Diaphorina citri psyllid: psy4809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
LSKDELGKLVQGFEKQDILTSSGVTLAGNRYIYLSGTDKVIRAKLGKVGVHCMKTQQAVVISLYEDPIQPQQAASVVEKLGDYLVSCGY
ccHHHHHHHHHHcccccccccccEEECcEEEEEEEccccEEEEEEcccEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHHHHHccc
*SKDELGKLVQGFEKQDILTSSGVTLAGNRYIYLSGTDKVIRAKLGKVGVHCMKTQQAVVISLYEDPIQPQQAASVVEKLGDYLVSCGY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LSKDELGKLVQGFEKQDILTSSGVTLAGNRYIYLSGTDKVIRAKLGKVGVHCMKTQQAVVISLYEDPIQPQQAASVVEKLGDYLVSCGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Profilin Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.very confidentQ6QEJ7
Profilin Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. This profilin is required for intercellular cytoplasm transport during Drosophila oogenesis.very confidentP25843
Profilin Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.confidentP07274

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051491 [BP]positive regulation of filopodium assemblyprobableGO:0051130, GO:0051489, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0035193 [BP]larval central nervous system remodelingprobableGO:0032502, GO:0009886, GO:0044707, GO:0007399, GO:0048856, GO:0009791, GO:0002165, GO:0032501, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007488 [BP]histoblast morphogenesisprobableGO:0032502, GO:0009791, GO:0048707, GO:0009886, GO:0044707, GO:0007444, GO:0048569, GO:0032501, GO:0007552, GO:0007560, GO:0048563, GO:0044767, GO:0002165, GO:0048513, GO:0008150, GO:0009887, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0007300 [BP]ovarian nurse cell to oocyte transportprobableGO:0044702, GO:0048609, GO:0032504, GO:0006810, GO:0019953, GO:0007292, GO:0022414, GO:0044765, GO:0032501, GO:0008150, GO:0044699, GO:0051234, GO:0048477, GO:0051179, GO:0007276, GO:0000003
GO:0030717 [BP]karyosome formationprobableGO:0006996, GO:0044702, GO:0048610, GO:0051276, GO:0032504, GO:0071840, GO:0009987, GO:0019953, GO:0016043, GO:0007292, GO:0022414, GO:0032501, GO:0044763, GO:0044699, GO:0048609, GO:0022412, GO:0008150, GO:0048477, GO:0007276, GO:0000003
GO:0032507 [BP]maintenance of protein location in cellprobableGO:0033036, GO:0008104, GO:0070727, GO:0009987, GO:0034613, GO:0045185, GO:0065007, GO:0044763, GO:0008150, GO:0051235, GO:0065008, GO:0051651, GO:0051179, GO:0044699, GO:0051641
GO:0030041 [BP]actin filament polymerizationprobableGO:0022607, GO:0070271, GO:0043933, GO:0030036, GO:0034622, GO:0071840, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0030029, GO:0007015, GO:0006461, GO:0008154, GO:0044763, GO:0043623, GO:0006996, GO:0051258, GO:0007010, GO:0044085, GO:0008150
GO:0000915 [BP]cytokinesis, actomyosin contractile ring assemblyprobableGO:0000910, GO:0006996, GO:0000912, GO:0022607, GO:0032506, GO:0031032, GO:0030029, GO:0007049, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044085, GO:0022402, GO:0030036, GO:0044763, GO:0007010, GO:0051301
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0045451 [BP]pole plasm oskar mRNA localizationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0022607, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0060811, GO:0060810, GO:0008298, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0006403, GO:0009952, GO:0044707, GO:0008595, GO:0044702, GO:0048856, GO:0044085, GO:0048869, GO:0044763, GO:0009987
GO:0007391 [BP]dorsal closureprobableGO:0048598, GO:0002009, GO:0001700, GO:0048856, GO:0044707, GO:0032501, GO:0060429, GO:0016331, GO:0009888, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0032009 [CC]early phagosomeprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0043229, GO:0005623, GO:0031988, GO:0030139, GO:0045335, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0009524 [CC]phragmoplastprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005546 [MF]phosphatidylinositol-4,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0019897 [CC]extrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0031097 [CC]medial cortexprobableGO:0005737, GO:0032155, GO:0032153, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005937 [CC]mating projectionprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0003785 [MF]actin monomer bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0051285 [CC]cell cortex of cell tipprobableGO:0005737, GO:0060187, GO:0051286, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0005085 [MF]guanyl-nucleotide exchange factor activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D9Y, chain A
Confidence level:very confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL