Diaphorina citri psyllid: psy4829


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MKQLIQYHQELRLMRRKCSDKGYHEKVKNPMSFDVVRWRLNPSHPEGYKTIVQFISDIRLIFKNAFVYYAKTDQEYSDAKNLEEYFEHMLEKWLPDYAYDDSLDGELSEPSAKRLRRGQE
ccccccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
MKQLIQYHQELRLMRRKCSDKGYHEKVKNPMSFDVVRWRLNPSHPEGYKTIVQFISDIRLIFKNAFVYYAKTDQEYSDAKNLEEYFEHMLEKWLPDYAYD********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQLIQYHQELRLMRRKCSDKGYHEKVKNPMSFDVVRWRLNPSHPEGYKTIVQFISDIRLIFKNAFVYYAKTDQEYSDAKNLEEYFEHMLEKWLPDYAYDDSLDGELSEPSAKRLRRGQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0070577 [MF]histone acetyl-lysine bindingprobableGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0070603 [CC]SWI/SNF superfamily-type complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R10, chain A
Confidence level:very confident
Coverage over the Query: 6-92
View the alignment between query and template
View the model in PyMOL