4796         242 IHKTEREYACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       242 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      .|  ..+|.|+.|++.|.....|.+|+...|+
T Consensus        95 ~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         95 YT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            87  3579999999999999999999999986


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.36  E-value=3.9e-12  Score=108.07  Aligned_cols=146  Identities=16%  Similarity=0.348  Sum_probs=108.1

Q ss_pred             ccCCCCCcccCChhHHHHHHhhhcCCCCccCCC--CCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCC
Q psy4796          93 YKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHL--CPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEPISS  170 (274)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~  170 (274)
                      -.|+.|...... ..|..|.... ......|+.  |+..|... .+                   ...+.|+.|++.|. 
T Consensus       408 V~C~NC~~~i~l-~~l~lHe~~C-~r~~V~Cp~~~Cg~v~~r~-el-------------------~~H~~C~~Cgk~f~-  464 (567)
T PLN03086        408 VECRNCKHYIPS-RSIALHEAYC-SRHNVVCPHDGCGIVLRVE-EA-------------------KNHVHCEKCGQAFQ-  464 (567)
T ss_pred             EECCCCCCccch-hHHHHHHhhC-CCcceeCCcccccceeecc-cc-------------------ccCccCCCCCCccc-
Confidence            468888877554 3455776543 334567874  88777322 22                   22357888888884 


Q ss_pred             ChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCC----------chhHHHHH
Q psy4796         171 DMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQ----------SSNLQTHL  240 (274)
Q Consensus       171 ~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~----------~~~l~~H~  240 (274)
                       ...|..|     ...+.  .++.|+ ||+.+ .+..|..|+.+|.+++++.|..|++.|..          ...|..|.
T Consensus       465 -~s~LekH-----~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE  534 (567)
T PLN03086        465 -QGEMEKH-----MKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHE  534 (567)
T ss_pred             -hHHHHHH-----HHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHH
Confidence             4567777     44442  679999 99755 67899999999999999999999999852          34799998


Q ss_pred             hhhCCCCceecCCCCccCCChhHHHHHHhhhcC
Q psy4796         241 RIHKTEREYACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       241 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      ... +.+++.|..||+.+. ..+|..|+-.+|.
T Consensus       535 ~~C-G~rt~~C~~Cgk~Vr-lrdm~~H~~~~h~  565 (567)
T PLN03086        535 SIC-GSRTAPCDSCGRSVM-LKEMDIHQIAVHQ  565 (567)
T ss_pred             Hhc-CCcceEccccCCeee-ehhHHHHHHHhhc
Confidence            885 899999999999875 5569999998886


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.33  E-value=1.2e-11  Score=105.11  Aligned_cols=148  Identities=18%  Similarity=0.411  Sum_probs=104.2

Q ss_pred             CCCCCeeeccccCCcchhhHHHHHhhhccccccccccCCcceeccc--ccccccChHHHHHHHhhcCCCCcccCCCCCcc
Q psy4796          24 PPPADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLF--CSYVATARIAIKNHLSSHLGWKPYKCPHCDHC  101 (274)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  101 (274)
                      .......|..|.+..  ....|..|...|..        ..-.|+.  |+..|... .+.         ..+.|+.|++.
T Consensus       403 ~~~~~V~C~NC~~~i--~l~~l~lHe~~C~r--------~~V~Cp~~~Cg~v~~r~-el~---------~H~~C~~Cgk~  462 (567)
T PLN03086        403 MDVDTVECRNCKHYI--PSRSIALHEAYCSR--------HNVVCPHDGCGIVLRVE-EAK---------NHVHCEKCGQA  462 (567)
T ss_pred             CCCCeEECCCCCCcc--chhHHHHHHhhCCC--------cceeCCcccccceeecc-ccc---------cCccCCCCCCc
Confidence            344567899999998  77778899874442        2345774  88877422 222         23578888888


Q ss_pred             cCChhHHHHHHhhhcCCCCccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCCC---------h
Q psy4796         102 FTQKVVLQRHLLTHTGEKPFACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEPISSD---------M  172 (274)
Q Consensus       102 f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~---------~  172 (274)
                      |. ...|..|+..++  .++.|+ |+..+ .+..|..|+..        +  ...+++.|+.|+..+...         .
T Consensus       463 f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~t--------h--Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~  527 (567)
T PLN03086        463 FQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQAS--------T--CPLRLITCRFCGDMVQAGGSAMDVRDRL  527 (567)
T ss_pred             cc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhc--------c--CCCCceeCCCCCCccccCccccchhhhh
Confidence            85 577888888764  678888 88654 56788888765        3  677888888888877421         3


Q ss_pred             hhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHh
Q psy4796         173 SEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVM  213 (274)
Q Consensus       173 ~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  213 (274)
                      +.|..|     .... +.+++.|..||+.+..+ .+..|+.
T Consensus       528 s~Lt~H-----E~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~  561 (567)
T PLN03086        528 RGMSEH-----ESIC-GSRTAPCDSCGRSVMLK-EMDIHQI  561 (567)
T ss_pred             hhHHHH-----HHhc-CCcceEccccCCeeeeh-hHHHHHH
Confidence            467777     5554 77889999999888855 4667765


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.12  E-value=2.7e-11  Score=69.15  Aligned_cols=42  Identities=19%  Similarity=0.420  Sum_probs=28.6

Q ss_pred             cccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCCChhHH
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTAALPDL  264 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  264 (274)
                      |.|+.||+.|...++|..|+++|.  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            567777777777777777777766  566777777776665544


No 15 
>KOG3993|consensus
Probab=99.11  E-value=8.3e-12  Score=99.79  Aligned_cols=111  Identities=16%  Similarity=0.248  Sum_probs=72.1

Q ss_pred             CCeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHhhcCCCCcccC---CCCCcccC
Q psy4796          27 ADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLSSHLGWKPYKC---PHCDHCFT  103 (274)
Q Consensus        27 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C---~~C~~~f~  103 (274)
                      ..|.|.+|...| .+...|.+|.-       .---...|+|++|+|+|..-.+|..|.++|.....--=   +-=.+...
T Consensus       266 GdyiCqLCK~kY-eD~F~LAQHrC-------~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~  337 (500)
T KOG3993|consen  266 GDYICQLCKEKY-EDAFALAQHRC-------PRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVE  337 (500)
T ss_pred             HHHHHHHHHHhh-hhHHHHhhccC-------CeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhh
Confidence            358899999999 99999999975       33334568999999999999999999999854321100   00000011


Q ss_pred             ChhHHHHHHh--hhcCCCCccCCCCCCccccHHHHHHHHHHHHH
Q psy4796         104 QKVVLQRHLL--THTGEKPFACHLCPYRASRKYYITAHLNSLLS  145 (274)
Q Consensus       104 ~~~~l~~H~~--~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  145 (274)
                      +....+.-.+  ....+..|.|..|+++|.....|+.|+.+++.
T Consensus       338 ~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  338 TRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             hhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence            1111111110  01223469999999999999999999887654


No 16 
>KOG3993|consensus
Probab=99.08  E-value=4e-11  Score=95.97  Aligned_cols=26  Identities=31%  Similarity=0.705  Sum_probs=17.9

Q ss_pred             cccCCCCCcccCChhHHHHHHhhhcC
Q psy4796          92 PYKCPHCDHCFTQKVVLQRHLLTHTG  117 (274)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~h~~  117 (274)
                      -|.|..|++.|.....|+.|+.+|..
T Consensus       356 i~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  356 IFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             eeecHHhhhhhHHHHHHHHhHHhhhc
Confidence            57777777777777777777666543


No 17 
>PHA00733 hypothetical protein
Probab=99.08  E-value=2.3e-10  Score=79.65  Aligned_cols=83  Identities=18%  Similarity=0.303  Sum_probs=59.7

Q ss_pred             ccCCcceecccccccccChHHHHHH--Hh---hcCCCCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCccccH
Q psy4796          59 TSAKLQFLCLFCSYVATARIAIKNH--LS---SHLGWKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRASRK  133 (274)
Q Consensus        59 h~~~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  133 (274)
                      -..++++.|.+|...|.....|..+  +.   .+.+.+||.|..|++.|.+...|..|++.+  ..+|.|+.|++.|...
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         35 TPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             ChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCH
Confidence            3446677888888777766555544  11   223467888888888888888888888765  3468888888888888


Q ss_pred             HHHHHHHHHH
Q psy4796         134 YYITAHLNSL  143 (274)
Q Consensus       134 ~~l~~H~~~~  143 (274)
                      ..|..|+...
T Consensus       113 ~sL~~H~~~~  122 (128)
T PHA00733        113 DSTLDHVCKK  122 (128)
T ss_pred             HHHHHHHHHh
Confidence            8888887763


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.94  E-value=5.7e-10  Score=63.78  Aligned_cols=43  Identities=16%  Similarity=0.241  Sum_probs=39.4

Q ss_pred             ccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhH
Q psy4796         192 KFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNL  236 (274)
Q Consensus       192 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  236 (274)
                      .|.|+.||+.|.....|..|+++|+  ++|.|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            3899999999999999999999999  689999999999977665


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.87  E-value=1.6e-09  Score=53.02  Aligned_cols=25  Identities=36%  Similarity=0.755  Sum_probs=18.2

Q ss_pred             hHHHHHhhhCCCCceecCCCCccCC
Q psy4796         235 NLQTHLRIHKTEREYACGKCAYRTA  259 (274)
Q Consensus       235 ~l~~H~~~h~~~~~~~C~~C~~~f~  259 (274)
                      +|.+|+++|++++||.|++|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3667777777777777777777765


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.69  E-value=1.1e-08  Score=49.97  Aligned_cols=26  Identities=38%  Similarity=0.988  Sum_probs=23.6

Q ss_pred             HHHHHHhhccCCCCcccCcCccccCC
Q psy4796         207 YIKTHVMTHTGDKPFACSYCDYTCNQ  232 (274)
Q Consensus       207 ~l~~H~~~h~~~~~~~C~~C~~~f~~  232 (274)
                      +|..|+++|++++||.|+.|++.|..
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999999863


No 21 
>PHA00616 hypothetical protein
Probab=98.64  E-value=9.7e-09  Score=55.80  Aligned_cols=33  Identities=12%  Similarity=0.256  Sum_probs=21.9

Q ss_pred             CcccCcCccccCCchhHHHHHhhhCCCCceecC
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHKTEREYACG  252 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  252 (274)
                      ||+|+.||+.|..+++|.+|++.|++++++.|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            466666666666666666666666666666554


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.55  E-value=1e-07  Score=55.83  Aligned_cols=51  Identities=31%  Similarity=0.621  Sum_probs=36.7

Q ss_pred             CcccCcCccccCCchhHHHHHhh-hCCC-CceecCCCCccCCChhHHHHHHhhhcC
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRI-HKTE-REYACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~-~~~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      .|.|+.|++ ..+...|..|... |..+ +.+.||+|...+.  .+|.+|+...|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            477888888 4456778888765 5443 4588888887655  488888888775


No 23 
>PHA00616 hypothetical protein
Probab=98.51  E-value=3.4e-08  Score=53.70  Aligned_cols=27  Identities=22%  Similarity=0.338  Sum_probs=25.9

Q ss_pred             ceecCCCCccCCChhHHHHHHhhhcCC
Q psy4796         248 EYACGKCAYRTAALPDLKLHLKNMHLY  274 (274)
Q Consensus       248 ~~~C~~C~~~f~~~~~l~~H~~~~H~~  274 (274)
                      ||+|+.||+.|.++++|.+|+++|||+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC
Confidence            689999999999999999999999986


No 24 
>PHA00732 hypothetical protein
Probab=98.50  E-value=7.8e-08  Score=60.61  Aligned_cols=48  Identities=25%  Similarity=0.454  Sum_probs=36.6

Q ss_pred             ccccCCCCccccCHHHHHHHHhh-ccCCCCcccCcCccccCCchhHHHHHhhhCC
Q psy4796         192 KFVCFACPYATQYACYIKTHVMT-HTGDKPFACSYCDYTCNQSSNLQTHLRIHKT  245 (274)
Q Consensus       192 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  245 (274)
                      +|.|..|++.|.....|..|++. |++   +.|+.|++.|.   .|..|++.+.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---ChhhhhcccCC
Confidence            47788888888888888888874 543   57888888887   47778866554


No 25 
>PHA00732 hypothetical protein
Probab=98.42  E-value=2.8e-07  Score=58.13  Aligned_cols=45  Identities=27%  Similarity=0.490  Sum_probs=34.7

Q ss_pred             CcccCcCccccCCchhHHHHHhh-hCCCCceecCCCCccCCChhHHHHHHhh
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRI-HKTEREYACGKCAYRTAALPDLKLHLKN  270 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~  270 (274)
                      ||.|..|++.|.+..+|+.|++. |.+   +.|+.|++.|.   .+..|++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhcc
Confidence            57888888888888888888874 543   57888888886   46677654


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.17  E-value=4.6e-06  Score=48.80  Aligned_cols=50  Identities=24%  Similarity=0.450  Sum_probs=39.4

Q ss_pred             ccccCCCCccccCHHHHHHHHh-hccCC-CCcccCcCccccCCchhHHHHHhhhC
Q psy4796         192 KFVCFACPYATQYACYIKTHVM-THTGD-KPFACSYCDYTCNQSSNLQTHLRIHK  244 (274)
Q Consensus       192 ~~~C~~C~~~f~~~~~l~~H~~-~h~~~-~~~~C~~C~~~f~~~~~l~~H~~~h~  244 (274)
                      .|.||.|++ ..+...|..|.. .|..+ +.+.|++|...+.  .+|.+|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            489999999 455788999987 55543 5699999998755  48999998754


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.13  E-value=1.5e-06  Score=41.13  Aligned_cols=22  Identities=27%  Similarity=0.640  Sum_probs=14.6

Q ss_pred             eecCCCCccCCChhHHHHHHhh
Q psy4796         249 YACGKCAYRTAALPDLKLHLKN  270 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~  270 (274)
                      |.|++|++.|.+...|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5666666666666666666665


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.12  E-value=2e-06  Score=41.17  Aligned_cols=24  Identities=21%  Similarity=0.605  Sum_probs=16.3

Q ss_pred             eecCCCCccCCChhHHHHHHhhhc
Q psy4796         249 YACGKCAYRTAALPDLKLHLKNMH  272 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~~H  272 (274)
                      |.|++|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777777765


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.06  E-value=2.1e-06  Score=40.65  Aligned_cols=23  Identities=35%  Similarity=0.807  Sum_probs=13.9

Q ss_pred             cccCcCccccCCchhHHHHHhhh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      |.|+.|++.|.++..|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            45666666666666666666543


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.91  E-value=6.6e-06  Score=40.61  Aligned_cols=25  Identities=20%  Similarity=0.534  Sum_probs=16.3

Q ss_pred             ceecCCCCccCCChhHHHHHHhhhc
Q psy4796         248 EYACGKCAYRTAALPDLKLHLKNMH  272 (274)
Q Consensus       248 ~~~C~~C~~~f~~~~~l~~H~~~~H  272 (274)
                      +|.|..|++.|.+...|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4666666666666666666666555


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.82  E-value=1.2e-05  Score=53.85  Aligned_cols=23  Identities=17%  Similarity=0.462  Sum_probs=11.9

Q ss_pred             ceecCCCCccCCChhHHHHHHhh
Q psy4796         248 EYACGKCAYRTAALPDLKLHLKN  270 (274)
Q Consensus       248 ~~~C~~C~~~f~~~~~l~~H~~~  270 (274)
                      .+.|.+|++.|.+...|..|++.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHcC
Confidence            35555555555555555555553


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.77  E-value=1.7e-05  Score=37.78  Aligned_cols=23  Identities=35%  Similarity=0.816  Sum_probs=13.7

Q ss_pred             cccCcCccccCCchhHHHHHhhh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      |.|++|++.|.+...|+.|+..|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666654


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.72  E-value=1.8e-05  Score=39.04  Aligned_cols=25  Identities=40%  Similarity=0.686  Sum_probs=17.0

Q ss_pred             CcccCcCccccCCchhHHHHHhhhC
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHK  244 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~  244 (274)
                      +|.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4667777777777777777776654


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.70  E-value=2.3e-05  Score=52.55  Aligned_cols=73  Identities=19%  Similarity=0.440  Sum_probs=17.5

Q ss_pred             eeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHhhcCCCCcccCCCCCcccCChhHHH
Q psy4796          30 TCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFTQKVVLQ  109 (274)
Q Consensus        30 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  109 (274)
                      +|..|+..| .+...|..|+..      .|.-..+     ....+.....+..+..... ...+.|..|++.|.+...|.
T Consensus         1 ~C~~C~~~f-~~~~~l~~H~~~------~H~~~~~-----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~   67 (100)
T PF12756_consen    1 QCLFCDESF-SSVDDLLQHMKK------KHGFDIP-----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQ   67 (100)
T ss_dssp             -------------------------------------------------------------SSEEBSSSS-EESSHHHHH
T ss_pred             Ccccccccc-cccccccccccc------ccccccc-----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHH
Confidence            477888888 778888888763      3332211     1111112223333332211 12577777777777777777


Q ss_pred             HHHhhh
Q psy4796         110 RHLLTH  115 (274)
Q Consensus       110 ~H~~~h  115 (274)
                      .|++.+
T Consensus        68 ~Hm~~~   73 (100)
T PF12756_consen   68 EHMRSK   73 (100)
T ss_dssp             HHHHHT
T ss_pred             HHHcCc
Confidence            777754


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.67  E-value=1.6e-05  Score=62.11  Aligned_cols=53  Identities=30%  Similarity=0.674  Sum_probs=42.0

Q ss_pred             CCCcccCc--CccccCCchhHHHHHhh-hC------------------CCCceecCCCCccCCChhHHHHHHhh
Q psy4796         218 DKPFACSY--CDYTCNQSSNLQTHLRI-HK------------------TEREYACGKCAYRTAALPDLKLHLKN  270 (274)
Q Consensus       218 ~~~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  270 (274)
                      +|||.|++  |.+.|.....|+.|+.. |-                  ..|||.|.+|+|.+.+...|+-|+.-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            58888866  88888888888888754 31                  34789999999999999999888543


No 36 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.59  E-value=5e-05  Score=36.19  Aligned_cols=24  Identities=46%  Similarity=0.876  Sum_probs=18.0

Q ss_pred             eecCCCCccCCChhHHHHHHhhhcC
Q psy4796         249 YACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      |.|+.|+.... ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            67888888887 8888888888875


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.57  E-value=2.2e-05  Score=61.43  Aligned_cols=24  Identities=17%  Similarity=0.357  Sum_probs=17.5

Q ss_pred             Ccceeccc--ccccccChHHHHHHHh
Q psy4796          62 KLQFLCLF--CSYVATARIAIKNHLS   85 (274)
Q Consensus        62 ~~~~~C~~--C~~~f~~~~~l~~H~~   85 (274)
                      +++|+|++  |+++|.++..|.-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~l  372 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHML  372 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhh
Confidence            47777777  7777777777777764


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.20  E-value=0.00031  Score=33.88  Aligned_cols=20  Identities=25%  Similarity=0.514  Sum_probs=8.6

Q ss_pred             ecCCCCccCCChhHHHHHHh
Q psy4796         250 ACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       250 ~C~~C~~~f~~~~~l~~H~~  269 (274)
                      .|+.|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            34444444444444444443


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.19  E-value=0.00033  Score=39.09  Aligned_cols=28  Identities=36%  Similarity=0.680  Sum_probs=10.3

Q ss_pred             CCCcccCcCccccCCchhHHHHHhhhCC
Q psy4796         218 DKPFACSYCDYTCNQSSNLQTHLRIHKT  245 (274)
Q Consensus       218 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~  245 (274)
                      +.|-.|++|+..+.+..+|++|+.++++
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            3344444444444444444444444333


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.15  E-value=0.00032  Score=33.83  Aligned_cols=23  Identities=30%  Similarity=0.720  Sum_probs=21.0

Q ss_pred             cccCcCccccCCchhHHHHHhhh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            68999999999999999999865


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=97.05  E-value=0.00046  Score=49.97  Aligned_cols=37  Identities=24%  Similarity=0.665  Sum_probs=23.0

Q ss_pred             CcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCCC
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTAA  260 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  260 (274)
                      +|.|. |+.   ....+++|.++|.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            46665 665   44556666666666666666666666543


No 42 
>KOG2231|consensus
Probab=97.04  E-value=0.0021  Score=56.52  Aligned_cols=48  Identities=21%  Similarity=0.313  Sum_probs=31.7

Q ss_pred             cccCCCCccccCHHHHHHHHhhccCCCCcccCcCc------cccCCchhHHHHHhhhC
Q psy4796         193 FVCFACPYATQYACYIKTHVMTHTGDKPFACSYCD------YTCNQSSNLQTHLRIHK  244 (274)
Q Consensus       193 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~------~~f~~~~~l~~H~~~h~  244 (274)
                      -.|..|...|-....|..|++.++    |.|..|.      ..|...+.|..|.+.++
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            457777777777777777777665    4555553      45556667777776655


No 43 
>KOG1146|consensus
Probab=97.03  E-value=0.00062  Score=63.41  Aligned_cols=108  Identities=19%  Similarity=0.324  Sum_probs=80.0

Q ss_pred             eeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHhhcC--------------------
Q psy4796          29 VTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLSSHL--------------------   88 (274)
Q Consensus        29 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--------------------   88 (274)
                      ..|.-|+..+ .....+..|+..      .++..+.|+|+.|+..|.....|..||+..+                    
T Consensus       437 ~e~~~~e~~~-~s~r~~~~~t~~------L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg  509 (1406)
T KOG1146|consen  437 VELTKAEPLL-ESKRSLEGQTVV------LHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARG  509 (1406)
T ss_pred             ccccchhhhh-hhhcccccceee------eecccccccCCccchhhhhHHHhhhcccccccccchhHhHhcccccccccc
Confidence            4456666666 666666666553      6666778888888888888888888887621                    


Q ss_pred             -----CCCcccCCCCCcccCChhHHHHHHhh--hcC-----------------------------------------CCC
Q psy4796          89 -----GWKPYKCPHCDHCFTQKVVLQRHLLT--HTG-----------------------------------------EKP  120 (274)
Q Consensus        89 -----~~~~~~C~~C~~~f~~~~~l~~H~~~--h~~-----------------------------------------~~~  120 (274)
                           +.++|.|..|...+.++.+|-+|++.  |..                                         ...
T Consensus       510 ~~~~~~~~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~  589 (1406)
T KOG1146|consen  510 EVYRCPGKPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPS  589 (1406)
T ss_pred             ccccCCCCcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCC
Confidence                 23578999999999999999999753  111                                         122


Q ss_pred             ccCCCCCCccccHHHHHHHHHHH
Q psy4796         121 FACHLCPYRASRKYYITAHLNSL  143 (274)
Q Consensus       121 ~~C~~C~~~f~~~~~l~~H~~~~  143 (274)
                      |.|..|+++..-..+|+.|+...
T Consensus       590 ~~C~vc~yetniarnlrihmtss  612 (1406)
T KOG1146|consen  590 WRCEVCSYETNIARNLRIHMTAS  612 (1406)
T ss_pred             cchhhhcchhhhhhccccccccC
Confidence            88999999998888899888653


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.03  E-value=0.00051  Score=38.33  Aligned_cols=37  Identities=19%  Similarity=0.348  Sum_probs=23.9

Q ss_pred             HHHHhhh-CCCCceecCCCCccCCChhHHHHHHhhhcC
Q psy4796         237 QTHLRIH-KTEREYACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       237 ~~H~~~h-~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      ..+.+.+ ..+.|-.||+|+..+....+|.+|+...|+
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            4444443 456789999999999999999999998886


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.94  E-value=0.00044  Score=33.20  Aligned_cols=18  Identities=28%  Similarity=0.781  Sum_probs=7.5

Q ss_pred             cCcCccccCCchhHHHHH
Q psy4796         223 CSYCDYTCNQSSNLQTHL  240 (274)
Q Consensus       223 C~~C~~~f~~~~~l~~H~  240 (274)
                      |.+|++.|.+...|+.|+
T Consensus         3 C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             ETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCcCCHHHHHHHH
Confidence            444444444444444443


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.92  E-value=0.00061  Score=32.67  Aligned_cols=23  Identities=22%  Similarity=0.514  Sum_probs=21.0

Q ss_pred             eecCCCCccCCChhHHHHHHhhh
Q psy4796         249 YACGKCAYRTAALPDLKLHLKNM  271 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~~  271 (274)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999754


No 47 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.60  E-value=0.0011  Score=31.37  Aligned_cols=23  Identities=39%  Similarity=0.933  Sum_probs=13.7

Q ss_pred             cccCcCccccCCchhHHHHHhhhC
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIHK  244 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h~  244 (274)
                      |.|+.|+.... ...|.+|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777776666 667777776643


No 48 
>KOG2785|consensus
Probab=96.55  E-value=0.01  Score=48.25  Aligned_cols=51  Identities=18%  Similarity=0.363  Sum_probs=37.6

Q ss_pred             ccccCCCCccccCHHHHHHHHhhccCC-----------------------CCcccCcCc---cccCCchhHHHHHhh
Q psy4796         192 KFVCFACPYATQYACYIKTHVMTHTGD-----------------------KPFACSYCD---YTCNQSSNLQTHLRI  242 (274)
Q Consensus       192 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~  242 (274)
                      |-.|-.|+..+.+......||..+++-                       .-+.|..|.   +.|.+..+.++||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            466888888888888888888877652                       236677777   777777777777765


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=96.49  E-value=0.0014  Score=47.58  Aligned_cols=40  Identities=18%  Similarity=0.355  Sum_probs=34.6

Q ss_pred             CccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCch
Q psy4796         191 KKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSS  234 (274)
Q Consensus       191 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  234 (274)
                      -+|.|. |+.   ....+..|.++|+++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            369998 997   6677899999999999999999999887654


No 50 
>KOG2785|consensus
Probab=96.46  E-value=0.0085  Score=48.72  Aligned_cols=52  Identities=17%  Similarity=0.383  Sum_probs=43.6

Q ss_pred             CCcccCcCccccCCchhHHHHHhhhCCCC-----------------------ceecCCCC---ccCCChhHHHHHHhh
Q psy4796         219 KPFACSYCDYTCNQSSNLQTHLRIHKTER-----------------------EYACGKCA---YRTAALPDLKLHLKN  270 (274)
Q Consensus       219 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~-----------------------~~~C~~C~---~~f~~~~~l~~H~~~  270 (274)
                      -|-.|..|++.+.+...-..||..+++-.                       -+.|-.|.   +.|.+...+..||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            35789999999999999999998876531                       27888888   999999999999964


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.30  E-value=0.0012  Score=32.34  Aligned_cols=21  Identities=29%  Similarity=0.575  Sum_probs=12.9

Q ss_pred             eecCCCCccCCChhHHHHHHh
Q psy4796         249 YACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~  269 (274)
                      |.|.+|++.|.+...+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666654


No 52 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.26  E-value=0.008  Score=48.09  Aligned_cols=72  Identities=25%  Similarity=0.476  Sum_probs=53.8

Q ss_pred             ccCCCCccccCHHHHHHHHhhccCCCCcccCcCcc-------ccCCchhHHHHHhhhCCCCceecCC--CC----ccCCC
Q psy4796         194 VCFACPYATQYACYIKTHVMTHTGDKPFACSYCDY-------TCNQSSNLQTHLRIHKTEREYACGK--CA----YRTAA  260 (274)
Q Consensus       194 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~h~~~~~~~C~~--C~----~~f~~  260 (274)
                      .|..|...|-+...|.+|++.-+.    .|-+|++       -|.+..+|.+|.+.    .-|.|.+  |.    ..|++
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~~~k~~vf~~  293 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCRVGKCYVFPY  293 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEecCcEEEecc
Confidence            699999999999999999986552    3555543       45666777777653    3377755  54    37999


Q ss_pred             hhHHHHHHhhhcC
Q psy4796         261 LPDLKLHLKNMHL  273 (274)
Q Consensus       261 ~~~l~~H~~~~H~  273 (274)
                      ...|..|+-+-|+
T Consensus       294 ~~el~~h~~~~h~  306 (493)
T COG5236         294 HTELLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHHHHhh
Confidence            9999999988776


No 53 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.93  E-value=0.0033  Score=30.75  Aligned_cols=21  Identities=29%  Similarity=0.423  Sum_probs=13.2

Q ss_pred             cccCCCCccccCHHHHHHHHh
Q psy4796         193 FVCFACPYATQYACYIKTHVM  213 (274)
Q Consensus       193 ~~C~~C~~~f~~~~~l~~H~~  213 (274)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            556666666666666666654


No 54 
>KOG2482|consensus
Probab=95.90  E-value=0.067  Score=42.95  Aligned_cols=78  Identities=18%  Similarity=0.244  Sum_probs=46.4

Q ss_pred             ccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCc
Q psy4796         121 FACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPY  200 (274)
Q Consensus       121 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~  200 (274)
                      ..|-.|.....+...+..||+..|.-.+.+-    ...+.     -.|-. .-.++.       -...+.....|..|.-
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki----~sd~~-----Ln~Yq-rvrviN-------yiRkq~~~~~c~~cd~  342 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKI----QSDYS-----LNFYQ-RVRVIN-------YIRKQKKKSRCAECDL  342 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhh----ccccc-----cchhh-hhhHHH-------HHHHHhhccccccccc
Confidence            5899999999999999999998776443322    11110     00000 000100       1112233456788888


Q ss_pred             cccCHHHHHHHHhhc
Q psy4796         201 ATQYACYIKTHVMTH  215 (274)
Q Consensus       201 ~f~~~~~l~~H~~~h  215 (274)
                      .|-....|..|+..+
T Consensus       343 ~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  343 SFWKEPGLLIHMVED  357 (423)
T ss_pred             cccCcchhhhhcccc
Confidence            888888888888643


No 55 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.89  E-value=0.0049  Score=29.47  Aligned_cols=20  Identities=20%  Similarity=0.408  Sum_probs=11.3

Q ss_pred             eeeccccCCcchhhHHHHHhhh
Q psy4796          29 VTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        29 ~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      ..|+.||+.|  ..+.|..|+.
T Consensus         3 ~~C~~CgR~F--~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF--NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE--CHHHHHHHHH
Confidence            3456666666  5555555554


No 56 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.56  E-value=0.01  Score=28.32  Aligned_cols=19  Identities=26%  Similarity=0.434  Sum_probs=11.1

Q ss_pred             ecCCCCccCCChhHHHHHHh
Q psy4796         250 ACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       250 ~C~~C~~~f~~~~~l~~H~~  269 (274)
                      .|+.||..| ....|.+|++
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 4555666654


No 57 
>KOG1146|consensus
Probab=95.56  E-value=0.009  Score=56.12  Aligned_cols=168  Identities=20%  Similarity=0.301  Sum_probs=104.7

Q ss_pred             cccccccccChHHHHHHHh-hcCCCCcccCCCCCcccCChhHHHHHHhhhcC-------------------------CCC
Q psy4796          67 CLFCSYVATARIAIKNHLS-SHLGWKPYKCPHCDHCFTQKVVLQRHLLTHTG-------------------------EKP  120 (274)
Q Consensus        67 C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------------------~~~  120 (274)
                      |..|+..+.....+.-|+. .+...+.++|+.|+..|+....|..||+..+.                         .++
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            3444444444444433332 23445789999999999999999999987221                         366


Q ss_pred             ccCCCCCCccccHHHHHHHHHHHHHHHHHHhHh--hcC----CCc-cCCCCCCCCCCChhhhhhhccCCCCCc-ccCCCc
Q psy4796         121 FACHLCPYRASRKYYITAHLNSLLSALLLQHFL--ASQ----PRR-KCVHCSEPISSDMSEIIEHCLVCPNAT-RTDKKK  192 (274)
Q Consensus       121 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~--~~~----~~~-~c~~c~~~~~~~~~~l~~h~~~~~~~~-~~~~~~  192 (274)
                      |.|..|..++..+..|..|++............  .+.    .+- .+..+...-+...+.         -.. ....-.
T Consensus       519 ~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~a---------gs~~pktkP~  589 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSA---------GSSGPKTKPS  589 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCC---------CCCCCCCCCC
Confidence            899999999999999999998644322211100  110    000 021222111110000         011 122335


Q ss_pred             cccCCCCccccCHHHHHHHHh-hccCCCCcccCcCccccCCchhHHHHHhhh
Q psy4796         193 FVCFACPYATQYACYIKTHVM-THTGDKPFACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       193 ~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      +.|..|+..-.-..+|+.|+. .++...|..+..+.-.+.....+..+.+.+
T Consensus       590 ~~C~vc~yetniarnlrihmtss~~s~~p~~~Lq~~it~~l~~~~~~~~~lp  641 (1406)
T KOG1146|consen  590 WRCEVCSYETNIARNLRIHMTASPSSSPPSLVLQQNITSSLASLLGGQGRLP  641 (1406)
T ss_pred             cchhhhcchhhhhhccccccccCCCCCChHHHhhhcchhhccccccCcCCCC
Confidence            889999999999999999987 556566678888888887777776666665


No 58 
>KOG2231|consensus
Probab=95.43  E-value=0.027  Score=49.86  Aligned_cols=45  Identities=24%  Similarity=0.408  Sum_probs=29.2

Q ss_pred             cCCCCCcccCChhHHHHHHhhhcCCCCccCCCC------CCccccHHHHHHHHHH
Q psy4796          94 KCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLC------PYRASRKYYITAHLNS  142 (274)
Q Consensus        94 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~  142 (274)
                      .|..|...|-....|.+|++.++    |.|..|      +.-|.....|..|.+.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~  234 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRK  234 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhh
Confidence            57777777777777777777654    445555      2345666667777655


No 59 
>KOG2482|consensus
Probab=95.36  E-value=0.021  Score=45.65  Aligned_cols=90  Identities=17%  Similarity=0.332  Sum_probs=63.3

Q ss_pred             CeeeccccCCcchhhHHHHHhhhcccccc------cc-------cc--CCcceecccccccccChHHHHHHHhhc--CC-
Q psy4796          28 DVTCLHCSLTTPCVMKDMIRHGRLCEFNS------VV-------TS--AKLQFLCLFCSYVATARIAIKNHLSSH--LG-   89 (274)
Q Consensus        28 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~------~~-------h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h--~~-   89 (274)
                      -..|..|+..+..++.....|+...++-.      -+       |.  .-..+.|-.|.+.|.++..|+.||+..  .. 
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrri  223 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRI  223 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCccc
Confidence            36799998888677788888876433210      00       00  111377999999999999999999752  10 


Q ss_pred             ---------------------------------------------------CCc--ccCCCCCcccCChhHHHHHHhhhc
Q psy4796          90 ---------------------------------------------------WKP--YKCPHCDHCFTQKVVLQRHLLTHT  116 (274)
Q Consensus        90 ---------------------------------------------------~~~--~~C~~C~~~f~~~~~l~~H~~~h~  116 (274)
                                                                         ..+  .+|-.|.....+...|..||...+
T Consensus       224 nPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~vH  303 (423)
T KOG2482|consen  224 NPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIVH  303 (423)
T ss_pred             CCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHHH
Confidence                                                               011  489999999999999999998644


Q ss_pred             C
Q psy4796         117 G  117 (274)
Q Consensus       117 ~  117 (274)
                      .
T Consensus       304 e  304 (423)
T KOG2482|consen  304 E  304 (423)
T ss_pred             H
Confidence            3


No 60 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=95.15  E-value=0.036  Score=37.67  Aligned_cols=85  Identities=22%  Similarity=0.365  Sum_probs=48.2

Q ss_pred             cCCCccccCCCCccccCHHHHHHHHh-hccCCCCcccCcCccccCCchhHH---HHHhh-hCCC---------Cceec--
Q psy4796         188 TDKKKFVCFACPYATQYACYIKTHVM-THTGDKPFACSYCDYTCNQSSNLQ---THLRI-HKTE---------REYAC--  251 (274)
Q Consensus       188 ~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~---~H~~~-h~~~---------~~~~C--  251 (274)
                      ...+...|..|+..... +.+..|++ .|+..+...-..=...+.....|.   ..+.. ..+.         ..|.|  
T Consensus         7 ~~~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~   85 (109)
T PF12013_consen    7 PEYRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQC   85 (109)
T ss_pred             CcCCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeec
Confidence            34456789999988876 78899988 444321110000000000000000   00000 0000         23899  


Q ss_pred             --CCCCccCCChhHHHHHHhhhcC
Q psy4796         252 --GKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       252 --~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                        +.|++.+.+...|.+|.+.+||
T Consensus        86 ~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   86 DPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCCCcEeccHHHHHHHHHHhcC
Confidence              9999999999999999999997


No 61 
>KOG2893|consensus
Probab=95.11  E-value=0.0056  Score=46.27  Aligned_cols=42  Identities=21%  Similarity=0.340  Sum_probs=24.7

Q ss_pred             eeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHH
Q psy4796          30 TCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNH   83 (274)
Q Consensus        30 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H   83 (274)
                      .|+.|++.| .+...|+.|++           .+-|+|.+|-++..+--.|.+|
T Consensus        12 wcwycnref-ddekiliqhqk-----------akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREF-DDEKILIQHQK-----------AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeeccccc-chhhhhhhhhh-----------hccceeeeehhhhccCCCceee
Confidence            366777777 66666666666           3446666666554444444433


No 62 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.93  E-value=0.018  Score=29.67  Aligned_cols=24  Identities=21%  Similarity=0.791  Sum_probs=13.6

Q ss_pred             cccCcCccccCCchhHHHHHhhhCCCCceecCCCCc
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAY  256 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  256 (274)
                      |.|..||..+....            .+..||+|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            56666665554322            5566666664


No 63 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.76  E-value=0.055  Score=43.49  Aligned_cols=19  Identities=26%  Similarity=0.616  Sum_probs=12.0

Q ss_pred             eccccCCcchhhHHHHHhhh
Q psy4796          31 CLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        31 C~~C~~~f~~~~~~l~~H~~   50 (274)
                      |..|+..| .+.++|..|++
T Consensus       223 C~FC~~~F-YdDDEL~~HcR  241 (493)
T COG5236         223 CIFCKIYF-YDDDELRRHCR  241 (493)
T ss_pred             hhhcccee-cChHHHHHHHH
Confidence            66666666 66666666665


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.40  E-value=0.037  Score=28.77  Aligned_cols=22  Identities=23%  Similarity=0.433  Sum_probs=16.5

Q ss_pred             ceecCCCCccCCChhHHHHHHh
Q psy4796         248 EYACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       248 ~~~C~~C~~~f~~~~~l~~H~~  269 (274)
                      +|.|.+|++.|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4678888888877777777764


No 65 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.72  E-value=0.047  Score=28.34  Aligned_cols=23  Identities=26%  Similarity=0.611  Sum_probs=16.3

Q ss_pred             CcccCcCccccCCchhHHHHHhh
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRI  242 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~  242 (274)
                      +|.|..|+..|.+..++..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777777777777654


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.61  E-value=0.028  Score=31.98  Aligned_cols=26  Identities=15%  Similarity=0.470  Sum_probs=15.3

Q ss_pred             CCCCcccCcCccccCCchhHHHHHhh
Q psy4796         217 GDKPFACSYCDYTCNQSSNLQTHLRI  242 (274)
Q Consensus       217 ~~~~~~C~~C~~~f~~~~~l~~H~~~  242 (274)
                      |+..+.|+.||..|....++.+|+..
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhH
Confidence            44456666666666666666666543


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.00  E-value=0.029  Score=48.13  Aligned_cols=151  Identities=25%  Similarity=0.374  Sum_probs=85.2

Q ss_pred             cccCCCCCcccCChhHHHHHHh--hhcCC--CCccCC--CCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCC--C
Q psy4796          92 PYKCPHCDHCFTQKVVLQRHLL--THTGE--KPFACH--LCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCV--H  163 (274)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~--~  163 (274)
                      ++.|..|...|.....+..|.+  .|..+  +++.|+  .|++.|.....+..|...+          ....+..+.  .
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~  358 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLH----------TSISPAKEKLLN  358 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccc----------cCCCcccccccc
Confidence            4666777777777777777776  56666  677777  5777776666666665542          222222221  1


Q ss_pred             CCCCCCCChh----hhhhhccCCCCCcccCCCcccc--CCCCccccCHHHHHHHHhhccCCC--CcccCcCccccCCchh
Q psy4796         164 CSEPISSDMS----EIIEHCLVCPNATRTDKKKFVC--FACPYATQYACYIKTHVMTHTGDK--PFACSYCDYTCNQSSN  235 (274)
Q Consensus       164 c~~~~~~~~~----~l~~h~~~~~~~~~~~~~~~~C--~~C~~~f~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~  235 (274)
                      +...+.....    .....     .........+.+  ..|...+.....+..|...+....  .+.+..|...|.....
T Consensus       359 ~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  433 (467)
T COG5048         359 SSSKFSPLLNNEPPQSLQQ-----YKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYN  433 (467)
T ss_pred             CccccccccCCCCccchhh-----ccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCccc
Confidence            2222221000    00110     112222233333  235566666666667766666555  3556778888888888


Q ss_pred             HHHHHhhhCCCCceecCCCCcc
Q psy4796         236 LQTHLRIHKTEREYACGKCAYR  257 (274)
Q Consensus       236 l~~H~~~h~~~~~~~C~~C~~~  257 (274)
                      +..|++.|....++.|..++..
T Consensus       434 ~~~~~~~~~~~~~~~~~~~~~~  455 (467)
T COG5048         434 LIPHKKIHTNHAPLLCSILKSF  455 (467)
T ss_pred             ccccccccccCCceeecccccc
Confidence            8888888877776666555533


No 68 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.82  E-value=0.32  Score=32.78  Aligned_cols=54  Identities=17%  Similarity=0.403  Sum_probs=31.4

Q ss_pred             ccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHhhhCCCCceecCCCC
Q psy4796         194 VCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCA  255 (274)
Q Consensus       194 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  255 (274)
                      .|-.|+..|.......  ...-.....|+|+.|...|=..-+...|...|.      |+-|.
T Consensus        57 ~C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~------CPGC~  110 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNVFCVDCDVFVHESLHC------CPGCI  110 (112)
T ss_pred             cccCcCCCCCCccccc--ccccccccceeCCCCCCccccccchhhhhhccC------CcCCC
Confidence            4777777776542110  000112335788888888777777777776664      66554


No 69 
>KOG2893|consensus
Probab=92.80  E-value=0.028  Score=42.65  Aligned_cols=47  Identities=21%  Similarity=0.471  Sum_probs=35.7

Q ss_pred             ccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHH-HhhhC
Q psy4796         194 VCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTH-LRIHK  244 (274)
Q Consensus       194 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~  244 (274)
                      .|..|++.|.+..-|..|++..+    |.|.+|.+..-+-..|..| +++|.
T Consensus        12 wcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceeehhhhhh
Confidence            58999999999988888876544    8899998776666667666 45553


No 70 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.22  E-value=0.093  Score=27.15  Aligned_cols=24  Identities=25%  Similarity=0.682  Sum_probs=14.2

Q ss_pred             cccCcCccccCCchhHHHHHhhhCCCCceecCCCCc
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAY  256 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  256 (274)
                      |.|..||..+...            +.|..||+|+.
T Consensus         3 ~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeECC------------cCCCcCcCCCC
Confidence            6677777654432            14556777775


No 71 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.06  E-value=0.14  Score=43.94  Aligned_cols=153  Identities=21%  Similarity=0.308  Sum_probs=73.8

Q ss_pred             ceecccccccccChHHHHHHHh--hcCCC--CcccCC--CCCcccCChhHHHHHHhhhcCCCCccCCCC--CCccccHHH
Q psy4796          64 QFLCLFCSYVATARIAIKNHLS--SHLGW--KPYKCP--HCDHCFTQKVVLQRHLLTHTGEKPFACHLC--PYRASRKYY  135 (274)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C--~~~f~~~~~  135 (274)
                      ++.|..|...|.....+..|..  .|.++  +++.|+  .|++.|.....+..|...|....++.+..-  ...+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLN  368 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccC
Confidence            4555555555555555555555  45555  555565  466666666666666555555544443222  222211111


Q ss_pred             HHHHHHHHHHHHHHHhHhhcCCCccCC--CCCCCCCCChhhhhhhccCCCCCcccCCC--ccccCCCCccccCHHHHHHH
Q psy4796         136 ITAHLNSLLSALLLQHFLASQPRRKCV--HCSEPISSDMSEIIEHCLVCPNATRTDKK--KFVCFACPYATQYACYIKTH  211 (274)
Q Consensus       136 l~~H~~~~~~~~~~~~~~~~~~~~~c~--~c~~~~~~~~~~l~~h~~~~~~~~~~~~~--~~~C~~C~~~f~~~~~l~~H  211 (274)
                      -..+.....     ...........+.  .|...+.. ...+..+     ...+....  .+.+..|...+.....+..|
T Consensus       369 ~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  437 (467)
T COG5048         369 NEPPQSLQQ-----YKDLKNDKKSETLSNSCIRNFKR-DSNLSLH-----IITHLSFRPYNCKNPPCSKSFNRHYNLIPH  437 (467)
T ss_pred             CCCccchhh-----ccCccCCccccccccchhhhhcc-ccccccc-----cccccccCCcCCCCCcchhhccCccccccc
Confidence            000000000     0000111111111  12222222 2222222     33333333  46678899999999999999


Q ss_pred             HhhccCCCCcccCcCc
Q psy4796         212 VMTHTGDKPFACSYCD  227 (274)
Q Consensus       212 ~~~h~~~~~~~C~~C~  227 (274)
                      .+.+....++.|..++
T Consensus       438 ~~~~~~~~~~~~~~~~  453 (467)
T COG5048         438 KKIHTNHAPLLCSILK  453 (467)
T ss_pred             ccccccCCceeecccc
Confidence            9988877776665544


No 72 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.51  E-value=0.12  Score=34.80  Aligned_cols=14  Identities=21%  Similarity=0.636  Sum_probs=6.9

Q ss_pred             CCcccCcCccccCC
Q psy4796         219 KPFACSYCDYTCNQ  232 (274)
Q Consensus       219 ~~~~C~~C~~~f~~  232 (274)
                      .|..|+.||..|.-
T Consensus        25 ~PivCP~CG~~~~~   38 (108)
T PF09538_consen   25 DPIVCPKCGTEFPP   38 (108)
T ss_pred             CCccCCCCCCccCc
Confidence            44455555555443


No 73 
>KOG4173|consensus
Probab=91.08  E-value=0.075  Score=39.44  Aligned_cols=47  Identities=19%  Similarity=0.468  Sum_probs=24.2

Q ss_pred             ccCCCCccccCHHHHHHHHhhcc----------CCCCccc--CcCccccCCchhHHHHH
Q psy4796         194 VCFACPYATQYACYIKTHVMTHT----------GDKPFAC--SYCDYTCNQSSNLQTHL  240 (274)
Q Consensus       194 ~C~~C~~~f~~~~~l~~H~~~h~----------~~~~~~C--~~C~~~f~~~~~l~~H~  240 (274)
                      .|.+|.+.|.+...|..|+...+          |.-.|+|  ..|+..|....+.+.|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            45666666666666666654222          2233555  23555555555555554


No 74 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=90.97  E-value=0.88  Score=30.72  Aligned_cols=50  Identities=22%  Similarity=0.430  Sum_probs=33.6

Q ss_pred             ccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhcc
Q psy4796         159 RKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHT  216 (274)
Q Consensus       159 ~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  216 (274)
                      ..|-.|...|...... .       .........|.|+.|...|-..-....|...|.
T Consensus        56 ~~C~~C~~~f~~~~~~-~-------~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        56 RFCFGCQGPFPKPPVS-P-------FDELKDSHRYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             CcccCcCCCCCCcccc-c-------ccccccccceeCCCCCCccccccchhhhhhccC
Confidence            3488888888752110 0       011234557999999999998888888887775


No 75 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=90.97  E-value=0.23  Score=36.22  Aligned_cols=36  Identities=14%  Similarity=0.324  Sum_probs=27.1

Q ss_pred             cCCCCcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCCC
Q psy4796         216 TGDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTAA  260 (274)
Q Consensus       216 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  260 (274)
                      ....-|.|+.|+..|+...++.         ..|.||.||.....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLDY  140 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEeee
Confidence            3456688999999888888774         36899999986543


No 76 
>PHA00626 hypothetical protein
Probab=90.94  E-value=0.14  Score=29.28  Aligned_cols=17  Identities=24%  Similarity=0.589  Sum_probs=11.5

Q ss_pred             CCCccccCCCCccccCH
Q psy4796         189 DKKKFVCFACPYATQYA  205 (274)
Q Consensus       189 ~~~~~~C~~C~~~f~~~  205 (274)
                      ....|.|+.||..|+..
T Consensus        20 ~snrYkCkdCGY~ft~~   36 (59)
T PHA00626         20 WSDDYVCCDCGYNDSKD   36 (59)
T ss_pred             cCcceEcCCCCCeechh
Confidence            35567777777777643


No 77 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.75  E-value=0.36  Score=28.11  Aligned_cols=33  Identities=27%  Similarity=0.675  Sum_probs=17.0

Q ss_pred             CccccCCCCccccCHHHHHHHHhhccCCCCcccCcCcc
Q psy4796         191 KKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDY  228 (274)
Q Consensus       191 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  228 (274)
                      ..|.|+.||.....+..--     -.-..+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~~C-----Rk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAKC-----RKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhhhH-----HHcCCceECCCcCc
Confidence            3477888886544332111     11134577777663


No 78 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.66  E-value=0.097  Score=29.86  Aligned_cols=31  Identities=19%  Similarity=0.237  Sum_probs=20.5

Q ss_pred             ccCCCccccCCCCccccCHHHHHHHHhhccC
Q psy4796         187 RTDKKKFVCFACPYATQYACYIKTHVMTHTG  217 (274)
Q Consensus       187 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  217 (274)
                      ..++.-+.|+-||..|+.......|...-++
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3455566777777777777777777764443


No 79 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=90.33  E-value=0.21  Score=24.05  Aligned_cols=10  Identities=30%  Similarity=0.849  Sum_probs=5.7

Q ss_pred             ecCCCCccCC
Q psy4796         250 ACGKCAYRTA  259 (274)
Q Consensus       250 ~C~~C~~~f~  259 (274)
                      .|+.||+.|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4666666553


No 80 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=89.74  E-value=0.3  Score=36.31  Aligned_cols=35  Identities=14%  Similarity=0.431  Sum_probs=24.6

Q ss_pred             CCCCcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCCC
Q psy4796         217 GDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTAA  260 (274)
Q Consensus       217 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  260 (274)
                      ....|.|+.|+..|+...++.         ..|.||.||.....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            345688888888888777652         35888888875543


No 81 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.52  E-value=0.77  Score=31.10  Aligned_cols=25  Identities=20%  Similarity=0.612  Sum_probs=22.3

Q ss_pred             ccc----CcCccccCCchhHHHHHhhhCC
Q psy4796         221 FAC----SYCDYTCNQSSNLQTHLRIHKT  245 (274)
Q Consensus       221 ~~C----~~C~~~f~~~~~l~~H~~~h~~  245 (274)
                      |.|    ..|+..+.+...+.+|++.+++
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999988664


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.43  E-value=0.26  Score=26.10  Aligned_cols=11  Identities=36%  Similarity=0.761  Sum_probs=5.8

Q ss_pred             ceecCCCCccC
Q psy4796         248 EYACGKCAYRT  258 (274)
Q Consensus       248 ~~~C~~C~~~f  258 (274)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~~   35 (38)
T TIGR02098        25 KVRCGKCGHVW   35 (38)
T ss_pred             EEECCCCCCEE
Confidence            35555555544


No 83 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=89.03  E-value=0.15  Score=38.88  Aligned_cols=28  Identities=18%  Similarity=0.261  Sum_probs=17.0

Q ss_pred             CceecCCCCccCCChhHHHHHHhhhcCC
Q psy4796         247 REYACGKCAYRTAALPDLKLHLKNMHLY  274 (274)
Q Consensus       247 ~~~~C~~C~~~f~~~~~l~~H~~~~H~~  274 (274)
                      ..|.|++|+|.|.-..-+.+||...|+|
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            3477777777777777777777766653


No 84 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=88.86  E-value=0.2  Score=38.76  Aligned_cols=97  Identities=20%  Similarity=0.379  Sum_probs=54.3

Q ss_pred             hhcCCCCccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCCCCCChhhhhhhccCCCCCcccCCCcc
Q psy4796         114 THTGEKPFACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKF  193 (274)
Q Consensus       114 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~  193 (274)
                      +.++.+.|+|..|.. |.-...--.|+++        -.......|+|..|++.                       ..|
T Consensus       136 w~hGGrif~CsfC~~-flCEDDQFEHQAs--------CQvLe~E~~KC~SCNrl-----------------------Gq~  183 (314)
T PF06524_consen  136 WDHGGRIFKCSFCDN-FLCEDDQFEHQAS--------CQVLESETFKCQSCNRL-----------------------GQY  183 (314)
T ss_pred             ccCCCeEEEeecCCC-eeeccchhhhhhh--------hhhhhcccccccccccc-----------------------cch
Confidence            456778899999965 4334444455544        22355667888777642                       115


Q ss_pred             ccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHhhh
Q psy4796         194 VCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       194 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      .|-.|...|-.....+.=.+ -...+++.|+.|+.....-..|..-.+.|
T Consensus       184 sCLRCK~cfCddHvrrKg~k-y~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  184 SCLRCKICFCDDHVRRKGFK-YEKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             hhhheeeeehhhhhhhcccc-cccCCCCCCCCCCCcccccccceeeeecc
Confidence            55555555553322111111 12347788888887766655555544444


No 85 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.84  E-value=0.14  Score=39.44  Aligned_cols=24  Identities=21%  Similarity=0.170  Sum_probs=17.1

Q ss_pred             CCCeeeccccCCcchhhHHHHHhhh
Q psy4796          26 PADVTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      ++.+.||+|+..| .+..-.....+
T Consensus         3 ~k~~~CPvC~~~F-~~~~vrs~~~r   26 (214)
T PF09986_consen    3 DKKITCPVCGKEF-KTKKVRSGKIR   26 (214)
T ss_pred             CCceECCCCCCee-eeeEEEcCCce
Confidence            4568899999998 66665555555


No 86 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=88.68  E-value=0.47  Score=34.17  Aligned_cols=38  Identities=16%  Similarity=0.445  Sum_probs=24.4

Q ss_pred             CCCCcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccC
Q psy4796         217 GDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRT  258 (274)
Q Consensus       217 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  258 (274)
                      ....|.|+.|+..|.....+.- .  . ....|.||.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            4456888888888886544322 0  1 23448888888765


No 87 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=88.45  E-value=0.72  Score=26.98  Aligned_cols=11  Identities=36%  Similarity=0.757  Sum_probs=7.9

Q ss_pred             CccccCCCCcc
Q psy4796         191 KKFVCFACPYA  201 (274)
Q Consensus       191 ~~~~C~~C~~~  201 (274)
                      ..|.|+.||..
T Consensus        24 ~~F~CPnCG~~   34 (59)
T PRK14890         24 VKFLCPNCGEV   34 (59)
T ss_pred             CEeeCCCCCCe
Confidence            34788888866


No 88 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.14  E-value=0.42  Score=25.21  Aligned_cols=11  Identities=18%  Similarity=0.437  Sum_probs=5.1

Q ss_pred             ccCCCCccccC
Q psy4796         194 VCFACPYATQY  204 (274)
Q Consensus       194 ~C~~C~~~f~~  204 (274)
                      .|+.|+..|.-
T Consensus         4 ~CP~C~~~f~v   14 (37)
T PF13719_consen    4 TCPNCQTRFRV   14 (37)
T ss_pred             ECCCCCceEEc
Confidence            34445444443


No 89 
>KOG2186|consensus
Probab=87.73  E-value=0.32  Score=37.53  Aligned_cols=45  Identities=22%  Similarity=0.559  Sum_probs=22.6

Q ss_pred             eecccccccccChHHHHHHHhhcCCCCcccCCCCCcccCChhHHHHHH
Q psy4796          65 FLCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFTQKVVLQRHL  112 (274)
Q Consensus        65 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  112 (274)
                      |.|.+||.... +..+.+|+..-++ ..|.|-.|+..|.. ..+..|.
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            45555555443 3334445555444 34555555555555 4445553


No 90 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=87.55  E-value=0.43  Score=26.35  Aligned_cols=27  Identities=30%  Similarity=0.500  Sum_probs=14.5

Q ss_pred             CCceecCCCCccCCC----hhHHHHHHhhhc
Q psy4796         246 EREYACGKCAYRTAA----LPDLKLHLKNMH  272 (274)
Q Consensus       246 ~~~~~C~~C~~~f~~----~~~l~~H~~~~H  272 (274)
                      .....|.+|++.+..    .+.|.+|++..|
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            344567777776654    356777775554


No 91 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=87.45  E-value=0.51  Score=24.75  Aligned_cols=6  Identities=50%  Similarity=1.254  Sum_probs=2.3

Q ss_pred             ccCcCc
Q psy4796         222 ACSYCD  227 (274)
Q Consensus       222 ~C~~C~  227 (274)
                      +|+.|+
T Consensus        27 ~C~~C~   32 (36)
T PF13717_consen   27 RCSKCG   32 (36)
T ss_pred             ECCCCC
Confidence            333333


No 92 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=87.43  E-value=0.46  Score=26.20  Aligned_cols=11  Identities=18%  Similarity=0.751  Sum_probs=5.2

Q ss_pred             cccCCCCcccc
Q psy4796         193 FVCFACPYATQ  203 (274)
Q Consensus       193 ~~C~~C~~~f~  203 (274)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            44455554444


No 93 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=87.38  E-value=0.36  Score=35.18  Aligned_cols=24  Identities=29%  Similarity=0.707  Sum_probs=16.9

Q ss_pred             CcccCcCccccCCchhHHHHHhhhCCCCceecCCCCc
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAY  256 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  256 (274)
                      .|.|++||..+             .++.|-+||+||.
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCCC
Confidence            58888887653             3456777888874


No 94 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.11  E-value=0.34  Score=32.64  Aligned_cols=30  Identities=17%  Similarity=0.372  Sum_probs=19.4

Q ss_pred             cccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCCCh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTAAL  261 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  261 (274)
                      ..|+.||..|-...           ..|.+||.||..|.-.
T Consensus        10 R~Cp~CG~kFYDLn-----------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN-----------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC-----------CCCccCCCCCCccCcc
Confidence            46777777776532           2667777777776544


No 95 
>KOG2186|consensus
Probab=86.92  E-value=0.34  Score=37.37  Aligned_cols=46  Identities=20%  Similarity=0.476  Sum_probs=29.0

Q ss_pred             cccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHh
Q psy4796         193 FVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLR  241 (274)
Q Consensus       193 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  241 (274)
                      |.|..||...... .+..|+...++ .-|.|.-|++.|.. .++..|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            6677777665533 45557766665 44777777777766 55666643


No 96 
>KOG4173|consensus
Probab=86.62  E-value=0.31  Score=36.34  Aligned_cols=75  Identities=24%  Similarity=0.506  Sum_probs=38.5

Q ss_pred             eeccc--ccccccChHHHHHHHhhcCCCCcccCCCCCcccCChhHHHHHHhh-h---------cCCCCccC--CCCCCcc
Q psy4796          65 FLCLF--CSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFTQKVVLQRHLLT-H---------TGEKPFAC--HLCPYRA  130 (274)
Q Consensus        65 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h---------~~~~~~~C--~~C~~~f  130 (274)
                      +.|++  |.+.|.+.+....|...-++   -.|..|.+.|.+...|..|+.. |         -+...|.|  ..|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            45555  55556555555555432222   2466666666666666666432 2         12233555  4455566


Q ss_pred             ccHHHHHHHHHH
Q psy4796         131 SRKYYITAHLNS  142 (274)
Q Consensus       131 ~~~~~l~~H~~~  142 (274)
                      .+......|+-.
T Consensus       157 kT~r~RkdH~I~  168 (253)
T KOG4173|consen  157 KTSRDRKDHMIR  168 (253)
T ss_pred             hhhhhhhhHHHH
Confidence            555555555443


No 97 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=85.39  E-value=0.76  Score=22.06  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=14.6

Q ss_pred             ecCCCCccCCChhHHHHHHh
Q psy4796         250 ACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       250 ~C~~C~~~f~~~~~l~~H~~  269 (274)
                      .||+|++.+ ....+.+|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            588888887 5677888875


No 98 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.07  E-value=0.6  Score=32.08  Aligned_cols=30  Identities=10%  Similarity=0.077  Sum_probs=16.5

Q ss_pred             cccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCc
Q psy4796         193 FVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQS  233 (274)
Q Consensus       193 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  233 (274)
                      ..|+.||+.|...           ++.|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            4566666666543           23455666666665443


No 99 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=85.03  E-value=0.78  Score=27.08  Aligned_cols=47  Identities=28%  Similarity=0.550  Sum_probs=25.7

Q ss_pred             CCcccCc--CccccCCchhHHHHHhhhCCCCceecCC----CCccCCChhHHHHH
Q psy4796         219 KPFACSY--CDYTCNQSSNLQTHLRIHKTEREYACGK----CAYRTAALPDLKLH  267 (274)
Q Consensus       219 ~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~~~l~~H  267 (274)
                      .+..|+.  |...+ .+..|..|+..--..++..|+.    |+..+. ...|.+|
T Consensus         8 ~~v~C~~~cc~~~i-~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~-~~~l~~H   60 (60)
T PF02176_consen    8 RPVPCPNGCCNEMI-PRKELDDHLENECPKRPVPCPYSPYGCKERVP-REDLEEH   60 (60)
T ss_dssp             SEEE-TT--S-BEE-ECCCHHHHHHTTSTTSEEE-SS----S--EEE-HHHHHHC
T ss_pred             CEeeCCCCCcccce-eHHHHHHHHHccCCCCcEECCCCCCCCCCccc-hhHHhCC
Confidence            4566766  43333 4557788888777777778888    777653 3334433


No 100
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=84.87  E-value=0.28  Score=28.12  Aligned_cols=11  Identities=18%  Similarity=0.745  Sum_probs=5.7

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            45555555554


No 101
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=83.73  E-value=0.43  Score=26.58  Aligned_cols=11  Identities=18%  Similarity=0.791  Sum_probs=5.8

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |.|+.||..|.
T Consensus         4 y~C~~CG~~~~   14 (46)
T PRK00398          4 YKCARCGREVE   14 (46)
T ss_pred             EECCCCCCEEE
Confidence            55555555444


No 102
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=83.22  E-value=0.86  Score=23.15  Aligned_cols=8  Identities=25%  Similarity=0.791  Sum_probs=3.2

Q ss_pred             cccCcCcc
Q psy4796         221 FACSYCDY  228 (274)
Q Consensus       221 ~~C~~C~~  228 (274)
                      .+|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            34444443


No 103
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=82.29  E-value=1.1  Score=25.37  Aligned_cols=24  Identities=25%  Similarity=0.558  Sum_probs=13.3

Q ss_pred             eecCCCCccCCCh-----hHHHHHHhhhc
Q psy4796         249 YACGKCAYRTAAL-----PDLKLHLKNMH  272 (274)
Q Consensus       249 ~~C~~C~~~f~~~-----~~l~~H~~~~H  272 (274)
                      -.|..|++.+...     +.|.+|++..|
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            3456666655443     46777766433


No 104
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=81.97  E-value=0.54  Score=25.63  Aligned_cols=12  Identities=17%  Similarity=0.636  Sum_probs=6.0

Q ss_pred             ccCCCCCCCCCC
Q psy4796         159 RKCVHCSEPISS  170 (274)
Q Consensus       159 ~~c~~c~~~~~~  170 (274)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            445555554443


No 105
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=80.91  E-value=0.25  Score=38.01  Aligned_cols=11  Identities=27%  Similarity=0.933  Sum_probs=5.6

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      ..|+.||..|.
T Consensus        49 ~vCP~CgyA~~   59 (214)
T PF09986_consen   49 WVCPHCGYAAF   59 (214)
T ss_pred             EECCCCCCccc
Confidence            44555555444


No 106
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=80.70  E-value=1.9  Score=31.46  Aligned_cols=34  Identities=21%  Similarity=0.328  Sum_probs=24.0

Q ss_pred             CCCCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCcc
Q psy4796          88 LGWKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRA  130 (274)
Q Consensus        88 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  130 (274)
                      .+..-|.|+.|+..|+.-..+.         ..|.||.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            4455678888888877777664         258888888755


No 107
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=80.58  E-value=0.88  Score=31.89  Aligned_cols=22  Identities=32%  Similarity=0.544  Sum_probs=9.0

Q ss_pred             eecCCCCccCCChhHHHHHHhhhcC
Q psy4796         249 YACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      ..|-+||+.|..   |.+|++.|||
T Consensus        73 i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eEEccCCcccch---HHHHHHHccC
Confidence            455555555532   3455555554


No 108
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=79.54  E-value=0.84  Score=24.49  Aligned_cols=11  Identities=18%  Similarity=0.742  Sum_probs=5.0

Q ss_pred             ccCCCCCCCCC
Q psy4796         159 RKCVHCSEPIS  169 (274)
Q Consensus       159 ~~c~~c~~~~~  169 (274)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            34444444443


No 109
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.48  E-value=3.7  Score=29.52  Aligned_cols=38  Identities=29%  Similarity=0.504  Sum_probs=21.4

Q ss_pred             CCCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCcc
Q psy4796          89 GWKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRA  130 (274)
Q Consensus        89 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  130 (274)
                      +..-|.|+.|+..|.....+.. .  . ....|.||.|+...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            3445777777777775443321 0  1 12337777777755


No 110
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=79.14  E-value=0.98  Score=25.44  Aligned_cols=10  Identities=20%  Similarity=0.839  Sum_probs=4.8

Q ss_pred             cccCcCcccc
Q psy4796         221 FACSYCDYTC  230 (274)
Q Consensus       221 ~~C~~C~~~f  230 (274)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4444444444


No 111
>PRK04023 DNA polymerase II large subunit; Validated
Probab=78.42  E-value=3.2  Score=39.07  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=7.7

Q ss_pred             eecCCCCccCCC
Q psy4796         249 YACGKCAYRTAA  260 (274)
Q Consensus       249 ~~C~~C~~~f~~  260 (274)
                      |.|+.|+..-..
T Consensus       664 y~CPKCG~El~~  675 (1121)
T PRK04023        664 DECEKCGREPTP  675 (1121)
T ss_pred             CcCCCCCCCCCc
Confidence            667777765443


No 112
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=78.33  E-value=3.1  Score=33.99  Aligned_cols=28  Identities=21%  Similarity=0.548  Sum_probs=20.2

Q ss_pred             hhhCCCCceecCCCC-ccCCChhHHHHHH
Q psy4796         241 RIHKTEREYACGKCA-YRTAALPDLKLHL  268 (274)
Q Consensus       241 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~  268 (274)
                      +.|.-.+.|.|.+|| +++.-...+.+|.
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhh
Confidence            344445569999999 6777777788776


No 113
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=77.93  E-value=1.6  Score=30.11  Aligned_cols=31  Identities=13%  Similarity=0.108  Sum_probs=19.2

Q ss_pred             eecccccccccChHHHHHHHhhcCCCCcccCCCCCcccCChh
Q psy4796          65 FLCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFTQKV  106 (274)
Q Consensus        65 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  106 (274)
                      ..|+.||+.|...           +..|..|+.||..|....
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~~   40 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPEE   40 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcch
Confidence            3577777777532           335677777777765553


No 114
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=77.37  E-value=1.6  Score=25.70  Aligned_cols=10  Identities=20%  Similarity=0.106  Sum_probs=4.8

Q ss_pred             hhHHHHHhhh
Q psy4796          41 VMKDMIRHGR   50 (274)
Q Consensus        41 ~~~~l~~H~~   50 (274)
                      .+..|..|+.
T Consensus        22 ~r~~l~~H~~   31 (60)
T PF02176_consen   22 PRKELDDHLE   31 (60)
T ss_dssp             ECCCHHHHHH
T ss_pred             eHHHHHHHHH
Confidence            3445555554


No 115
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=76.92  E-value=1.7  Score=31.75  Aligned_cols=23  Identities=39%  Similarity=1.054  Sum_probs=17.3

Q ss_pred             ccccCCCCccccCHHHHHHHHhhccCCCCcccCcCc
Q psy4796         192 KFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCD  227 (274)
Q Consensus       192 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  227 (274)
                      .|.|++||..             +.++-|-.||+||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            6888888865             4456778888887


No 116
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=76.58  E-value=2.8  Score=31.22  Aligned_cols=34  Identities=24%  Similarity=0.465  Sum_probs=24.6

Q ss_pred             CCCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCccc
Q psy4796          89 GWKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRAS  131 (274)
Q Consensus        89 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  131 (274)
                      +..-|.|+.|+..|+.-..+.         ..|.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            445688888888887776653         2588999988653


No 117
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=75.58  E-value=3.1  Score=31.90  Aligned_cols=30  Identities=13%  Similarity=0.262  Sum_probs=21.3

Q ss_pred             CccCCCCCCccccHHHHHHHHHHHHHHHHH
Q psy4796         120 PFACHLCPYRASRKYYITAHLNSLLSALLL  149 (274)
Q Consensus       120 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  149 (274)
                      .|.|+.|++.|.-...+..||...|.+.+.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e~ve  106 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPEKVE  106 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHHHHH
Confidence            488888888888888888888887775544


No 118
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=75.14  E-value=1.6  Score=31.55  Aligned_cols=12  Identities=25%  Similarity=0.387  Sum_probs=5.7

Q ss_pred             cccCCCCccccC
Q psy4796         193 FVCFACPYATQY  204 (274)
Q Consensus       193 ~~C~~C~~~f~~  204 (274)
                      +.|+.||+.|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            444445444443


No 119
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=75.04  E-value=0.66  Score=28.65  Aligned_cols=15  Identities=20%  Similarity=0.467  Sum_probs=8.1

Q ss_pred             CCCcccC--cCccccCC
Q psy4796         218 DKPFACS--YCDYTCNQ  232 (274)
Q Consensus       218 ~~~~~C~--~C~~~f~~  232 (274)
                      +..++|.  .||.+|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            4445554  56665554


No 120
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=74.93  E-value=1.5  Score=21.86  Aligned_cols=11  Identities=18%  Similarity=0.540  Sum_probs=6.4

Q ss_pred             CCceecCCCCc
Q psy4796         246 EREYACGKCAY  256 (274)
Q Consensus       246 ~~~~~C~~C~~  256 (274)
                      ...|.|+.|+.
T Consensus        17 ~~~~vCp~C~~   27 (30)
T PF08274_consen   17 GELLVCPECGH   27 (30)
T ss_dssp             SSSEEETTTTE
T ss_pred             CCEEeCCcccc
Confidence            34466666664


No 121
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=73.51  E-value=2  Score=19.92  Aligned_cols=6  Identities=33%  Similarity=1.154  Sum_probs=2.9

Q ss_pred             cCCCCc
Q psy4796         251 CGKCAY  256 (274)
Q Consensus       251 C~~C~~  256 (274)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            454543


No 122
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=72.43  E-value=2.7  Score=25.17  Aligned_cols=49  Identities=16%  Similarity=0.294  Sum_probs=31.9

Q ss_pred             CCCCeeeccccCCcchhh---HHHHHhhhccccccccccCCcceecccccccc
Q psy4796          25 PPADVTCLHCSLTTPCVM---KDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVA   74 (274)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~---~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f   74 (274)
                      +...|.|..|+..+ -..   .....|.+..++...+........|-.|+...
T Consensus         8 ~~~lw~CL~Cg~~~-C~~~~~~Ha~~H~~~~~H~l~v~~~~~~i~C~~C~~~v   59 (63)
T PF02148_consen    8 NSNLWLCLTCGYVG-CGRYSNGHALKHYKETGHPLAVSLSTGSIWCYACDDYV   59 (63)
T ss_dssp             SSSEEEETTTS-EE-ETTTSTSHHHHHHHHHT--EEEETTTTCEEETTTTEEE
T ss_pred             CCceEEeCCCCccc-ccCCcCcHHHHhhcccCCeEEEECCCCeEEEcCCCcEE
Confidence            35578899998877 553   56777777666666666666667777776543


No 123
>PF14353 CpXC:  CpXC protein
Probab=72.10  E-value=4.6  Score=28.20  Aligned_cols=15  Identities=20%  Similarity=0.498  Sum_probs=8.0

Q ss_pred             cccCcCccccCCchh
Q psy4796         221 FACSYCDYTCNQSSN  235 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~  235 (274)
                      |.|+.||..|.-...
T Consensus        39 ~~CP~Cg~~~~~~~p   53 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYP   53 (128)
T ss_pred             EECCCCCCceecCCC
Confidence            556666655554433


No 124
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=71.36  E-value=2.9  Score=32.60  Aligned_cols=22  Identities=23%  Similarity=0.569  Sum_probs=13.4

Q ss_pred             CCCccCCCCCCccccHHHHHHH
Q psy4796         118 EKPFACHLCPYRASRKYYITAH  139 (274)
Q Consensus       118 ~~~~~C~~C~~~f~~~~~l~~H  139 (274)
                      .+++.||.|+........|..-
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmS  228 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMS  228 (314)
T ss_pred             CCCCCCCCCCCcccccccceee
Confidence            4667777777766555544433


No 125
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=69.63  E-value=2  Score=26.45  Aligned_cols=10  Identities=20%  Similarity=0.531  Sum_probs=6.3

Q ss_pred             eeeccccCCc
Q psy4796          29 VTCLHCSLTT   38 (274)
Q Consensus        29 ~~C~~C~~~f   38 (274)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            6666666655


No 126
>KOG3408|consensus
Probab=68.49  E-value=6  Score=27.00  Aligned_cols=33  Identities=15%  Similarity=0.219  Sum_probs=26.8

Q ss_pred             CCCCCCCCCCCeeeccccCCcchhhHHHHHhhhc
Q psy4796          18 DKASPGPPPADVTCLHCSLTTPCVMKDMIRHGRL   51 (274)
Q Consensus        18 ~~~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~   51 (274)
                      +.++..++..-|-|..|.+.| .+...|..|.+.
T Consensus        47 ~~D~dlPG~GqfyCi~CaRyF-i~~~~l~~H~kt   79 (129)
T KOG3408|consen   47 EIDPDLPGGGQFYCIECARYF-IDAKALKTHFKT   79 (129)
T ss_pred             cCCCCCCCCceeehhhhhhhh-cchHHHHHHHhc
Confidence            445566666679999999999 999999999873


No 127
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=67.47  E-value=7.8  Score=37.67  Aligned_cols=29  Identities=14%  Similarity=0.485  Sum_probs=15.4

Q ss_pred             CcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCC
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTA  259 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  259 (274)
                      +|.|+.||.......         ++  ...|+.|+....
T Consensus       692 vy~CPsCGaev~~de---------s~--a~~CP~CGtplv  720 (1337)
T PRK14714        692 VYVCPDCGAEVPPDE---------SG--RVECPRCDVELT  720 (1337)
T ss_pred             ceeCccCCCccCCCc---------cc--cccCCCCCCccc
Confidence            467777776543211         11  345777775443


No 128
>PRK04023 DNA polymerase II large subunit; Validated
Probab=66.98  E-value=7.5  Score=36.80  Aligned_cols=10  Identities=20%  Similarity=0.301  Sum_probs=5.6

Q ss_pred             cccCCCCccc
Q psy4796         193 FVCFACPYAT  202 (274)
Q Consensus       193 ~~C~~C~~~f  202 (274)
                      +.|+.||...
T Consensus       664 y~CPKCG~El  673 (1121)
T PRK04023        664 DECEKCGREP  673 (1121)
T ss_pred             CcCCCCCCCC
Confidence            4566666543


No 129
>PF12907 zf-met2:  Zinc-binding
Probab=66.97  E-value=3  Score=22.42  Aligned_cols=25  Identities=32%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             eecCCCCccCCC---hhHHHHHHhhhcC
Q psy4796         249 YACGKCAYRTAA---LPDLKLHLKNMHL  273 (274)
Q Consensus       249 ~~C~~C~~~f~~---~~~l~~H~~~~H~  273 (274)
                      +.|.+|..+|..   ...|..|....|.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHp   29 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHP   29 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCC
Confidence            456777744433   3457777666554


No 130
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=66.63  E-value=3.8  Score=22.30  Aligned_cols=22  Identities=36%  Similarity=0.958  Sum_probs=17.1

Q ss_pred             cccCcCccccCCchhHHHHHhh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRI  242 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~  242 (274)
                      |.|-.|..+..-++.|..||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            7788888888778888877764


No 131
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=66.59  E-value=3.4  Score=27.52  Aligned_cols=13  Identities=15%  Similarity=0.404  Sum_probs=7.0

Q ss_pred             CCCcccCcCcccc
Q psy4796         218 DKPFACSYCDYTC  230 (274)
Q Consensus       218 ~~~~~C~~C~~~f  230 (274)
                      ..|..|+.||++|
T Consensus        24 rdPiVsPytG~s~   36 (129)
T COG4530          24 RDPIVSPYTGKSY   36 (129)
T ss_pred             CCccccCcccccc
Confidence            3445555555555


No 132
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=66.29  E-value=5.6  Score=21.50  Aligned_cols=23  Identities=17%  Similarity=0.447  Sum_probs=12.7

Q ss_pred             cccCcCccccCC--chhHHHHHhhh
Q psy4796         221 FACSYCDYTCNQ--SSNLQTHLRIH  243 (274)
Q Consensus       221 ~~C~~C~~~f~~--~~~l~~H~~~h  243 (274)
                      -.|+.||..|..  ..+-..|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            456666666553  34445555555


No 133
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=65.79  E-value=3.5  Score=28.96  Aligned_cols=25  Identities=28%  Similarity=0.472  Sum_probs=13.5

Q ss_pred             CcccCcCccccCCchhHHHHHhhhCCCC
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHKTER  247 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~  247 (274)
                      ...|-+||+.|..   |++|++.|+|..
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             eeEEccCCcccch---HHHHHHHccCCC
Confidence            3677778877764   477887776553


No 134
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=64.23  E-value=5.2  Score=27.83  Aligned_cols=20  Identities=25%  Similarity=0.388  Sum_probs=10.1

Q ss_pred             cccCcCccccCCchhHHHHHhhh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      ..|-++|+.|.   .|++|+.+|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~   96 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTH   96 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcc
Confidence            44555555554   245555554


No 135
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=64.16  E-value=3.9  Score=20.94  Aligned_cols=22  Identities=18%  Similarity=0.300  Sum_probs=16.4

Q ss_pred             CeeeccccCCcchhhHHHHHhhhc
Q psy4796          28 DVTCLHCSLTTPCVMKDMIRHGRL   51 (274)
Q Consensus        28 ~~~C~~C~~~f~~~~~~l~~H~~~   51 (274)
                      .+.|+.|++.+  ....+..|+..
T Consensus         4 ~~~C~nC~R~v--~a~RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPV--AASRFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEE--EGGGHHHHHHH
T ss_pred             eEECCCCcCCc--chhhhHHHHHH
Confidence            47899998887  77778888764


No 136
>KOG4602|consensus
Probab=63.02  E-value=12  Score=29.29  Aligned_cols=56  Identities=16%  Similarity=0.336  Sum_probs=34.3

Q ss_pred             CCCCCCCCCeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccC
Q psy4796          20 ASPGPPPADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATA   76 (274)
Q Consensus        20 ~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~   76 (274)
                      ..++....++.|..|--.- .....+..|...-+...|.-...+.|.|++||-+-.+
T Consensus       225 P~pg~Q~r~l~CvFC~nN~-E~~A~y~tH~lkd~dgRVLCPkLR~YVCPiCGATgDn  280 (318)
T KOG4602|consen  225 PPPGNQPRPLCCVFCFNNA-EEFARYHTHPLKDKDGRVLCPKLRSYVCPICGATGDN  280 (318)
T ss_pred             CCCCCCCCceeEEeecCCC-chhhheecccccCCCCcEechhHhhhcCccccccCCc
Confidence            3445555668899996555 5556667777643333333344456778888876543


No 137
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=62.61  E-value=6.5  Score=25.11  Aligned_cols=12  Identities=17%  Similarity=0.351  Sum_probs=5.7

Q ss_pred             ccccCCCCcccc
Q psy4796         192 KFVCFACPYATQ  203 (274)
Q Consensus       192 ~~~C~~C~~~f~  203 (274)
                      .+.|..||..|.
T Consensus        53 IW~C~kCg~~fA   64 (89)
T COG1997          53 IWKCRKCGAKFA   64 (89)
T ss_pred             eEEcCCCCCeec
Confidence            344555555443


No 138
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=62.07  E-value=6.1  Score=30.69  Aligned_cols=14  Identities=21%  Similarity=0.394  Sum_probs=7.8

Q ss_pred             CccccCCCCccccC
Q psy4796         191 KKFVCFACPYATQY  204 (274)
Q Consensus       191 ~~~~C~~C~~~f~~  204 (274)
                      ..|.|+.|+..|+.
T Consensus       154 aef~C~~C~h~F~G  167 (278)
T PF15135_consen  154 AEFHCPKCRHNFRG  167 (278)
T ss_pred             eeeecccccccchh
Confidence            34556666666554


No 139
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=62.01  E-value=3.1  Score=29.47  Aligned_cols=13  Identities=23%  Similarity=0.429  Sum_probs=10.1

Q ss_pred             CCCeeeccccCCc
Q psy4796          26 PADVTCLHCSLTT   38 (274)
Q Consensus        26 ~~~~~C~~C~~~f   38 (274)
                      +..+.|..||..|
T Consensus        68 p~~~~C~~CG~~~   80 (135)
T PRK03824         68 EAVLKCRNCGNEW   80 (135)
T ss_pred             ceEEECCCCCCEE
Confidence            3458899998888


No 140
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=61.62  E-value=5.5  Score=22.65  Aligned_cols=9  Identities=44%  Similarity=1.276  Sum_probs=4.5

Q ss_pred             cccCcCccc
Q psy4796         221 FACSYCDYT  229 (274)
Q Consensus       221 ~~C~~C~~~  229 (274)
                      +.|..||.+
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            455555543


No 141
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=61.44  E-value=12  Score=20.73  Aligned_cols=11  Identities=27%  Similarity=0.782  Sum_probs=6.3

Q ss_pred             CCceecCCCCc
Q psy4796         246 EREYACGKCAY  256 (274)
Q Consensus       246 ~~~~~C~~C~~  256 (274)
                      ...|.|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            34566666654


No 142
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=61.29  E-value=4.6  Score=18.98  Aligned_cols=7  Identities=29%  Similarity=1.336  Sum_probs=3.5

Q ss_pred             eecCCCC
Q psy4796         249 YACGKCA  255 (274)
Q Consensus       249 ~~C~~C~  255 (274)
                      |.||.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4555554


No 143
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=60.21  E-value=2.8  Score=20.50  Aligned_cols=19  Identities=21%  Similarity=0.399  Sum_probs=10.7

Q ss_pred             eeeccccCCcchhhHHHHHhh
Q psy4796          29 VTCLHCSLTTPCVMKDMIRHG   49 (274)
Q Consensus        29 ~~C~~C~~~f~~~~~~l~~H~   49 (274)
                      |.|..|++.|  ....+..|.
T Consensus         1 ~sCiDC~~~F--~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF--DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE--EGGGTTT--
T ss_pred             CeeecCCCCc--CcCCcCCCC
Confidence            4577777777  555555554


No 144
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=60.08  E-value=4.5  Score=28.89  Aligned_cols=33  Identities=30%  Similarity=0.815  Sum_probs=18.9

Q ss_pred             CcccCcCccccCCchhHHHHHhhhCCCCceecCCCCcc
Q psy4796         220 PFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYR  257 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  257 (274)
                      +|.|. |+..|.+.   ++|-.+-.|+ .|.|..|+-.
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            46776 76665443   3444444455 6777777654


No 145
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=60.04  E-value=6.3  Score=21.43  Aligned_cols=9  Identities=33%  Similarity=0.933  Sum_probs=3.7

Q ss_pred             eeccccccc
Q psy4796          65 FLCLFCSYV   73 (274)
Q Consensus        65 ~~C~~C~~~   73 (274)
                      +.|+.||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            345555443


No 146
>KOG2593|consensus
Probab=59.81  E-value=6.8  Score=33.16  Aligned_cols=41  Identities=15%  Similarity=0.285  Sum_probs=27.7

Q ss_pred             ccCCcceecccccccccChHHHHHHHhhcCCCCcccCCCCCccc
Q psy4796          59 TSAKLQFLCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCF  102 (274)
Q Consensus        59 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  102 (274)
                      -+....|.|+.|.++|....+++.   .-.....|.|..|+-..
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGGEL  163 (436)
T ss_pred             ccccccccCCccccchhhhHHHHh---hcccCceEEEecCCCch
Confidence            344556899999999987766543   22223468999998654


No 147
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=59.46  E-value=7.5  Score=22.46  Aligned_cols=10  Identities=20%  Similarity=0.428  Sum_probs=4.9

Q ss_pred             ccCCCCcccc
Q psy4796         194 VCFACPYATQ  203 (274)
Q Consensus       194 ~C~~C~~~f~  203 (274)
                      .|+.||+.|.
T Consensus         7 ~C~~Cg~~~~   16 (54)
T PF14446_consen    7 KCPVCGKKFK   16 (54)
T ss_pred             cChhhCCccc
Confidence            4555555443


No 148
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=58.40  E-value=4.2  Score=32.63  Aligned_cols=23  Identities=22%  Similarity=0.580  Sum_probs=12.2

Q ss_pred             cccCcCccccCCchhHHHHHhhh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIH  243 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h  243 (274)
                      |+|+.|...|-..-+...|...|
T Consensus       389 Y~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         389 YQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             eechhhhhhhhhhhHHHHHHHHh
Confidence            55555555555555555554444


No 149
>KOG1280|consensus
Probab=57.93  E-value=9  Score=31.41  Aligned_cols=41  Identities=24%  Similarity=0.510  Sum_probs=30.7

Q ss_pred             cCCCCcccCcCccccCCchhHHHHHhhhCCCCc--eecCCCCc
Q psy4796         216 TGDKPFACSYCDYTCNQSSNLQTHLRIHKTERE--YACGKCAY  256 (274)
Q Consensus       216 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~~  256 (274)
                      -....|.|+.|+..=.....|..|+..-+.+.+  -.|++|+.
T Consensus        75 y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   75 YDPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             cccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            345579999999977788899999987555544  35788774


No 150
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=57.85  E-value=2.4  Score=22.80  Aligned_cols=10  Identities=50%  Similarity=1.082  Sum_probs=6.4

Q ss_pred             eecCCCCccC
Q psy4796         249 YACGKCAYRT  258 (274)
Q Consensus       249 ~~C~~C~~~f  258 (274)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6666666654


No 151
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=57.81  E-value=8.1  Score=35.65  Aligned_cols=11  Identities=27%  Similarity=0.673  Sum_probs=5.6

Q ss_pred             CCCcccCcCcc
Q psy4796         218 DKPFACSYCDY  228 (274)
Q Consensus       218 ~~~~~C~~C~~  228 (274)
                      ..|..|+.||.
T Consensus       473 ~~p~~Cp~Cgs  483 (730)
T COG1198         473 PIPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCCC
Confidence            34455555553


No 152
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=56.56  E-value=10  Score=21.58  Aligned_cols=8  Identities=38%  Similarity=0.937  Sum_probs=4.4

Q ss_pred             cccCCCCc
Q psy4796         193 FVCFACPY  200 (274)
Q Consensus       193 ~~C~~C~~  200 (274)
                      |.|+.|+.
T Consensus        35 w~CP~C~a   42 (50)
T cd00730          35 WVCPVCGA   42 (50)
T ss_pred             CCCCCCCC
Confidence            55555553


No 153
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=56.28  E-value=5.4  Score=20.86  Aligned_cols=29  Identities=14%  Similarity=0.269  Sum_probs=14.3

Q ss_pred             ecccccccccChHHHHHHHhhcCCCCcccCCCCCccc
Q psy4796          66 LCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCF  102 (274)
Q Consensus        66 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  102 (274)
                      .|+.||..|...        ......+-.|..|+..+
T Consensus         3 ~C~~Cg~~Yh~~--------~~pP~~~~~Cd~cg~~L   31 (36)
T PF05191_consen    3 ICPKCGRIYHIE--------FNPPKVEGVCDNCGGEL   31 (36)
T ss_dssp             EETTTTEEEETT--------TB--SSTTBCTTTTEBE
T ss_pred             CcCCCCCccccc--------cCCCCCCCccCCCCCee
Confidence            466666666422        12233345566666544


No 154
>KOG2636|consensus
Probab=56.10  E-value=13  Score=31.73  Aligned_cols=23  Identities=30%  Similarity=0.769  Sum_probs=13.0

Q ss_pred             Ccceeccccc-ccccChHHHHHHH
Q psy4796          62 KLQFLCLFCS-YVATARIAIKNHL   84 (274)
Q Consensus        62 ~~~~~C~~C~-~~f~~~~~l~~H~   84 (274)
                      ...|.|.+|| +++....++.+|.
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHh
Confidence            4456666665 5555555555554


No 155
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=54.61  E-value=7.7  Score=25.94  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=5.8

Q ss_pred             eecCCCCccCC
Q psy4796         249 YACGKCAYRTA  259 (274)
Q Consensus       249 ~~C~~C~~~f~  259 (274)
                      |.||.|+....
T Consensus        20 ~iCpeC~~EW~   30 (109)
T TIGR00686        20 LICPSCLYEWN   30 (109)
T ss_pred             eECcccccccc
Confidence            55555555443


No 156
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=54.58  E-value=9.3  Score=20.51  Aligned_cols=20  Identities=15%  Similarity=0.127  Sum_probs=11.4

Q ss_pred             CceecCCCCccCCChhHHHH
Q psy4796         247 REYACGKCAYRTAALPDLKL  266 (274)
Q Consensus       247 ~~~~C~~C~~~f~~~~~l~~  266 (274)
                      ..+.|+.|+-.+-+..+|.+
T Consensus        18 ~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEECCCCCeEEccHHHHHH
Confidence            34566666666666555543


No 157
>PRK10220 hypothetical protein; Provisional
Probab=54.47  E-value=9.1  Score=25.62  Aligned_cols=11  Identities=36%  Similarity=0.800  Sum_probs=5.7

Q ss_pred             eecCCCCccCC
Q psy4796         249 YACGKCAYRTA  259 (274)
Q Consensus       249 ~~C~~C~~~f~  259 (274)
                      |.|+.|+..+.
T Consensus        21 ~vCpeC~hEW~   31 (111)
T PRK10220         21 YICPECAHEWN   31 (111)
T ss_pred             EECCcccCcCC
Confidence            55555555443


No 158
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=54.30  E-value=4.9  Score=36.98  Aligned_cols=15  Identities=13%  Similarity=0.374  Sum_probs=11.5

Q ss_pred             hCCCCceecCCCCcc
Q psy4796         243 HKTEREYACGKCAYR  257 (274)
Q Consensus       243 h~~~~~~~C~~C~~~  257 (274)
                      +....|..|+.||-.
T Consensus       470 ~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            445678899999965


No 159
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=53.92  E-value=11  Score=26.33  Aligned_cols=11  Identities=18%  Similarity=0.389  Sum_probs=5.0

Q ss_pred             ccCCCCCCccc
Q psy4796         121 FACHLCPYRAS  131 (274)
Q Consensus       121 ~~C~~C~~~f~  131 (274)
                      ++|..|++.|.
T Consensus         2 H~Ct~Cg~~f~   12 (131)
T PF09845_consen    2 HQCTKCGRVFE   12 (131)
T ss_pred             cccCcCCCCcC
Confidence            34444444443


No 160
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=53.20  E-value=4.6  Score=26.49  Aligned_cols=12  Identities=33%  Similarity=0.681  Sum_probs=6.5

Q ss_pred             CCccccCCCCcc
Q psy4796         190 KKKFVCFACPYA  201 (274)
Q Consensus       190 ~~~~~C~~C~~~  201 (274)
                      ++.|.|+.||..
T Consensus        20 ~k~FtCp~Cghe   31 (104)
T COG4888          20 PKTFTCPRCGHE   31 (104)
T ss_pred             CceEecCccCCe
Confidence            344566666644


No 161
>KOG2593|consensus
Probab=52.94  E-value=15  Score=31.21  Aligned_cols=41  Identities=27%  Similarity=0.516  Sum_probs=29.8

Q ss_pred             cCCCCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCcc
Q psy4796          87 HLGWKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRA  130 (274)
Q Consensus        87 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  130 (274)
                      -+....|.|+.|.+.|+....++   ..-...-.|.|..|+-..
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGEL  163 (436)
T ss_pred             ccccccccCCccccchhhhHHHH---hhcccCceEEEecCCCch
Confidence            34556799999999998776553   233334569999999865


No 162
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=52.63  E-value=7.5  Score=28.17  Aligned_cols=15  Identities=27%  Similarity=0.208  Sum_probs=9.1

Q ss_pred             eecccccccccChHH
Q psy4796          65 FLCLFCSYVATARIA   79 (274)
Q Consensus        65 ~~C~~C~~~f~~~~~   79 (274)
                      ++|+.||+.|.....
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            566666666665543


No 163
>KOG2071|consensus
Probab=52.32  E-value=12  Score=33.22  Aligned_cols=17  Identities=18%  Similarity=0.563  Sum_probs=13.2

Q ss_pred             CCCccCCCCCCccccHH
Q psy4796         118 EKPFACHLCPYRASRKY  134 (274)
Q Consensus       118 ~~~~~C~~C~~~f~~~~  134 (274)
                      +....|++|+..|...+
T Consensus       511 e~~~~C~IC~EkFe~v~  527 (579)
T KOG2071|consen  511 ERQASCPICQEKFEVVF  527 (579)
T ss_pred             ccccCCcccccccceee
Confidence            56688999999886554


No 164
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=51.68  E-value=11  Score=21.78  Aligned_cols=10  Identities=20%  Similarity=0.554  Sum_probs=5.2

Q ss_pred             cccCCCCccc
Q psy4796         193 FVCFACPYAT  202 (274)
Q Consensus       193 ~~C~~C~~~f  202 (274)
                      ..|+.||..+
T Consensus        23 V~Cp~CGael   32 (54)
T TIGR01206        23 VICDECGAEL   32 (54)
T ss_pred             EeCCCCCCEE
Confidence            4555555543


No 165
>KOG4124|consensus
Probab=50.17  E-value=2.7  Score=34.26  Aligned_cols=50  Identities=32%  Similarity=0.639  Sum_probs=28.1

Q ss_pred             CCcccCc--CccccCCchhHHHHHhh-hC------------------CCCceecCCCCccCCChhHHHHHH
Q psy4796         219 KPFACSY--CDYTCNQSSNLQTHLRI-HK------------------TEREYACGKCAYRTAALPDLKLHL  268 (274)
Q Consensus       219 ~~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~~~~~C~~C~~~f~~~~~l~~H~  268 (274)
                      ++|.|++  |++.+.....|+.|... |.                  ..|+|.|++|.+....-..|.-|+
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            4566633  66666655555555332 21                  246677888777776655554443


No 166
>KOG2807|consensus
Probab=50.16  E-value=29  Score=28.37  Aligned_cols=20  Identities=25%  Similarity=0.416  Sum_probs=14.8

Q ss_pred             eecCCCCccCCChhHHHHHH
Q psy4796         249 YACGKCAYRTAALPDLKLHL  268 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~  268 (274)
                      |.|..|...|..--+...|-
T Consensus       346 y~C~~Ck~~FCldCDv~iHe  365 (378)
T KOG2807|consen  346 YRCESCKNVFCLDCDVFIHE  365 (378)
T ss_pred             EEchhccceeeccchHHHHh
Confidence            88888888887766655554


No 167
>KOG3507|consensus
Probab=50.06  E-value=25  Score=20.61  Aligned_cols=15  Identities=13%  Similarity=0.279  Sum_probs=9.5

Q ss_pred             CCCCCeeeccccCCc
Q psy4796          24 PPPADVTCLHCSLTT   38 (274)
Q Consensus        24 ~~~~~~~C~~C~~~f   38 (274)
                      .....|.|..|+..-
T Consensus        16 ~~~miYiCgdC~~en   30 (62)
T KOG3507|consen   16 TATMIYICGDCGQEN   30 (62)
T ss_pred             cccEEEEeccccccc
Confidence            344457777777665


No 168
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=49.52  E-value=11  Score=27.07  Aligned_cols=16  Identities=19%  Similarity=0.364  Sum_probs=8.4

Q ss_pred             CcccCcCccccCCchh
Q psy4796         220 PFACSYCDYTCNQSSN  235 (274)
Q Consensus       220 ~~~C~~C~~~f~~~~~  235 (274)
                      .|.|+.||+.|..-++
T Consensus       124 f~~C~~C~kiyW~GsH  139 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSH  139 (147)
T ss_pred             EEECCCCCCEeccccc
Confidence            4555555555554443


No 169
>KOG2807|consensus
Probab=49.23  E-value=28  Score=28.48  Aligned_cols=20  Identities=15%  Similarity=0.300  Sum_probs=10.8

Q ss_pred             ccCCCCCCccccHHHHHHHH
Q psy4796         121 FACHLCPYRASRKYYITAHL  140 (274)
Q Consensus       121 ~~C~~C~~~f~~~~~l~~H~  140 (274)
                      |.|+.|...|-..-+.-.|-
T Consensus       346 y~C~~Ck~~FCldCDv~iHe  365 (378)
T KOG2807|consen  346 YRCESCKNVFCLDCDVFIHE  365 (378)
T ss_pred             EEchhccceeeccchHHHHh
Confidence            55666665555555544443


No 170
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=48.59  E-value=23  Score=22.96  Aligned_cols=12  Identities=17%  Similarity=0.484  Sum_probs=6.3

Q ss_pred             ccccCCCCcccc
Q psy4796         192 KFVCFACPYATQ  203 (274)
Q Consensus       192 ~~~C~~C~~~f~  203 (274)
                      .+.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PTZ00255         54 IWRCKGCKKTVA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            355555555554


No 171
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=47.73  E-value=21  Score=24.97  Aligned_cols=13  Identities=15%  Similarity=0.363  Sum_probs=7.5

Q ss_pred             ecCCCCccCCChh
Q psy4796         250 ACGKCAYRTAALP  262 (274)
Q Consensus       250 ~C~~C~~~f~~~~  262 (274)
                      +||.|..+|.+.+
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            5666666665543


No 172
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=47.43  E-value=9.7  Score=25.98  Aligned_cols=11  Identities=18%  Similarity=0.664  Sum_probs=5.7

Q ss_pred             cccCCCCcccc
Q psy4796         193 FVCFACPYATQ  203 (274)
Q Consensus       193 ~~C~~C~~~f~  203 (274)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            55555554444


No 173
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=47.31  E-value=17  Score=20.42  Aligned_cols=12  Identities=42%  Similarity=1.065  Sum_probs=6.9

Q ss_pred             ccccCCCCcccc
Q psy4796         192 KFVCFACPYATQ  203 (274)
Q Consensus       192 ~~~C~~C~~~f~  203 (274)
                      .+.|+.||..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            466666665543


No 174
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=46.91  E-value=11  Score=21.10  Aligned_cols=8  Identities=38%  Similarity=0.937  Sum_probs=3.2

Q ss_pred             cccCCCCc
Q psy4796         193 FVCFACPY  200 (274)
Q Consensus       193 ~~C~~C~~  200 (274)
                      |.|+.|+.
T Consensus        35 w~CP~C~a   42 (47)
T PF00301_consen   35 WVCPVCGA   42 (47)
T ss_dssp             -B-TTTSS
T ss_pred             CcCcCCCC
Confidence            55555553


No 175
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=46.82  E-value=14  Score=24.32  Aligned_cols=13  Identities=23%  Similarity=0.744  Sum_probs=7.9

Q ss_pred             CccCCCCCCCCCC
Q psy4796         158 RRKCVHCSEPISS  170 (274)
Q Consensus       158 ~~~c~~c~~~~~~  170 (274)
                      +..|..||..|..
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            4456666666665


No 176
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=46.40  E-value=13  Score=17.67  Aligned_cols=7  Identities=29%  Similarity=0.838  Sum_probs=3.4

Q ss_pred             ccCcCcc
Q psy4796         222 ACSYCDY  228 (274)
Q Consensus       222 ~C~~C~~  228 (274)
                      .|+.||.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            3455554


No 177
>KOG1280|consensus
Probab=46.31  E-value=21  Score=29.44  Aligned_cols=42  Identities=21%  Similarity=0.431  Sum_probs=30.1

Q ss_pred             ccCCCccccCCCCccccCHHHHHHHHhhccCCCC--cccCcCcc
Q psy4796         187 RTDKKKFVCFACPYATQYACYIKTHVMTHTGDKP--FACSYCDY  228 (274)
Q Consensus       187 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~~  228 (274)
                      +-...-|.|+.|++.=.....|..|+..-+.+-+  ..|++|+-
T Consensus        74 ~y~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   74 HYDPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            3445579999999998888889999875444433  45677753


No 178
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=45.95  E-value=10  Score=25.94  Aligned_cols=13  Identities=15%  Similarity=0.312  Sum_probs=7.0

Q ss_pred             ccccCCCCccccC
Q psy4796         192 KFVCFACPYATQY  204 (274)
Q Consensus       192 ~~~C~~C~~~f~~  204 (274)
                      ...|..||..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (115)
T TIGR00100        70 ECECEDCSEEVSP   82 (115)
T ss_pred             EEEcccCCCEEec
Confidence            3556666655543


No 179
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=45.67  E-value=22  Score=23.11  Aligned_cols=12  Identities=17%  Similarity=0.398  Sum_probs=6.2

Q ss_pred             ccccCCCCcccc
Q psy4796         192 KFVCFACPYATQ  203 (274)
Q Consensus       192 ~~~C~~C~~~f~  203 (274)
                      .+.|..|++.|.
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            355555555544


No 180
>KOG2907|consensus
Probab=45.08  E-value=11  Score=25.32  Aligned_cols=11  Identities=27%  Similarity=1.062  Sum_probs=5.7

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |.|+.|++.|+
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55555555443


No 181
>KOG2272|consensus
Probab=45.07  E-value=16  Score=28.52  Aligned_cols=20  Identities=10%  Similarity=0.497  Sum_probs=13.4

Q ss_pred             CcccCCCCCcccCChhHHHH
Q psy4796          91 KPYKCPHCDHCFTQKVVLQR  110 (274)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~  110 (274)
                      .-|.|.+|++...+...++.
T Consensus        98 ~CF~Cd~Cn~~Lad~gf~rn  117 (332)
T KOG2272|consen   98 ACFRCDLCNKHLADQGFYRN  117 (332)
T ss_pred             ccchhHHHHHHHhhhhhHhh
Confidence            35788888877766665543


No 182
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=44.95  E-value=14  Score=21.30  Aligned_cols=12  Identities=17%  Similarity=0.354  Sum_probs=6.3

Q ss_pred             cccCCCCccccC
Q psy4796         193 FVCFACPYATQY  204 (274)
Q Consensus       193 ~~C~~C~~~f~~  204 (274)
                      +.|+.||-.|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            455555555443


No 183
>KOG4167|consensus
Probab=44.76  E-value=15  Score=33.46  Aligned_cols=27  Identities=19%  Similarity=0.297  Sum_probs=20.0

Q ss_pred             CCCCCCeeeccccCCcchhhHHHHHhhh
Q psy4796          23 GPPPADVTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        23 ~~~~~~~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      ......|.|-.|++.| .....+-.||+
T Consensus       787 ~~~~giFpCreC~kvF-~KiKSrNAHMK  813 (907)
T KOG4167|consen  787 TDPTGIFPCRECGKVF-FKIKSRNAHMK  813 (907)
T ss_pred             CCCCceeehHHHHHHH-HHHhhhhHHHH
Confidence            3445568888888888 77788888887


No 184
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=44.63  E-value=39  Score=27.45  Aligned_cols=50  Identities=20%  Similarity=0.410  Sum_probs=34.6

Q ss_pred             ccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhcc
Q psy4796         159 RKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHT  216 (274)
Q Consensus       159 ~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  216 (274)
                      -.|..|...|...+..        +....+....|.|+.|...|-..-..-.|...|.
T Consensus       363 ~~Cf~CQ~~fp~~~~~--------~~~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         363 THCFVCQGPFPKPPVS--------PFDESTSSGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             ccceeccCCCCCCCCC--------cccccccccceechhhhhhhhhhhHHHHHHHHhh
Confidence            3477787777662111        1233345667999999999999988888877664


No 185
>KOG3408|consensus
Probab=44.29  E-value=14  Score=25.29  Aligned_cols=27  Identities=30%  Similarity=0.395  Sum_probs=23.0

Q ss_pred             cCCCccccCCCCccccCHHHHHHHHhh
Q psy4796         188 TDKKKFVCFACPYATQYACYIKTHVMT  214 (274)
Q Consensus       188 ~~~~~~~C~~C~~~f~~~~~l~~H~~~  214 (274)
                      .+...|.|-.|.+-|.+...|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            345569999999999999999999874


No 186
>PF14369 zf-RING_3:  zinc-finger
Probab=44.14  E-value=19  Score=18.70  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=4.5

Q ss_pred             eecccccccc
Q psy4796          65 FLCLFCSYVA   74 (274)
Q Consensus        65 ~~C~~C~~~f   74 (274)
                      |+|-.|.+.+
T Consensus         3 ywCh~C~~~V   12 (35)
T PF14369_consen    3 YWCHQCNRFV   12 (35)
T ss_pred             EeCccCCCEe
Confidence            4444444443


No 187
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=44.10  E-value=13  Score=22.57  Aligned_cols=11  Identities=18%  Similarity=0.386  Sum_probs=4.3

Q ss_pred             cccCCCCcccc
Q psy4796         193 FVCFACPYATQ  203 (274)
Q Consensus       193 ~~C~~C~~~f~  203 (274)
                      -.|..|++.|.
T Consensus        10 ~~C~~C~~~F~   20 (69)
T PF01363_consen   10 SNCMICGKKFS   20 (69)
T ss_dssp             SB-TTT--B-B
T ss_pred             CcCcCcCCcCC
Confidence            35677777775


No 188
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=43.80  E-value=8.2  Score=24.99  Aligned_cols=11  Identities=18%  Similarity=0.446  Sum_probs=6.2

Q ss_pred             cccCCCCcccc
Q psy4796         193 FVCFACPYATQ  203 (274)
Q Consensus       193 ~~C~~C~~~f~  203 (274)
                      +.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (90)
T PF01780_consen   54 WKCKKCGKKFA   64 (90)
T ss_dssp             EEETTTTEEEE
T ss_pred             eecCCCCCEEe
Confidence            55666655553


No 189
>KOG1701|consensus
Probab=43.56  E-value=4.8  Score=33.93  Aligned_cols=43  Identities=12%  Similarity=0.388  Sum_probs=22.4

Q ss_pred             ecccccccccChHHHHHHHhhcCCCCcccCCCCCcccCChhHH
Q psy4796          66 LCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFTQKVVL  108 (274)
Q Consensus        66 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  108 (274)
                      .|..|++...-...--.-|..---..-|+|..|+++..-+.-+
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY  318 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFY  318 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhcccccc
Confidence            5777877654433222222211112357888888776555443


No 190
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=43.44  E-value=2.7  Score=37.94  Aligned_cols=88  Identities=20%  Similarity=0.317  Sum_probs=55.9

Q ss_pred             CCCCCCCeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHhhcCCCCcc-cCCCCCc
Q psy4796          22 PGPPPADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLSSHLGWKPY-KCPHCDH  100 (274)
Q Consensus        22 ~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~-~C~~C~~  100 (274)
                      ...+...-.|+.|-+.+ .++..-+-++-             --.|..||-.|+-..+|---. ..+.-..| -|+.|.+
T Consensus        95 ~~I~pD~a~C~~Cl~Ei-~dp~~rrY~YP-------------F~~CT~CGPRfTIi~alPYDR-~nTsM~~F~lC~~C~~  159 (750)
T COG0068          95 TQIPPDAATCEDCLEEI-FDPNSRRYLYP-------------FINCTNCGPRFTIIEALPYDR-ENTSMADFPLCPFCDK  159 (750)
T ss_pred             cccCCchhhhHHHHHHh-cCCCCcceecc-------------ccccCCCCcceeeeccCCCCc-ccCccccCcCCHHHHH
Confidence            44455668899998888 66655544432             014999999997655442211 12222334 4999999


Q ss_pred             ccCChhHHHHHHhhhcCCCCccCCCCCCcc
Q psy4796         101 CFTQKVVLQRHLLTHTGEKPFACHLCPYRA  130 (274)
Q Consensus       101 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  130 (274)
                      .|.+..+-+-|.      .+..|+.||-..
T Consensus       160 EY~dP~nRRfHA------Qp~aCp~CGP~~  183 (750)
T COG0068         160 EYKDPLNRRFHA------QPIACPKCGPHL  183 (750)
T ss_pred             HhcCcccccccc------ccccCcccCCCe
Confidence            888887644443      368899999744


No 191
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=43.33  E-value=43  Score=21.69  Aligned_cols=13  Identities=15%  Similarity=0.370  Sum_probs=7.5

Q ss_pred             ccccCCCCccccC
Q psy4796         192 KFVCFACPYATQY  204 (274)
Q Consensus       192 ~~~C~~C~~~f~~  204 (274)
                      |-.|..||..|.+
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            3456666666655


No 192
>KOG4167|consensus
Probab=43.00  E-value=6  Score=35.84  Aligned_cols=26  Identities=23%  Similarity=0.249  Sum_probs=21.5

Q ss_pred             CccccCCCCccccCHHHHHHHHhhcc
Q psy4796         191 KKFVCFACPYATQYACYIKTHVMTHT  216 (274)
Q Consensus       191 ~~~~C~~C~~~f~~~~~l~~H~~~h~  216 (274)
                      ..|.|.+|++.|.....+..|+++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            45888888888888888888888885


No 193
>KOG3002|consensus
Probab=42.84  E-value=43  Score=27.37  Aligned_cols=79  Identities=19%  Similarity=0.339  Sum_probs=44.8

Q ss_pred             CCccccCCCCccccCHHHHHHHHhhccCCCCcccC----cCccccCCchhHHHHHhhhCCCCceecCC----CCccCCCh
Q psy4796         190 KKKFVCFACPYATQYACYIKTHVMTHTGDKPFACS----YCDYTCNQSSNLQTHLRIHKTEREYACGK----CAYRTAAL  261 (274)
Q Consensus       190 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~----~C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~  261 (274)
                      +....|+.|...+.....  .++..-.......|+    -|.+.|..... ..|.+.-.. ++|.||.    |... ...
T Consensus        78 ~~~~~CP~Cr~~~g~~R~--~amEkV~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p~~~C~~~-G~~  152 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGNIRC--RAMEKVAEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVPGAECKYT-GSY  152 (299)
T ss_pred             hhcccCCccccccccHHH--HHHHHHHHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCCcccCCcc-CcH
Confidence            344678888887775432  223222333445564    37777776554 445544333 6677754    5543 456


Q ss_pred             hHHHHHHhhhcC
Q psy4796         262 PDLKLHLKNMHL  273 (274)
Q Consensus       262 ~~l~~H~~~~H~  273 (274)
                      ..|..|...-|.
T Consensus       153 ~~l~~H~~~~hk  164 (299)
T KOG3002|consen  153 KDLYAHLNDTHK  164 (299)
T ss_pred             HHHHHHHHhhCh
Confidence            677778776554


No 194
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=42.29  E-value=4  Score=36.91  Aligned_cols=58  Identities=17%  Similarity=0.269  Sum_probs=42.4

Q ss_pred             cCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCccccHHHHHHHHHHHHHHHHHHhHhhcCCCccCCCCCCC
Q psy4796          94 KCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRASRKYYITAHLNSLLSALLLQHFLASQPRRKCVHCSEP  167 (274)
Q Consensus        94 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~~~c~~c~~~  167 (274)
                      .|..||-.|+....|-......+...--.|+.|.++|.+..+.+.|.                .+..|+.||-.
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfHA----------------Qp~aCp~CGP~  182 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFHA----------------QPIACPKCGPH  182 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCcccccccc----------------ccccCcccCCC
Confidence            59999999998887744443333333357999999999988877763                35779999864


No 195
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=42.00  E-value=9.2  Score=23.59  Aligned_cols=13  Identities=15%  Similarity=0.255  Sum_probs=5.0

Q ss_pred             cccCCCCCcccCC
Q psy4796          92 PYKCPHCDHCFTQ  104 (274)
Q Consensus        92 ~~~C~~C~~~f~~  104 (274)
                      ...|..|+..+..
T Consensus        41 ~v~Cg~C~~~~~~   53 (71)
T PF05495_consen   41 RVICGKCRTEQPI   53 (71)
T ss_dssp             EEEETTT--EEES
T ss_pred             CeECCCCCCccCh
Confidence            3445555544433


No 196
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=41.53  E-value=18  Score=31.38  Aligned_cols=21  Identities=14%  Similarity=0.536  Sum_probs=10.2

Q ss_pred             cccCcCccccCCchhHHHHHh
Q psy4796         221 FACSYCDYTCNQSSNLQTHLR  241 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~  241 (274)
                      +.|+.|.+.|.+...+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            444445555555555555443


No 197
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=40.67  E-value=14  Score=25.44  Aligned_cols=12  Identities=17%  Similarity=0.509  Sum_probs=6.5

Q ss_pred             ccccCCCCcccc
Q psy4796         192 KFVCFACPYATQ  203 (274)
Q Consensus       192 ~~~C~~C~~~f~  203 (274)
                      .+.|..||..|.
T Consensus        71 ~~~C~~Cg~~~~   82 (117)
T PRK00564         71 ELECKDCSHVFK   82 (117)
T ss_pred             EEEhhhCCCccc
Confidence            355666665544


No 198
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.53  E-value=8.2  Score=29.70  Aligned_cols=24  Identities=13%  Similarity=0.099  Sum_probs=16.0

Q ss_pred             CCCeeeccccCCcchhhHHHHHhhh
Q psy4796          26 PADVTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        26 ~~~~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      .+...||+|+..| ....-+..-.+
T Consensus        17 kk~ieCPvC~tkF-kkeev~tgsiR   40 (267)
T COG1655          17 KKTIECPVCNTKF-KKEEVKTGSIR   40 (267)
T ss_pred             hceeccCcccchh-hhhheecccee
Confidence            4567899999999 65554444444


No 199
>PRK04351 hypothetical protein; Provisional
Probab=40.20  E-value=18  Score=26.14  Aligned_cols=30  Identities=27%  Similarity=0.703  Sum_probs=15.0

Q ss_pred             cccCcCccccCCchhHHHHHhhhCCCCceecCCCCccC
Q psy4796         221 FACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRT  258 (274)
Q Consensus       221 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  258 (274)
                      |.|..|+..+...       +.+ +...|.|..|+-.+
T Consensus       113 Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L  142 (149)
T PRK04351        113 YECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKL  142 (149)
T ss_pred             EECCCCCCEeeee-------eec-CCCcEEeCCCCcEe
Confidence            6666666544321       112 23446666666544


No 200
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=40.20  E-value=35  Score=27.80  Aligned_cols=40  Identities=20%  Similarity=0.260  Sum_probs=27.6

Q ss_pred             CeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHH
Q psy4796          28 DVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHL   84 (274)
Q Consensus        28 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~   84 (274)
                      -.+|+.|+...  ....|.....               .|+.|+.-|.-...-+...
T Consensus        38 w~kc~~C~~~~--~~~~l~~~~~---------------vcp~c~~h~rltAreRI~~   77 (296)
T CHL00174         38 WVQCENCYGLN--YKKFLKSKMN---------------ICEQCGYHLKMSSSDRIEL   77 (296)
T ss_pred             eeECCCccchh--hHHHHHHcCC---------------CCCCCCCCcCCCHHHHHHH
Confidence            46799999888  4555655543               6999999887555444443


No 201
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=39.82  E-value=21  Score=20.56  Aligned_cols=11  Identities=18%  Similarity=0.561  Sum_probs=6.7

Q ss_pred             ccCCCCccccC
Q psy4796         194 VCFACPYATQY  204 (274)
Q Consensus       194 ~C~~C~~~f~~  204 (274)
                      .|..|++.|..
T Consensus         4 ~C~~C~~~F~~   14 (57)
T cd00065           4 SCMGCGKPFTL   14 (57)
T ss_pred             cCcccCccccC
Confidence            46666666664


No 202
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=39.66  E-value=20  Score=26.15  Aligned_cols=14  Identities=21%  Similarity=0.553  Sum_probs=6.6

Q ss_pred             cccCcCccccCCch
Q psy4796         221 FACSYCDYTCNQSS  234 (274)
Q Consensus       221 ~~C~~C~~~f~~~~  234 (274)
                      |.|+.||+.|.--+
T Consensus       131 ~~C~~CgkiYW~Gs  144 (165)
T COG1656         131 YRCPKCGKIYWKGS  144 (165)
T ss_pred             eECCCCcccccCch
Confidence            44555555544333


No 203
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=39.51  E-value=31  Score=22.39  Aligned_cols=12  Identities=17%  Similarity=0.346  Sum_probs=6.2

Q ss_pred             ccccCCCCcccc
Q psy4796         192 KFVCFACPYATQ  203 (274)
Q Consensus       192 ~~~C~~C~~~f~  203 (274)
                      .+.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PRK03976         54 IWECRKCGAKFA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            355555555544


No 204
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=38.03  E-value=20  Score=24.52  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=6.9

Q ss_pred             ceeccccccccc
Q psy4796          64 QFLCLFCSYVAT   75 (274)
Q Consensus        64 ~~~C~~C~~~f~   75 (274)
                      ..+|..|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (114)
T PRK03681         70 ECWCETCQQYVT   81 (114)
T ss_pred             EEEcccCCCeee
Confidence            355666666554


No 205
>PRK00420 hypothetical protein; Validated
Probab=37.92  E-value=22  Score=24.16  Aligned_cols=27  Identities=15%  Similarity=0.276  Sum_probs=14.8

Q ss_pred             ecccccccccChHHHHHHHhhcCCCCcccCCCCCcccC
Q psy4796          66 LCLFCSYVATARIAIKNHLSSHLGWKPYKCPHCDHCFT  103 (274)
Q Consensus        66 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  103 (274)
                      .||.||..+...           ......|+.|+....
T Consensus        25 ~CP~Cg~pLf~l-----------k~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         25 HCPVCGLPLFEL-----------KDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCcceec-----------CCCceECCCCCCeee
Confidence            577777654320           112456777777544


No 206
>KOG2636|consensus
Probab=37.86  E-value=25  Score=30.11  Aligned_cols=31  Identities=19%  Similarity=0.444  Sum_probs=25.7

Q ss_pred             HhhccCCCCcccCcCc-cccCCchhHHHHHhh
Q psy4796         212 VMTHTGDKPFACSYCD-YTCNQSSNLQTHLRI  242 (274)
Q Consensus       212 ~~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~~  242 (274)
                      .+.|.-...|.|.+|| +++.-+.++.+|...
T Consensus       393 yKLHGL~~ey~CEICGNy~Y~GrkaF~RHF~E  424 (497)
T KOG2636|consen  393 YKLHGLDIEYNCEICGNYVYKGRKAFDRHFNE  424 (497)
T ss_pred             HhhcCCCcccceeeccCccccCcHHHHHHhHH
Confidence            3556667889999999 788899999999885


No 207
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=37.74  E-value=14  Score=19.02  Aligned_cols=14  Identities=36%  Similarity=0.975  Sum_probs=8.0

Q ss_pred             cCCCccccCCCCcc
Q psy4796         188 TDKKKFVCFACPYA  201 (274)
Q Consensus       188 ~~~~~~~C~~C~~~  201 (274)
                      .+...+.|+.||..
T Consensus        18 d~r~R~vC~~Cg~I   31 (34)
T PF14803_consen   18 DDRERLVCPACGFI   31 (34)
T ss_dssp             -SS-EEEETTTTEE
T ss_pred             CCccceECCCCCCE
Confidence            34455778887754


No 208
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=37.62  E-value=48  Score=19.98  Aligned_cols=11  Identities=27%  Similarity=0.845  Sum_probs=5.2

Q ss_pred             CccCCCCCCcc
Q psy4796         120 PFACHLCPYRA  130 (274)
Q Consensus       120 ~~~C~~C~~~f  130 (274)
                      .|.|+.|+..+
T Consensus        46 ~~~C~~Cg~~~   56 (69)
T PF07282_consen   46 VFTCPNCGFEM   56 (69)
T ss_pred             eEEcCCCCCEE
Confidence            34555554443


No 209
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=37.58  E-value=4.5  Score=21.56  Aligned_cols=10  Identities=20%  Similarity=0.597  Sum_probs=5.3

Q ss_pred             eecccccccc
Q psy4796          65 FLCLFCSYVA   74 (274)
Q Consensus        65 ~~C~~C~~~f   74 (274)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5555555543


No 210
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=37.42  E-value=11  Score=35.02  Aligned_cols=12  Identities=17%  Similarity=0.672  Sum_probs=0.0

Q ss_pred             CcccCcCccccC
Q psy4796         220 PFACSYCDYTCN  231 (274)
Q Consensus       220 ~~~C~~C~~~f~  231 (274)
                      .|.|+.|+....
T Consensus       680 ~~~Cp~C~~~~~  691 (900)
T PF03833_consen  680 VYVCPDCGIEVE  691 (900)
T ss_dssp             ------------
T ss_pred             ceeccccccccC
Confidence            377777776543


No 211
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=37.11  E-value=33  Score=18.13  Aligned_cols=11  Identities=18%  Similarity=0.510  Sum_probs=3.8

Q ss_pred             ccccCCCCccc
Q psy4796         192 KFVCFACPYAT  202 (274)
Q Consensus       192 ~~~C~~C~~~f  202 (274)
                      .|.|+.|+..|
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            36666777666


No 212
>PF12773 DZR:  Double zinc ribbon
Probab=37.01  E-value=43  Score=18.63  Aligned_cols=10  Identities=20%  Similarity=0.461  Sum_probs=5.3

Q ss_pred             ccCCCCcccc
Q psy4796         194 VCFACPYATQ  203 (274)
Q Consensus       194 ~C~~C~~~f~  203 (274)
                      .|+.||..+.
T Consensus        14 fC~~CG~~l~   23 (50)
T PF12773_consen   14 FCPHCGTPLP   23 (50)
T ss_pred             CChhhcCChh
Confidence            4555555544


No 213
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=36.90  E-value=31  Score=26.12  Aligned_cols=52  Identities=27%  Similarity=0.535  Sum_probs=22.3

Q ss_pred             ccccCC----CCccccCHHHHHHHHhhccCCCCcccCc----CccccCCchhHHHHHhhhCCC
Q psy4796         192 KFVCFA----CPYATQYACYIKTHVMTHTGDKPFACSY----CDYTCNQSSNLQTHLRIHKTE  246 (274)
Q Consensus       192 ~~~C~~----C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~~~l~~H~~~h~~~  246 (274)
                      .+.|..    |...+... ....|..... -+||.|+.    |+..= ....|..|....+..
T Consensus        14 ~~pC~~~~~GC~~~~~~~-~~~~HE~~C~-~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   14 KFPCKNAKYGCTETFPYS-EKREHEEECP-FRPCSCPFPGSGCDWQG-SYKELLDHLRDKHSW   73 (198)
T ss_dssp             -EE-CCGGGT---EE-GG-GHHHHHHT-T-TSEEE-SSSSTT---EE-ECCCHHHHHHHHTTT
T ss_pred             eecCCCCCCCCccccccc-ChhhHhccCC-CcCCcCCCCCCCccccC-CHHHHHHHHHHHCCC
Confidence            356654    66665433 4455554433 45677766    54332 345677777764444


No 214
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=36.76  E-value=3.9  Score=21.25  Aligned_cols=9  Identities=22%  Similarity=0.357  Sum_probs=4.2

Q ss_pred             ecccccccc
Q psy4796          66 LCLFCSYVA   74 (274)
Q Consensus        66 ~C~~C~~~f   74 (274)
                      .|+.||-.+
T Consensus        23 sC~~CGPr~   31 (35)
T PF07503_consen   23 SCTNCGPRY   31 (35)
T ss_dssp             -BTTCC-SC
T ss_pred             cCCCCCCCE
Confidence            466666544


No 215
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=36.73  E-value=11  Score=19.78  Aligned_cols=11  Identities=27%  Similarity=0.936  Sum_probs=4.9

Q ss_pred             CCCCceecCCC
Q psy4796         244 KTEREYACGKC  254 (274)
Q Consensus       244 ~~~~~~~C~~C  254 (274)
                      .|...|.|..|
T Consensus        25 ~G~qryrC~~C   35 (36)
T PF03811_consen   25 SGHQRYRCKDC   35 (36)
T ss_pred             CCCEeEecCcC
Confidence            33344555444


No 216
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=36.43  E-value=29  Score=28.42  Aligned_cols=75  Identities=19%  Similarity=0.410  Sum_probs=38.3

Q ss_pred             CccCCCCCCCCCCChhhhhhhccCCCCCcccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHH
Q psy4796         158 RRKCVHCSEPISSDMSEIIEHCLVCPNATRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQ  237 (274)
Q Consensus       158 ~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  237 (274)
                      .-.|+.||..-..   .+. +     .....+.+...|..|+-....              +...|+.||..    ..|.
T Consensus       187 ~~~CPvCGs~P~~---s~v-~-----~~~~~G~RyL~CslC~teW~~--------------~R~~C~~Cg~~----~~l~  239 (309)
T PRK03564        187 RQFCPVCGSMPVS---SVV-Q-----IGTTQGLRYLHCNLCESEWHV--------------VRVKCSNCEQS----GKLH  239 (309)
T ss_pred             CCCCCCCCCcchh---hee-e-----ccCCCCceEEEcCCCCCcccc--------------cCccCCCCCCC----Ccee
Confidence            4568888865322   111 1     112345555677777754432              12578888852    1121


Q ss_pred             HHHhhh---CCCCceecCCCCccCCC
Q psy4796         238 THLRIH---KTEREYACGKCAYRTAA  260 (274)
Q Consensus       238 ~H~~~h---~~~~~~~C~~C~~~f~~  260 (274)
                      . ...-   ...+-..|..|+.-++.
T Consensus       240 y-~~~~~~~~~~r~e~C~~C~~YlK~  264 (309)
T PRK03564        240 Y-WSLDSEQAAVKAESCGDCGTYLKI  264 (309)
T ss_pred             e-eeecCCCcceEeeeccccccccee
Confidence            1 1111   12355789988876554


No 217
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=36.42  E-value=26  Score=23.29  Aligned_cols=32  Identities=16%  Similarity=0.290  Sum_probs=25.4

Q ss_pred             CCCCCCCCCCCeeeccccCCcchhhHHHHHhhh
Q psy4796          18 DKASPGPPPADVTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        18 ~~~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      ..++..++..-+-|..|.+.| .+...|..|.+
T Consensus        45 p~Dp~lPGlGqhYCieCaryf-~t~~aL~~Hkk   76 (126)
T COG5112          45 PYDPELPGLGQHYCIECARYF-ITEKALMEHKK   76 (126)
T ss_pred             CCCCCCCCCceeeeehhHHHH-HHHHHHHHHhc
Confidence            345556666678899999999 99999999976


No 218
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=36.39  E-value=7.1  Score=26.66  Aligned_cols=11  Identities=27%  Similarity=1.041  Sum_probs=6.5

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |.|..||..|.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            66666665553


No 219
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=36.29  E-value=21  Score=19.01  Aligned_cols=14  Identities=14%  Similarity=0.463  Sum_probs=11.5

Q ss_pred             ceecCCCCccCCCh
Q psy4796         248 EYACGKCAYRTAAL  261 (274)
Q Consensus       248 ~~~C~~C~~~f~~~  261 (274)
                      ||.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999888654


No 220
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=36.17  E-value=32  Score=20.01  Aligned_cols=10  Identities=30%  Similarity=1.039  Sum_probs=4.4

Q ss_pred             cccCCCCCcc
Q psy4796          92 PYKCPHCDHC  101 (274)
Q Consensus        92 ~~~C~~C~~~  101 (274)
                      .|.|+.||..
T Consensus        14 ~~~Cp~cGip   23 (55)
T PF13824_consen   14 NFECPDCGIP   23 (55)
T ss_pred             CCcCCCCCCc
Confidence            3444444443


No 221
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.05  E-value=11  Score=27.18  Aligned_cols=8  Identities=50%  Similarity=1.497  Sum_probs=4.1

Q ss_pred             eecCCCCc
Q psy4796         249 YACGKCAY  256 (274)
Q Consensus       249 ~~C~~C~~  256 (274)
                      |.|+.|+.
T Consensus       144 ~~C~~C~~  151 (157)
T PF10263_consen  144 YRCGRCGG  151 (157)
T ss_pred             EECCCCCC
Confidence            55555553


No 222
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=35.79  E-value=14  Score=25.26  Aligned_cols=14  Identities=14%  Similarity=0.244  Sum_probs=7.2

Q ss_pred             ccccCCCCccccCH
Q psy4796         192 KFVCFACPYATQYA  205 (274)
Q Consensus       192 ~~~C~~C~~~f~~~  205 (274)
                      ...|..||..|...
T Consensus        70 ~~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   70 RARCRDCGHEFEPD   83 (113)
T ss_dssp             EEEETTTS-EEECH
T ss_pred             cEECCCCCCEEecC
Confidence            35566666665543


No 223
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=35.74  E-value=24  Score=19.91  Aligned_cols=10  Identities=30%  Similarity=0.913  Sum_probs=5.0

Q ss_pred             ceeccccccc
Q psy4796          64 QFLCLFCSYV   73 (274)
Q Consensus        64 ~~~C~~C~~~   73 (274)
                      .+.|..||.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            3455555543


No 224
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=35.65  E-value=6.3  Score=28.09  Aligned_cols=19  Identities=21%  Similarity=0.331  Sum_probs=13.5

Q ss_pred             cccCCCCCcccCChhHHHH
Q psy4796          92 PYKCPHCDHCFTQKVVLQR  110 (274)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~  110 (274)
                      .-.|..|++.|++...+..
T Consensus        28 RReC~~C~~RFTTyErve~   46 (147)
T TIGR00244        28 RRECLECHERFTTFERAEL   46 (147)
T ss_pred             cccCCccCCccceeeeccc
Confidence            3568888888888776543


No 225
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=35.42  E-value=46  Score=26.26  Aligned_cols=35  Identities=23%  Similarity=0.349  Sum_probs=25.6

Q ss_pred             CCCCeeeccccCCcchhhHHHHHhhhccccccccccCCcceeccccccccc
Q psy4796          25 PPADVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVAT   75 (274)
Q Consensus        25 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~   75 (274)
                      +.....|.+|+... .-...+.+|+.               +|..|+....
T Consensus        62 ~~p~v~CrVCq~~I-~i~gk~~QhVV---------------kC~~CnEATP   96 (256)
T PF09788_consen   62 GAPVVTCRVCQSLI-DIEGKMHQHVV---------------KCSVCNEATP   96 (256)
T ss_pred             CCceEEeecCCcee-cccCccceeeE---------------ECCCCCcccc
Confidence            33457899999988 77777777876               5777776543


No 226
>KOG0717|consensus
Probab=34.37  E-value=23  Score=30.55  Aligned_cols=21  Identities=19%  Similarity=0.407  Sum_probs=19.4

Q ss_pred             eeeccccCCcchhhHHHHHhhh
Q psy4796          29 VTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        29 ~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      +-|.+|++.| .+...|..|..
T Consensus       293 lyC~vCnKsF-KseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSF-KSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccc-cchHHHHhhHH
Confidence            8899999999 99999999975


No 227
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=34.33  E-value=57  Score=29.95  Aligned_cols=7  Identities=29%  Similarity=1.160  Sum_probs=3.5

Q ss_pred             cCCCCCC
Q psy4796         122 ACHLCPY  128 (274)
Q Consensus       122 ~C~~C~~  128 (274)
                      .|+.|+.
T Consensus         3 ~Cp~Cg~    9 (645)
T PRK14559          3 ICPQCQF    9 (645)
T ss_pred             cCCCCCC
Confidence            3555544


No 228
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=34.01  E-value=49  Score=23.23  Aligned_cols=15  Identities=13%  Similarity=0.507  Sum_probs=9.8

Q ss_pred             CCccccCCCCccccC
Q psy4796         190 KKKFVCFACPYATQY  204 (274)
Q Consensus       190 ~~~~~C~~C~~~f~~  204 (274)
                      ...|.|..|++.|..
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            455777777777654


No 229
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.75  E-value=42  Score=29.80  Aligned_cols=28  Identities=25%  Similarity=0.610  Sum_probs=16.4

Q ss_pred             cccCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCcc
Q psy4796         186 TRTDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDY  228 (274)
Q Consensus       186 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  228 (274)
                      .|...+...|..||...               ..|..|+.|+.
T Consensus       234 ~h~~~~~l~Ch~Cg~~~---------------~~~~~Cp~C~s  261 (505)
T TIGR00595       234 YHKKEGKLRCHYCGYQE---------------PIPKTCPQCGS  261 (505)
T ss_pred             EecCCCeEEcCCCcCcC---------------CCCCCCCCCCC
Confidence            34445556777777432               33467777765


No 230
>KOG0978|consensus
Probab=33.39  E-value=14  Score=33.74  Aligned_cols=11  Identities=18%  Similarity=0.386  Sum_probs=8.4

Q ss_pred             CeeeccccCCc
Q psy4796          28 DVTCLHCSLTT   38 (274)
Q Consensus        28 ~~~C~~C~~~f   38 (274)
                      .+.|+.|+.++
T Consensus       643 ~LkCs~Cn~R~  653 (698)
T KOG0978|consen  643 LLKCSVCNTRW  653 (698)
T ss_pred             ceeCCCccCch
Confidence            47799998666


No 231
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=33.24  E-value=28  Score=17.77  Aligned_cols=13  Identities=23%  Similarity=0.531  Sum_probs=6.3

Q ss_pred             Ccceecccccccc
Q psy4796          62 KLQFLCLFCSYVA   74 (274)
Q Consensus        62 ~~~~~C~~C~~~f   74 (274)
                      ..-+.|..|+..|
T Consensus        19 ~~~~~C~~Cg~~~   31 (33)
T PF08792_consen   19 DDYEVCIFCGSSF   31 (33)
T ss_pred             CCeEEcccCCcEe
Confidence            3334555555544


No 232
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=33.01  E-value=21  Score=20.17  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=6.4

Q ss_pred             CCeeeccccCCc
Q psy4796          27 ADVTCLHCSLTT   38 (274)
Q Consensus        27 ~~~~C~~C~~~f   38 (274)
                      +++.|..||..|
T Consensus         3 k~l~C~dCg~~F   14 (49)
T PF13451_consen    3 KTLTCKDCGAEF   14 (49)
T ss_pred             eeEEcccCCCeE
Confidence            345555555554


No 233
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=32.73  E-value=31  Score=18.70  Aligned_cols=17  Identities=12%  Similarity=0.202  Sum_probs=12.2

Q ss_pred             cccCCCCccccCHHHHH
Q psy4796         193 FVCFACPYATQYACYIK  209 (274)
Q Consensus       193 ~~C~~C~~~f~~~~~l~  209 (274)
                      -.|+.||+.|..+....
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            36888888888765544


No 234
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=32.26  E-value=12  Score=26.85  Aligned_cols=16  Identities=25%  Similarity=0.416  Sum_probs=11.1

Q ss_pred             ccCCCCCcccCChhHH
Q psy4796          93 YKCPHCDHCFTQKVVL  108 (274)
Q Consensus        93 ~~C~~C~~~f~~~~~l  108 (274)
                      -.|..|+..|++....
T Consensus        29 ReC~~C~~RFTTfE~~   44 (156)
T COG1327          29 RECLECGERFTTFERA   44 (156)
T ss_pred             hcccccccccchhhee
Confidence            4677777777777654


No 235
>PRK14873 primosome assembly protein PriA; Provisional
Probab=32.25  E-value=37  Score=31.29  Aligned_cols=9  Identities=33%  Similarity=1.102  Sum_probs=5.1

Q ss_pred             cCCCCCCCC
Q psy4796         160 KCVHCSEPI  168 (274)
Q Consensus       160 ~c~~c~~~~  168 (274)
                      .|..|+..+
T Consensus       385 ~C~~Cg~~~  393 (665)
T PRK14873        385 ACARCRTPA  393 (665)
T ss_pred             EhhhCcCee
Confidence            466666543


No 236
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=31.96  E-value=65  Score=23.43  Aligned_cols=57  Identities=19%  Similarity=0.257  Sum_probs=30.9

Q ss_pred             CccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccC-CchhHHHHHhh-hCCCCc
Q psy4796         191 KKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCN-QSSNLQTHLRI-HKTERE  248 (274)
Q Consensus       191 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~-~~~~l~~H~~~-h~~~~~  248 (274)
                      ....|++|--........ .-.+.+-..|+-.|..=+=.|. +..+|++|.+. |-..+|
T Consensus        79 ~~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~GtY~eLrKHar~~HP~~rP  137 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFSGTYSELRKHARSEHPSARP  137 (162)
T ss_pred             ccccCccccCceeceEEc-hHHHHHhccCCccCcccccccccCHHHHHHHHHhhCCCCCC
Confidence            347788886554332222 2244555566666755222333 55678888876 544443


No 237
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=31.87  E-value=57  Score=24.31  Aligned_cols=35  Identities=20%  Similarity=0.487  Sum_probs=24.0

Q ss_pred             cCCCCcccCCCCCcccCChhHHHHHHhhhcCCCCccCCCCCCcc
Q psy4796          87 HLGWKPYKCPHCDHCFTQKVVLQRHLLTHTGEKPFACHLCPYRA  130 (274)
Q Consensus        87 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  130 (274)
                      -.++.-|.|+.|...|+.-..+.         ..|.||.||...
T Consensus       108 ~~~~~~y~C~~~~~r~sfdeA~~---------~~F~Cp~Cg~~L  142 (176)
T COG1675         108 ETENNYYVCPNCHVKYSFDEAME---------LGFTCPKCGEDL  142 (176)
T ss_pred             hccCCceeCCCCCCcccHHHHHH---------hCCCCCCCCchh
Confidence            35566789988888776554432         129999999854


No 238
>PRK12496 hypothetical protein; Provisional
Probab=31.74  E-value=29  Score=25.50  Aligned_cols=11  Identities=18%  Similarity=0.395  Sum_probs=7.1

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |.|.-|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            56777776664


No 239
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=31.13  E-value=28  Score=19.90  Aligned_cols=23  Identities=22%  Similarity=0.495  Sum_probs=9.8

Q ss_pred             CCeeeccccCCcchhhHHHHHhhh
Q psy4796          27 ADVTCLHCSLTTPCVMKDMIRHGR   50 (274)
Q Consensus        27 ~~~~C~~C~~~f~~~~~~l~~H~~   50 (274)
                      ..|.|+.|+..| --.-.+-.|..
T Consensus        20 ~~y~C~~C~~~F-C~dCD~fiHE~   42 (51)
T PF07975_consen   20 SRYRCPKCKNHF-CIDCDVFIHET   42 (51)
T ss_dssp             EEE--TTTT--B--HHHHHTTTTT
T ss_pred             CeEECCCCCCcc-ccCcChhhhcc
Confidence            346666666666 55555555544


No 240
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.93  E-value=30  Score=20.45  Aligned_cols=37  Identities=16%  Similarity=0.379  Sum_probs=17.7

Q ss_pred             ccCCCCcc-ccCHHHHHHHHhhccCCCCcccCcCcccc
Q psy4796         194 VCFACPYA-TQYACYIKTHVMTHTGDKPFACSYCDYTC  230 (274)
Q Consensus       194 ~C~~C~~~-f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  230 (274)
                      .|..|.+. +.+...+..-......-+.|-|+.|....
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rv   41 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRV   41 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhh
Confidence            45555553 33333444333333444456666665443


No 241
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=30.91  E-value=17  Score=21.09  Aligned_cols=11  Identities=18%  Similarity=0.872  Sum_probs=2.9

Q ss_pred             ceecccccccc
Q psy4796          64 QFLCLFCSYVA   74 (274)
Q Consensus        64 ~~~C~~C~~~f   74 (274)
                      .|.|++||.+-
T Consensus        33 ~y~Cp~CgAtG   43 (55)
T PF05741_consen   33 KYVCPICGATG   43 (55)
T ss_dssp             G---TTT---G
T ss_pred             cCcCCCCcCcC
Confidence            46677776653


No 242
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=30.85  E-value=19  Score=19.53  Aligned_cols=15  Identities=13%  Similarity=0.394  Sum_probs=9.3

Q ss_pred             CceecCCCCccCCCh
Q psy4796         247 REYACGKCAYRTAAL  261 (274)
Q Consensus       247 ~~~~C~~C~~~f~~~  261 (274)
                      -++.|..|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478899999888654


No 243
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=30.29  E-value=19  Score=20.67  Aligned_cols=11  Identities=18%  Similarity=0.486  Sum_probs=6.0

Q ss_pred             ecCCCCccCCC
Q psy4796         250 ACGKCAYRTAA  260 (274)
Q Consensus       250 ~C~~C~~~f~~  260 (274)
                      .||+|+..|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            89999998875


No 244
>KOG4727|consensus
Probab=30.27  E-value=37  Score=24.85  Aligned_cols=27  Identities=19%  Similarity=0.405  Sum_probs=22.9

Q ss_pred             ccCCCccccCCCCccccCHHHHHHHHh
Q psy4796         187 RTDKKKFVCFACPYATQYACYIKTHVM  213 (274)
Q Consensus       187 ~~~~~~~~C~~C~~~f~~~~~l~~H~~  213 (274)
                      ......|.|.+|+-+|.+.-++.-|+.
T Consensus        70 ~sq~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   70 RSQKGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ccccCceeeeecceeehhhHHHHHHhc
Confidence            344556999999999999999999986


No 245
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=30.13  E-value=33  Score=17.91  Aligned_cols=12  Identities=25%  Similarity=0.525  Sum_probs=6.4

Q ss_pred             CCCccccCCCCc
Q psy4796         189 DKKKFVCFACPY  200 (274)
Q Consensus       189 ~~~~~~C~~C~~  200 (274)
                      .+..|.|..||-
T Consensus        22 ~dG~~yC~~cG~   33 (36)
T PF11781_consen   22 DDGFYYCDRCGH   33 (36)
T ss_pred             cCCEEEhhhCce
Confidence            334466666653


No 246
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.73  E-value=39  Score=17.99  Aligned_cols=13  Identities=23%  Similarity=0.583  Sum_probs=6.4

Q ss_pred             CCCccccCCCCcc
Q psy4796         189 DKKKFVCFACPYA  201 (274)
Q Consensus       189 ~~~~~~C~~C~~~  201 (274)
                      +.+.+.|.+|+..
T Consensus        21 ~~~~w~C~~C~~~   33 (40)
T PF04810_consen   21 GGKTWICNFCGTK   33 (40)
T ss_dssp             TTTEEEETTT--E
T ss_pred             CCCEEECcCCCCc
Confidence            3445667776653


No 247
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=29.43  E-value=37  Score=29.06  Aligned_cols=11  Identities=27%  Similarity=0.794  Sum_probs=5.4

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |+|+.||..+.
T Consensus       368 ~rC~kCg~~~~  378 (421)
T COG1571         368 FRCKKCGTRAR  378 (421)
T ss_pred             cccccccccCC
Confidence            45555554444


No 248
>COG1773 Rubredoxin [Energy production and conversion]
Probab=29.23  E-value=25  Score=20.46  Aligned_cols=10  Identities=20%  Similarity=0.487  Sum_probs=5.0

Q ss_pred             eeeccccCCc
Q psy4796          29 VTCLHCSLTT   38 (274)
Q Consensus        29 ~~C~~C~~~f   38 (274)
                      |+|.+||..|
T Consensus         4 ~~C~~CG~vY   13 (55)
T COG1773           4 WRCSVCGYVY   13 (55)
T ss_pred             eEecCCceEe
Confidence            4455555544


No 249
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=28.95  E-value=11  Score=24.00  Aligned_cols=14  Identities=14%  Similarity=0.396  Sum_probs=7.6

Q ss_pred             ceecccccccccCh
Q psy4796          64 QFLCLFCSYVATAR   77 (274)
Q Consensus        64 ~~~C~~C~~~f~~~   77 (274)
                      ...|..|+..|...
T Consensus        46 ~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   46 ILSCRVCGESFQTK   59 (81)
T ss_dssp             EEEESSS--EEEEE
T ss_pred             EEEecCCCCeEEEc
Confidence            45688887776543


No 250
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=28.87  E-value=19  Score=27.29  Aligned_cols=20  Identities=20%  Similarity=0.217  Sum_probs=0.0

Q ss_pred             eeecccc-CCcchhhHHHHHhh
Q psy4796          29 VTCLHCS-LTTPCVMKDMIRHG   49 (274)
Q Consensus        29 ~~C~~C~-~~f~~~~~~l~~H~   49 (274)
                      |.|.+|| ..| ..+..+.+|.
T Consensus       102 y~CEICGN~~Y-~GrkaFekHF  122 (196)
T PF11931_consen  102 YKCEICGNQSY-KGRKAFEKHF  122 (196)
T ss_dssp             ----------------------
T ss_pred             eeeEeCCCcce-ecHHHHHHhc
Confidence            4455552 344 4444444443


No 251
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=28.09  E-value=19  Score=20.75  Aligned_cols=10  Identities=30%  Similarity=0.806  Sum_probs=5.6

Q ss_pred             CCcccCcCcc
Q psy4796         219 KPFACSYCDY  228 (274)
Q Consensus       219 ~~~~C~~C~~  228 (274)
                      -|+.|+.|.+
T Consensus        27 fPlyCpKCK~   36 (55)
T PF14205_consen   27 FPLYCPKCKQ   36 (55)
T ss_pred             ccccCCCCCc
Confidence            3555666654


No 252
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=27.87  E-value=10  Score=20.84  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=6.3

Q ss_pred             CeeeccccCC
Q psy4796          28 DVTCLHCSLT   37 (274)
Q Consensus        28 ~~~C~~C~~~   37 (274)
                      +..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            4567777743


No 253
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=27.73  E-value=22  Score=19.13  Aligned_cols=11  Identities=27%  Similarity=0.582  Sum_probs=6.6

Q ss_pred             ceecCCCCccC
Q psy4796         248 EYACGKCAYRT  258 (274)
Q Consensus       248 ~~~C~~C~~~f  258 (274)
                      +-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45666666554


No 254
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=27.45  E-value=15  Score=21.40  Aligned_cols=7  Identities=29%  Similarity=1.222  Sum_probs=3.3

Q ss_pred             cccCcCc
Q psy4796         221 FACSYCD  227 (274)
Q Consensus       221 ~~C~~C~  227 (274)
                      |-|..|.
T Consensus        32 YmC~eC~   38 (56)
T PF09963_consen   32 YMCDECK   38 (56)
T ss_pred             eeChhHH
Confidence            4444444


No 255
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=27.42  E-value=30  Score=24.89  Aligned_cols=9  Identities=22%  Similarity=0.803  Sum_probs=5.3

Q ss_pred             cccCcCccc
Q psy4796         221 FACSYCDYT  229 (274)
Q Consensus       221 ~~C~~C~~~  229 (274)
                      |.|..||..
T Consensus       113 l~C~~Cg~~  121 (146)
T PF07295_consen  113 LVCENCGHE  121 (146)
T ss_pred             EecccCCCE
Confidence            666666643


No 256
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=27.29  E-value=41  Score=24.07  Aligned_cols=33  Identities=12%  Similarity=0.276  Sum_probs=18.8

Q ss_pred             ccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccC
Q psy4796         192 KFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCN  231 (274)
Q Consensus       192 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  231 (274)
                      .|.|..|+..+...      . .+.....|.|..|+-.+.
T Consensus       112 ~y~C~~C~~~~~~~------r-r~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLRV------R-RSNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCceE------c-cccCcceEEcCCCCCEEE
Confidence            57787787766432      1 122224478888876543


No 257
>KOG4727|consensus
Probab=27.21  E-value=35  Score=25.02  Aligned_cols=22  Identities=18%  Similarity=0.363  Sum_probs=19.2

Q ss_pred             CceecCCCCccCCChhHHHHHH
Q psy4796         247 REYACGKCAYRTAALPDLKLHL  268 (274)
Q Consensus       247 ~~~~C~~C~~~f~~~~~l~~H~  268 (274)
                      ..|.|.+|.-+|.+..++..|+
T Consensus        74 ~GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             CceeeeecceeehhhHHHHHHh
Confidence            3489999999999999998887


No 258
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=26.70  E-value=37  Score=23.35  Aligned_cols=14  Identities=14%  Similarity=0.273  Sum_probs=6.8

Q ss_pred             eecccccccccChH
Q psy4796          65 FLCLFCSYVATARI   78 (274)
Q Consensus        65 ~~C~~C~~~f~~~~   78 (274)
                      +.|+.||..+.+..
T Consensus        32 ~~C~~CGe~~~~~e   45 (127)
T TIGR03830        32 WYCPACGEELLDPE   45 (127)
T ss_pred             eECCCCCCEEEcHH
Confidence            34555555544443


No 260
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=26.62  E-value=8.9  Score=31.15  Aligned_cols=56  Identities=20%  Similarity=0.395  Sum_probs=24.3

Q ss_pred             CCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHhhhCCCCceecCCCCccCC
Q psy4796         189 DKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLRIHKTEREYACGKCAYRTA  259 (274)
Q Consensus       189 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  259 (274)
                      +.+...|..|+-.+...              ...|+.||..-...-.+.. ...-.+.+-+.|..|+..++
T Consensus       194 G~R~L~Cs~C~t~W~~~--------------R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~C~~C~~YlK  249 (290)
T PF04216_consen  194 GKRYLHCSLCGTEWRFV--------------RIKCPYCGNTDHEKLEYFT-VEGEPAYRVEVCESCGSYLK  249 (290)
T ss_dssp             -EEEEEETTT--EEE----------------TTS-TTT---SS-EEE---------SEEEEEETTTTEEEE
T ss_pred             ccEEEEcCCCCCeeeec--------------CCCCcCCCCCCCcceeeEe-cCCCCcEEEEECCcccchHH
Confidence            45667788888665422              2579999876433322210 11122345578999986544


No 261
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=26.52  E-value=90  Score=27.32  Aligned_cols=31  Identities=16%  Similarity=0.250  Sum_probs=24.8

Q ss_pred             ccCCCccccCCCCccccCHHHHHHHHh-hccC
Q psy4796         187 RTDKKKFVCFACPYATQYACYIKTHVM-THTG  217 (274)
Q Consensus       187 ~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~  217 (274)
                      +...+-+.|+.|.+.|.+...+..|+. .|.+
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            444556889999999999999999987 5654


No 262
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=26.42  E-value=34  Score=22.61  Aligned_cols=16  Identities=25%  Similarity=0.478  Sum_probs=12.8

Q ss_pred             CCCCcccCcCccccCC
Q psy4796         217 GDKPFACSYCDYTCNQ  232 (274)
Q Consensus       217 ~~~~~~C~~C~~~f~~  232 (274)
                      ..++++|..||..|..
T Consensus        76 ~g~~~rC~eCG~~fkL   91 (97)
T cd00924          76 KGKPKRCPECGHVFKL   91 (97)
T ss_pred             CCCceeCCCCCcEEEE
Confidence            3478999999988864


No 263
>KOG4377|consensus
Probab=26.33  E-value=44  Score=28.35  Aligned_cols=23  Identities=13%  Similarity=0.505  Sum_probs=18.0

Q ss_pred             eecCC--CCccCCChhHHHHHHhhh
Q psy4796         249 YACGK--CAYRTAALPDLKLHLKNM  271 (274)
Q Consensus       249 ~~C~~--C~~~f~~~~~l~~H~~~~  271 (274)
                      |.|..  |+..+.+.+.+..|.+.|
T Consensus       402 fhc~r~Gc~~tl~s~sqm~shkrkh  426 (480)
T KOG4377|consen  402 FHCDRLGCEATLYSVSQMASHKRKH  426 (480)
T ss_pred             eeecccCCceEEEehhhhhhhhhhh
Confidence            56644  888999999998887765


No 264
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=26.29  E-value=64  Score=26.47  Aligned_cols=54  Identities=20%  Similarity=0.426  Sum_probs=29.0

Q ss_pred             cCCCccccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCCchhHHHHHhhh-----CCCCceecCCCCccCCC
Q psy4796         188 TDKKKFVCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQSSNLQTHLRIH-----KTEREYACGKCAYRTAA  260 (274)
Q Consensus       188 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h-----~~~~~~~C~~C~~~f~~  260 (274)
                      .+.+...|..|+-.+..              +...|+.||..    ..|.. +.+-     .+.+-..|..|+...+.
T Consensus       206 ~G~RyL~CslC~teW~~--------------~R~~C~~Cg~~----~~l~y-~~~e~~~~~~~~r~e~C~~C~~YlK~  264 (305)
T TIGR01562       206 TGLRYLSCSLCATEWHY--------------VRVKCSHCEES----KHLAY-LSLEHDAEKAVLKAETCDSCQGYLKI  264 (305)
T ss_pred             CCceEEEcCCCCCcccc--------------cCccCCCCCCC----Cceee-EeecCCCCCcceEEeeccccccchhh
Confidence            44555667777754332              22578888864    11211 1111     12345789999876554


No 265
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=26.02  E-value=57  Score=23.62  Aligned_cols=19  Identities=11%  Similarity=0.193  Sum_probs=13.3

Q ss_pred             CCCccccCCCCccccCHHH
Q psy4796         189 DKKKFVCFACPYATQYACY  207 (274)
Q Consensus       189 ~~~~~~C~~C~~~f~~~~~  207 (274)
                      ...|..|..||+.|..-..
T Consensus        65 ~~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCCChhHHhCCCCCchHHH
Confidence            3467788888888876543


No 266
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=25.88  E-value=47  Score=22.06  Aligned_cols=27  Identities=19%  Similarity=0.538  Sum_probs=15.4

Q ss_pred             ccCCCCccccCHHHHHHHHhhccCCCCcccCcCccccCC
Q psy4796         194 VCFACPYATQYACYIKTHVMTHTGDKPFACSYCDYTCNQ  232 (274)
Q Consensus       194 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  232 (274)
                      .|+.||..+...            ...+.|+.|+..+..
T Consensus         2 fC~~Cg~~l~~~------------~~~~~C~~C~~~~~~   28 (104)
T TIGR01384         2 FCPKCGSLMTPK------------NGVYVCPSCGYEKEK   28 (104)
T ss_pred             CCcccCcccccC------------CCeEECcCCCCcccc
Confidence            367777666321            124677777766543


No 267
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=25.67  E-value=33  Score=23.86  Aligned_cols=10  Identities=20%  Similarity=0.943  Sum_probs=6.0

Q ss_pred             CeeeccccCCc
Q psy4796          28 DVTCLHCSLTT   38 (274)
Q Consensus        28 ~~~C~~C~~~f   38 (274)
                      .+.| .|+..|
T Consensus        70 ~~~C-~Cg~~~   79 (124)
T PRK00762         70 EIEC-ECGYEG   79 (124)
T ss_pred             eEEe-eCcCcc
Confidence            3556 666665


No 268
>KOG2906|consensus
Probab=25.48  E-value=5  Score=26.17  Aligned_cols=12  Identities=42%  Similarity=1.137  Sum_probs=6.7

Q ss_pred             CccCCCCCCccc
Q psy4796         120 PFACHLCPYRAS  131 (274)
Q Consensus       120 ~~~C~~C~~~f~  131 (274)
                      .|.|+.|++.|.
T Consensus        21 rf~C~tCpY~~~   32 (105)
T KOG2906|consen   21 RFSCRTCPYVFP   32 (105)
T ss_pred             eEEcCCCCceee
Confidence            355666666553


No 269
>KOG0717|consensus
Probab=25.44  E-value=42  Score=29.03  Aligned_cols=21  Identities=24%  Similarity=0.278  Sum_probs=16.6

Q ss_pred             eecCCCCccCCChhHHHHHHh
Q psy4796         249 YACGKCAYRTAALPDLKLHLK  269 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~  269 (274)
                      +.|.+|.++|.+...+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            778888888888887777764


No 270
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=25.07  E-value=60  Score=28.66  Aligned_cols=17  Identities=12%  Similarity=0.266  Sum_probs=11.4

Q ss_pred             CCCCCCCeeeccccCCc
Q psy4796          22 PGPPPADVTCLHCSLTT   38 (274)
Q Consensus        22 ~~~~~~~~~C~~C~~~f   38 (274)
                      .....+.|.|..|+..|
T Consensus       419 ~~~~~~~~~c~~c~~~y  435 (479)
T PRK05452        419 TADLGPRMQCSVCQWIY  435 (479)
T ss_pred             ccCCCCeEEECCCCeEE
Confidence            34455568888888777


No 271
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=25.05  E-value=81  Score=26.22  Aligned_cols=27  Identities=26%  Similarity=0.588  Sum_probs=17.7

Q ss_pred             ccCCcceeccccc-ccccChHHHHHHHh
Q psy4796          59 TSAKLQFLCLFCS-YVATARIAIKNHLS   85 (274)
Q Consensus        59 h~~~~~~~C~~C~-~~f~~~~~l~~H~~   85 (274)
                      |.-...|.|.+|| +++.....+.+|..
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhhhh
Confidence            3446667788887 66666666766654


No 272
>PLN02294 cytochrome c oxidase subunit Vb
Probab=24.93  E-value=38  Score=24.89  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=14.0

Q ss_pred             cCCCCcccCcCccccCCc
Q psy4796         216 TGDKPFACSYCDYTCNQS  233 (274)
Q Consensus       216 ~~~~~~~C~~C~~~f~~~  233 (274)
                      +..++++|++||..|..+
T Consensus       137 ~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        137 EKGKSFECPVCTQYFELE  154 (174)
T ss_pred             cCCCceeCCCCCCEEEEE
Confidence            446789999999988743


No 273
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=24.74  E-value=78  Score=25.72  Aligned_cols=41  Identities=15%  Similarity=0.209  Sum_probs=27.9

Q ss_pred             CeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHh
Q psy4796          28 DVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLS   85 (274)
Q Consensus        28 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   85 (274)
                      -.+|+.|+...  ....|.....               .|+.|+.-|.-...-+....
T Consensus        26 ~~~c~~c~~~~--~~~~l~~~~~---------------vc~~c~~h~rl~areRi~~L   66 (285)
T TIGR00515        26 WTKCPKCGQVL--YTKELERNLE---------------VCPKCDHHMRMDARERIESL   66 (285)
T ss_pred             eeECCCCcchh--hHHHHHhhCC---------------CCCCCCCcCcCCHHHHHHHc
Confidence            46799999988  4444555443               69999998876554444443


No 274
>KOG1842|consensus
Probab=24.48  E-value=48  Score=28.47  Aligned_cols=30  Identities=17%  Similarity=0.187  Sum_probs=24.6

Q ss_pred             CCCCCCeeeccccCCcchhhHHHHHhhhccc
Q psy4796          23 GPPPADVTCLHCSLTTPCVMKDMIRHGRLCE   53 (274)
Q Consensus        23 ~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~   53 (274)
                      +.....|.||+|...| ...+.|..|+...|
T Consensus        10 ~~i~egflCPiC~~dl-~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   10 GEILEGFLCPICLLDL-PNLSALNDHLDVEH   39 (505)
T ss_pred             chhhhcccCchHhhhh-hhHHHHHHHHhhhc
Confidence            3444569999999999 99999999998633


No 275
>KOG4118|consensus
Probab=24.46  E-value=33  Score=20.54  Aligned_cols=25  Identities=24%  Similarity=0.437  Sum_probs=17.4

Q ss_pred             eecCCCCccCCChhHHHHHHhhhcC
Q psy4796         249 YACGKCAYRTAALPDLKLHLKNMHL  273 (274)
Q Consensus       249 ~~C~~C~~~f~~~~~l~~H~~~~H~  273 (274)
                      |+|.+|-...++.-.+..|....|+
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHp   63 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHP   63 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCC
Confidence            6777777777777777777666554


No 276
>KOG2071|consensus
Probab=24.37  E-value=48  Score=29.59  Aligned_cols=27  Identities=30%  Similarity=0.653  Sum_probs=19.3

Q ss_pred             CCCcccCcCccccCCchhHHHHHhhhC
Q psy4796         218 DKPFACSYCDYTCNQSSNLQTHLRIHK  244 (274)
Q Consensus       218 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  244 (274)
                      ..+-+|..||.+|.+......||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            455778888888887777777776664


No 277
>PHA02998 RNA polymerase subunit; Provisional
Probab=23.84  E-value=25  Score=26.00  Aligned_cols=11  Identities=27%  Similarity=0.618  Sum_probs=5.8

Q ss_pred             cccCcCccccC
Q psy4796         221 FACSYCDYTCN  231 (274)
Q Consensus       221 ~~C~~C~~~f~  231 (274)
                      |.|..||..|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            55555555543


No 278
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=23.77  E-value=79  Score=25.81  Aligned_cols=41  Identities=15%  Similarity=0.197  Sum_probs=27.8

Q ss_pred             CeeeccccCCcchhhHHHHHhhhccccccccccCCcceecccccccccChHHHHHHHh
Q psy4796          28 DVTCLHCSLTTPCVMKDMIRHGRLCEFNSVVTSAKLQFLCLFCSYVATARIAIKNHLS   85 (274)
Q Consensus        28 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~   85 (274)
                      -.+|+.|+...  ....|.....               .|+.|+.-|.-...-+..+.
T Consensus        27 ~~~c~~c~~~~--~~~~l~~~~~---------------vc~~c~~h~rl~areRi~~L   67 (292)
T PRK05654         27 WTKCPSCGQVL--YRKELEANLN---------------VCPKCGHHMRISARERLDLL   67 (292)
T ss_pred             eeECCCccchh--hHHHHHhcCC---------------CCCCCCCCeeCCHHHHHHHH
Confidence            46799999888  4445555443               69999998875554444443


No 279
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=23.25  E-value=27  Score=19.41  Aligned_cols=8  Identities=38%  Similarity=1.070  Sum_probs=4.5

Q ss_pred             eccccCCc
Q psy4796          31 CLHCSLTT   38 (274)
Q Consensus        31 C~~C~~~f   38 (274)
                      |+.||...
T Consensus         2 CP~Cg~~a    9 (47)
T PF04606_consen    2 CPHCGSKA    9 (47)
T ss_pred             cCCCCCee
Confidence            55665544


No 280
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=23.13  E-value=52  Score=23.79  Aligned_cols=14  Identities=29%  Similarity=0.522  Sum_probs=9.0

Q ss_pred             CCCCeeeccccCCc
Q psy4796          25 PPADVTCLHCSLTT   38 (274)
Q Consensus        25 ~~~~~~C~~C~~~f   38 (274)
                      +....+|..|++.|
T Consensus        11 p~~vv~C~~c~kWF   24 (152)
T PF09416_consen   11 PSCVVKCNTCNKWF   24 (152)
T ss_dssp             CCCEEEETTTTEEE
T ss_pred             cccEeEcCCCCcEe
Confidence            33456777777766


No 281
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=22.91  E-value=41  Score=17.62  Aligned_cols=10  Identities=30%  Similarity=0.766  Sum_probs=5.0

Q ss_pred             ceecCCCCcc
Q psy4796         248 EYACGKCAYR  257 (274)
Q Consensus       248 ~~~C~~C~~~  257 (274)
                      .|+|..||..
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4788888764


No 282
>KOG1994|consensus
Probab=22.38  E-value=42  Score=25.91  Aligned_cols=23  Identities=17%  Similarity=0.414  Sum_probs=20.2

Q ss_pred             CCccccCCCCccccCHHHHHHHH
Q psy4796         190 KKKFVCFACPYATQYACYIKTHV  212 (274)
Q Consensus       190 ~~~~~C~~C~~~f~~~~~l~~H~  212 (274)
                      ...|.|-+||..|.+...|..|.
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhC
Confidence            34599999999999999999885


No 283
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=21.74  E-value=38  Score=25.12  Aligned_cols=11  Identities=18%  Similarity=0.489  Sum_probs=9.4

Q ss_pred             CeeeccccCCc
Q psy4796          28 DVTCLHCSLTT   38 (274)
Q Consensus        28 ~~~C~~C~~~f   38 (274)
                      .|.|..|.+.|
T Consensus       139 ~~rC~GC~~~f  149 (177)
T COG1439         139 RLRCHGCKRIF  149 (177)
T ss_pred             eEEEecCceec
Confidence            37899999999


No 284
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.48  E-value=51  Score=30.58  Aligned_cols=7  Identities=43%  Similarity=1.450  Sum_probs=3.1

Q ss_pred             cCCCCCc
Q psy4796          94 KCPHCDH  100 (274)
Q Consensus        94 ~C~~C~~  100 (274)
                      .|+.|+.
T Consensus       423 ~Cp~Cg~  429 (679)
T PRK05580        423 ACPECGS  429 (679)
T ss_pred             CCCCCcC
Confidence            4444433


No 285
>KOG3214|consensus
Probab=20.68  E-value=46  Score=21.94  Aligned_cols=13  Identities=15%  Similarity=0.309  Sum_probs=7.3

Q ss_pred             eecccccccccCh
Q psy4796          65 FLCLFCSYVATAR   77 (274)
Q Consensus        65 ~~C~~C~~~f~~~   77 (274)
                      ..|.+|+..|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            3466666666544


No 286
>KOG2747|consensus
Probab=20.65  E-value=53  Score=27.87  Aligned_cols=29  Identities=17%  Similarity=0.224  Sum_probs=20.7

Q ss_pred             CCCCCeeeccccCCcchhhHHHHHhhhccc
Q psy4796          24 PPPADVTCLHCSLTTPCVMKDMIRHGRLCE   53 (274)
Q Consensus        24 ~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~   53 (274)
                      .....|.|..|-+.+ .....|.+|+..|.
T Consensus       154 ~~~~lYiCEfCLkY~-~s~~~l~rH~~kC~  182 (396)
T KOG2747|consen  154 KLDKLYICEFCLKYM-KSRTSLQRHLKKCK  182 (396)
T ss_pred             cCCeEEEehHHHhHh-chHHHHHHHHHhcC
Confidence            334557788888777 77888888877554


No 287
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=20.57  E-value=89  Score=15.89  Aligned_cols=12  Identities=25%  Similarity=0.764  Sum_probs=6.7

Q ss_pred             CCCeeeccccCC
Q psy4796          26 PADVTCLHCSLT   37 (274)
Q Consensus        26 ~~~~~C~~C~~~   37 (274)
                      ...|.|..|++.
T Consensus         6 P~~Y~C~~C~~~   17 (32)
T PF13696_consen    6 PPGYVCHRCGQK   17 (32)
T ss_pred             CCCCEeecCCCC
Confidence            334666666543


No 288
>PRK05978 hypothetical protein; Provisional
Probab=20.56  E-value=39  Score=24.35  Aligned_cols=11  Identities=27%  Similarity=0.359  Sum_probs=7.7

Q ss_pred             ecccccccccC
Q psy4796          66 LCLFCSYVATA   76 (274)
Q Consensus        66 ~C~~C~~~f~~   76 (274)
                      .|+.||..|..
T Consensus        54 ~C~~CG~~~~~   64 (148)
T PRK05978         54 HCAACGEDFTH   64 (148)
T ss_pred             CccccCCcccc
Confidence            48888877753


No 289
>PTZ00448 hypothetical protein; Provisional
Probab=20.08  E-value=69  Score=26.91  Aligned_cols=23  Identities=22%  Similarity=0.440  Sum_probs=18.8

Q ss_pred             ceecCCCCccCCChhHHHHHHhh
Q psy4796         248 EYACGKCAYRTAALPDLKLHLKN  270 (274)
Q Consensus       248 ~~~C~~C~~~f~~~~~l~~H~~~  270 (274)
                      .|.|..|+..|.+......|++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999888888888764


Done!