Query         psy4830
Match_columns 292
No_of_seqs    523 out of 1285
Neff          11.1
Searched_HMMs 46136
Date          Fri Aug 16 18:51:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4830.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4830hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 8.8E-35 1.9E-39  217.9   6.0  105  183-290   159-263 (279)
  2 KOG2462|consensus              100.0 2.4E-33 5.2E-38  210.2   4.6  137   92-263   129-265 (279)
  3 KOG1074|consensus              100.0 1.2E-32 2.6E-37  233.3   5.2   84   66-150   606-692 (958)
  4 KOG3608|consensus              100.0 4.8E-31   1E-35  203.2   9.4  247    9-292    69-374 (467)
  5 KOG3608|consensus              100.0 1.8E-29 3.9E-34  194.5   9.2  222    9-268   134-379 (467)
  6 KOG1074|consensus               99.9 1.8E-28 3.9E-33  208.2   5.2  193   93-292   605-929 (958)
  7 KOG3623|consensus               99.9 4.8E-28   1E-32  202.6   6.9  106    9-114   210-330 (1007)
  8 KOG3576|consensus               99.8 1.7E-21 3.8E-26  139.3   1.8  111  181-291   113-233 (267)
  9 KOG3576|consensus               99.8 3.7E-19   8E-24  127.5   2.6  115   35-149   115-235 (267)
 10 KOG3623|consensus               99.7 2.4E-18 5.2E-23  145.1   1.4   80  183-262   892-971 (1007)
 11 PHA00733 hypothetical protein   99.5 2.6E-14 5.6E-19   99.3   4.0   81  183-265    38-123 (128)
 12 PLN03086 PRLI-interacting fact  99.5 2.5E-13 5.5E-18  115.4   8.5   99  184-290   452-560 (567)
 13 PHA00733 hypothetical protein   99.4   1E-13 2.3E-18   96.3   3.8   92  198-292    25-121 (128)
 14 PLN03086 PRLI-interacting fact  99.4 8.1E-13 1.8E-17  112.4   8.7  146   66-266   408-565 (567)
 15 PHA02768 hypothetical protein;  99.2 3.2E-12   7E-17   72.7   1.1   42  186-229     6-47  (55)
 16 KOG3993|consensus               99.2 4.7E-12   1E-16  101.2   1.8  215   37-268   267-485 (500)
 17 PHA02768 hypothetical protein;  99.2 7.8E-12 1.7E-16   71.2   2.0   44  213-258     5-48  (55)
 18 KOG3993|consensus               99.0 5.6E-11 1.2E-15   95.2   0.6  194   64-292   266-480 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.8E-10 3.8E-15   56.2   1.7   24  201-224     2-25  (26)
 20 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.1E-10 4.5E-15   56.0   1.2   24  229-252     2-25  (26)
 21 PHA00732 hypothetical protein   98.8 3.9E-09 8.4E-14   66.4   2.7   46  213-264     1-47  (79)
 22 PHA00616 hypothetical protein   98.8 3.6E-09 7.8E-14   57.3   1.5   34  185-218     1-34  (44)
 23 PHA00732 hypothetical protein   98.7 5.8E-09 1.3E-13   65.6   2.4   48  185-238     1-49  (79)
 24 PHA00616 hypothetical protein   98.7 1.5E-08 3.4E-13   54.9   2.1   35    9-43      1-35  (44)
 25 PF05605 zf-Di19:  Drought indu  98.5 8.7E-08 1.9E-12   56.1   3.3   47  242-291     3-50  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.3 3.1E-07 6.8E-12   43.5   1.9   22  242-263     1-22  (23)
 27 PF05605 zf-Di19:  Drought indu  98.3 6.9E-07 1.5E-11   52.3   2.8   20  186-206     3-22  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  98.3 5.4E-07 1.2E-11   42.6   1.6   23  186-208     1-23  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.2E-06 2.6E-11   41.9   2.2   24  242-265     1-24  (24)
 30 PF12756 zf-C2H2_2:  C2H2 type   98.1 1.3E-06 2.9E-11   58.8   2.4   73  187-264     1-73  (100)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.1   2E-06 4.4E-11   42.4   1.7   25  241-265     1-25  (27)
 32 PF12756 zf-C2H2_2:  C2H2 type   98.0   2E-06 4.4E-11   57.8   1.6   71  215-291     1-71  (100)
 33 COG5189 SFP1 Putative transcri  98.0 1.9E-06 4.1E-11   67.2   0.9   22  212-233   348-371 (423)
 34 COG5189 SFP1 Putative transcri  98.0   3E-06 6.4E-11   66.1   1.3   53  238-290   346-418 (423)
 35 PF13894 zf-C2H2_4:  C2H2-type   97.9 5.9E-06 1.3E-10   39.4   1.7   23  186-208     1-23  (24)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.9 6.6E-06 1.4E-10   40.5   1.6   24  185-208     1-24  (27)
 37 smart00355 ZnF_C2H2 zinc finge  97.4  0.0001 2.3E-09   35.6   1.8   23  242-264     1-23  (26)
 38 smart00355 ZnF_C2H2 zinc finge  97.4 0.00014   3E-09   35.2   2.1   24  186-209     1-24  (26)
 39 PF09237 GAGA:  GAGA factor;  I  97.4 0.00021 4.5E-09   39.8   2.9   30  238-267    21-50  (54)
 40 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00015 3.3E-09   34.4   2.0   23  242-265     1-23  (24)
 41 PF09237 GAGA:  GAGA factor;  I  97.3 0.00022 4.7E-09   39.7   2.4   32  182-213    21-52  (54)
 42 PF12874 zf-met:  Zinc-finger o  97.3 0.00016 3.4E-09   34.8   1.7   22  242-263     1-22  (25)
 43 PRK04860 hypothetical protein;  97.2 0.00018 3.8E-09   52.2   1.7   38  185-226   119-156 (160)
 44 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 0.00024 5.2E-09   34.8   1.6   21  271-291     2-22  (27)
 45 PF12874 zf-met:  Zinc-finger o  97.2 0.00025 5.4E-09   34.0   1.5   22  186-207     1-22  (25)
 46 PRK04860 hypothetical protein;  97.1 0.00015 3.2E-09   52.6   0.7   37  213-253   119-155 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  97.0 0.00029 6.2E-09   34.5   1.0   22  242-263     2-23  (27)
 48 KOG2231|consensus               96.9  0.0013 2.9E-08   57.9   4.9   69  186-262   183-260 (669)
 49 KOG2785|consensus               96.8  0.0036 7.8E-08   50.9   6.2  111  181-291    64-241 (390)
 50 PF13909 zf-H2C2_5:  C2H2-type   96.8 0.00085 1.8E-08   31.7   1.6   23  186-209     1-23  (24)
 51 COG5236 Uncharacterized conser  96.7  0.0016 3.5E-08   51.9   3.4   99  186-291   152-272 (493)
 52 KOG1146|consensus               96.5  0.0012 2.6E-08   61.8   1.4  104  188-291   439-610 (1406)
 53 PF13913 zf-C2HC_2:  zinc-finge  96.3  0.0029 6.3E-08   30.2   1.7   20  186-206     3-22  (25)
 54 KOG2231|consensus               96.3  0.0045 9.8E-08   54.7   3.9   89  196-292   125-234 (669)
 55 PF13913 zf-C2HC_2:  zinc-finge  95.9  0.0063 1.4E-07   29.0   1.7   19  243-262     4-22  (25)
 56 KOG1146|consensus               95.9  0.0034 7.5E-08   59.0   1.4   76  216-291   439-539 (1406)
 57 smart00451 ZnF_U1 U1-like zinc  95.8  0.0074 1.6E-07   31.5   1.9   21  270-290     3-23  (35)
 58 smart00451 ZnF_U1 U1-like zinc  95.5   0.011 2.4E-07   30.8   1.8   23  241-263     3-25  (35)
 59 COG5048 FOG: Zn-finger [Genera  95.4  0.0055 1.2E-07   53.0   0.7   53   65-117   289-347 (467)
 60 KOG2785|consensus               95.3   0.067 1.4E-06   43.8   6.5   76   37-115     3-90  (390)
 61 cd00350 rubredoxin_like Rubred  95.2   0.015 3.3E-07   29.8   1.8   10  269-278    16-25  (33)
 62 COG5048 FOG: Zn-finger [Genera  94.8   0.013 2.8E-07   50.7   1.2  107  184-291   288-439 (467)
 63 COG5236 Uncharacterized conser  94.7   0.036 7.9E-07   44.5   3.4   99   10-114   152-272 (493)
 64 KOG2893|consensus               94.6   0.013 2.8E-07   44.4   0.7   46  187-236    12-58  (341)
 65 KOG4173|consensus               94.3   0.016 3.5E-07   42.8   0.6   85  184-271    78-176 (253)
 66 TIGR00622 ssl1 transcription f  94.2   0.092   2E-06   35.3   4.0   79   36-116    14-104 (112)
 67 KOG2482|consensus               93.6   0.058 1.3E-06   43.4   2.6  105  185-290   195-354 (423)
 68 TIGR00622 ssl1 transcription f  93.1     0.3 6.4E-06   33.0   4.9   84  183-277    13-110 (112)
 69 COG4049 Uncharacterized protei  92.8   0.054 1.2E-06   30.8   0.9   32  235-266    11-42  (65)
 70 cd00729 rubredoxin_SM Rubredox  92.6    0.11 2.5E-06   26.8   2.0   26  241-279     2-27  (34)
 71 KOG2893|consensus               92.6   0.034 7.4E-07   42.2   0.0   46  216-265    13-58  (341)
 72 PF09986 DUF2225:  Uncharacteri  92.3   0.058 1.3E-06   41.6   0.9   13  242-254    49-61  (214)
 73 KOG4173|consensus               92.1   0.041 8.9E-07   40.8  -0.1   76  212-290    78-166 (253)
 74 PF09538 FYDLN_acid:  Protein o  91.8    0.12 2.7E-06   34.8   2.0   13  241-253    26-38  (108)
 75 COG4049 Uncharacterized protei  91.7   0.098 2.1E-06   29.8   1.1   26    6-31     14-39  (65)
 76 COG2888 Predicted Zn-ribbon RN  91.2     0.2 4.2E-06   29.2   2.1   11  268-278    48-58  (61)
 77 TIGR02098 MJ0042_CXXC MJ0042 f  90.3    0.18 3.9E-06   26.8   1.3   11  243-253     4-14  (38)
 78 PF13717 zinc_ribbon_4:  zinc-r  90.0    0.25 5.4E-06   25.9   1.6   11  270-280    25-35  (36)
 79 COG1592 Rubrerythrin [Energy p  89.1    0.28 6.1E-06   35.8   1.9   10  268-277   147-156 (166)
 80 PF09986 DUF2225:  Uncharacteri  88.6   0.086 1.9E-06   40.7  -1.0   44  183-226     3-61  (214)
 81 PRK00398 rpoP DNA-directed RNA  88.5    0.31 6.8E-06   27.2   1.5   10  242-251     4-13  (46)
 82 PF02892 zf-BED:  BED zinc fing  88.2    0.48   1E-05   26.1   2.1   27  238-264    13-43  (45)
 83 PF10571 UPF0547:  Uncharacteri  87.5    0.33 7.2E-06   23.3   1.0    8  244-251    17-24  (26)
 84 PF09538 FYDLN_acid:  Protein o  87.5    0.35 7.5E-06   32.6   1.5   30  186-226    10-39  (108)
 85 PRK06266 transcription initiat  87.4    0.31 6.8E-06   36.3   1.3   17  213-229   117-133 (178)
 86 TIGR00373 conserved hypothetic  86.8     0.6 1.3E-05   34.1   2.5   17  213-229   109-125 (158)
 87 TIGR02300 FYDLN_acid conserved  86.5    0.55 1.2E-05   32.3   2.0   30  214-254    10-39  (129)
 88 KOG2186|consensus               86.4     0.4 8.6E-06   37.1   1.4   45  186-233     4-48  (276)
 89 PRK00464 nrdR transcriptional   86.2    0.31 6.7E-06   35.3   0.7   12  242-253    29-40  (154)
 90 PF05290 Baculo_IE-1:  Baculovi  86.1    0.34 7.3E-06   33.5   0.8   13  272-284   123-135 (140)
 91 KOG2482|consensus               86.0    0.91   2E-05   36.8   3.2  139    9-149   144-357 (423)
 92 smart00659 RPOLCX RNA polymera  85.9    0.62 1.3E-05   25.7   1.6   11  214-224     3-13  (44)
 93 smart00734 ZnF_Rad18 Rad18-lik  85.4    0.75 1.6E-05   22.0   1.6   19  243-262     3-21  (26)
 94 PHA00626 hypothetical protein   85.1    0.44 9.6E-06   27.3   0.9   14  240-253    22-35  (59)
 95 COG1592 Rubrerythrin [Energy p  85.1    0.46   1E-05   34.7   1.2   11  238-248   146-156 (166)
 96 PRK14890 putative Zn-ribbon RN  85.1    0.78 1.7E-05   26.8   1.9   10  269-278    47-56  (59)
 97 PF13719 zinc_ribbon_5:  zinc-r  85.0    0.79 1.7E-05   24.1   1.8   10   94-103    26-35  (37)
 98 smart00531 TFIIE Transcription  84.8    0.93   2E-05   32.7   2.7   15  213-227    99-113 (147)
 99 smart00531 TFIIE Transcription  84.6    0.92   2E-05   32.7   2.6   14  184-197    98-111 (147)
100 PF12013 DUF3505:  Protein of u  84.4     1.1 2.4E-05   30.4   2.8   25  242-266    81-109 (109)
101 smart00834 CxxC_CXXC_SSSS Puta  84.1    0.36 7.7E-06   26.0   0.2   10  242-251     6-15  (41)
102 TIGR02605 CxxC_CxxC_SSSS putat  84.0    0.36 7.9E-06   27.7   0.2    9  187-195     7-15  (52)
103 PRK06266 transcription initiat  82.7    0.76 1.6E-05   34.3   1.5   36  181-225   113-148 (178)
104 TIGR00373 conserved hypothetic  82.6       1 2.3E-05   32.9   2.2   30   64-102   108-137 (158)
105 KOG2186|consensus               80.6     1.5 3.2E-05   34.1   2.4   45   66-113     4-48  (276)
106 smart00614 ZnF_BED BED zinc fi  80.4     1.5 3.2E-05   24.9   1.9   23  241-263    18-45  (50)
107 PRK09678 DNA-binding transcrip  79.9    0.69 1.5E-05   28.6   0.4   14  240-253    26-41  (72)
108 PF03604 DNA_RNApol_7kD:  DNA d  79.8     1.6 3.5E-05   22.1   1.7   11  242-252     1-11  (32)
109 TIGR02300 FYDLN_acid conserved  79.7     1.5 3.2E-05   30.2   1.9   35  185-230     9-43  (129)
110 PF09723 Zn-ribbon_8:  Zinc rib  79.7    0.89 1.9E-05   24.7   0.7   12  126-137     5-16  (42)
111 COG1996 RPC10 DNA-directed RNA  79.3    0.99 2.1E-05   25.4   0.8   10  186-195     7-16  (49)
112 PF05443 ROS_MUCR:  ROS/MUCR tr  77.9     1.4   3E-05   30.9   1.5   24  240-266    71-94  (132)
113 PF06524 NOA36:  NOA36 protein;  77.7     0.6 1.3E-05   36.3  -0.4   13   33-45    138-150 (314)
114 KOG2807|consensus               76.7     3.9 8.5E-05   33.2   3.8   18   65-82    290-307 (378)
115 PF08274 PhnA_Zn_Ribbon:  PhnA   76.1     1.1 2.4E-05   22.3   0.4    9  269-277    18-26  (30)
116 COG1997 RPL43A Ribosomal prote  76.1     1.6 3.4E-05   27.8   1.2   32  212-253    34-65  (89)
117 COG1198 PriA Primosomal protei  76.0     2.7 5.9E-05   38.8   3.1   13  267-279   472-484 (730)
118 PRK04023 DNA polymerase II lar  75.4     3.4 7.3E-05   39.1   3.5   50  184-281   625-674 (1121)
119 PF06524 NOA36:  NOA36 protein;  74.9     2.4 5.1E-05   33.1   2.1   25  240-264   208-232 (314)
120 PF12013 DUF3505:  Protein of u  74.7     2.5 5.4E-05   28.7   2.0   26  213-238    80-109 (109)
121 KOG2071|consensus               74.0     2.9 6.3E-05   36.9   2.6   28   91-118   416-443 (579)
122 PF02176 zf-TRAF:  TRAF-type zi  73.8     2.9 6.3E-05   24.6   1.9   21   78-98     23-43  (60)
123 COG5151 SSL1 RNA polymerase II  73.7     3.3 7.1E-05   33.3   2.7   23   93-115   388-410 (421)
124 PF07754 DUF1610:  Domain of un  73.5     1.7 3.8E-05   20.3   0.7    8  241-248    16-23  (24)
125 PF14353 CpXC:  CpXC protein     73.0    0.79 1.7E-05   32.2  -0.8   19  214-232    39-57  (128)
126 COG4530 Uncharacterized protei  72.1     2.6 5.6E-05   28.0   1.5   12  240-251    25-36  (129)
127 COG4888 Uncharacterized Zn rib  71.1    0.93   2E-05   29.6  -0.7   11  271-281    47-57  (104)
128 COG5188 PRP9 Splicing factor 3  70.7     6.1 0.00013   32.4   3.6   22   93-114   238-259 (470)
129 PF12907 zf-met2:  Zinc-binding  69.8     2.8   6E-05   22.5   1.0   27  242-268     2-31  (40)
130 PF05191 ADK_lid:  Adenylate ki  68.8     2.4 5.2E-05   22.2   0.7    9  187-195     3-11  (36)
131 COG5151 SSL1 RNA polymerase II  67.2     6.1 0.00013   31.8   2.8   47  216-264   365-411 (421)
132 PF05495 zf-CHY:  CHY zinc fing  66.9     1.2 2.6E-05   27.5  -0.8   14  213-226    41-54  (71)
133 TIGR01206 lysW lysine biosynth  66.6     2.6 5.6E-05   24.4   0.6   10  214-223     3-12  (54)
134 PF09845 DUF2072:  Zn-ribbon co  66.3     3.7 7.9E-05   28.6   1.3   12  186-197     2-13  (131)
135 PF15269 zf-C2H2_7:  Zinc-finge  65.9       4 8.7E-05   22.2   1.2   20  242-261    21-40  (54)
136 PF12760 Zn_Tnp_IS1595:  Transp  65.9     9.5 0.00021   21.1   2.8    9  240-248    36-44  (46)
137 COG1198 PriA Primosomal protei  64.8     4.5 9.9E-05   37.4   2.0   13  123-135   472-484 (730)
138 KOG4167|consensus               64.6     2.3   5E-05   38.4   0.1   24    9-32    792-815 (907)
139 KOG4167|consensus               63.6     1.7 3.7E-05   39.2  -0.8   25  241-265   792-816 (907)
140 PF14446 Prok-RING_1:  Prokaryo  63.3     4.9 0.00011   23.2   1.3    9  243-251     7-15  (54)
141 KOG4124|consensus               62.6     1.6 3.5E-05   35.6  -1.0   19  269-287   397-415 (442)
142 KOG2593|consensus               62.3     8.4 0.00018   32.8   2.9   36   35-73    126-161 (436)
143 PF10013 DUF2256:  Uncharacteri  61.3     6.5 0.00014   21.2   1.4   11  244-254    11-21  (42)
144 PF08271 TF_Zn_Ribbon:  TFIIB z  61.0     3.9 8.4E-05   22.3   0.6    9  271-279    20-28  (43)
145 COG3357 Predicted transcriptio  60.9     5.7 0.00012   25.5   1.4   27  212-248    57-83  (97)
146 PF01363 FYVE:  FYVE zinc finge  60.3     5.7 0.00012   24.2   1.3   10  187-196    11-20  (69)
147 PF01286 XPA_N:  XPA protein N-  59.4     8.7 0.00019   19.8   1.6   11  243-253     5-15  (34)
148 PF04959 ARS2:  Arsenite-resist  58.9     7.2 0.00016   30.1   1.9   28  212-239    76-103 (214)
149 PF08790 zf-LYAR:  LYAR-type C2  58.5     2.9 6.2E-05   20.4  -0.2   17  187-204     2-18  (28)
150 smart00440 ZnF_C2C2 C2C2 Zinc   58.0     5.2 0.00011   21.5   0.7   10  242-251    29-38  (40)
151 PRK04023 DNA polymerase II lar  57.3     8.6 0.00019   36.6   2.4   14  240-253  1036-1049(1121)
152 KOG2593|consensus               57.1      12 0.00027   31.8   3.1   38   62-102   125-162 (436)
153 PF01096 TFIIS_C:  Transcriptio  56.8     2.9 6.2E-05   22.3  -0.4   10  242-251    29-38  (39)
154 COG4957 Predicted transcriptio  56.5     6.8 0.00015   27.3   1.3   22  242-266    77-98  (148)
155 PRK14714 DNA polymerase II lar  55.5      14  0.0003   36.3   3.5   54  185-281   667-720 (1337)
156 PF07975 C1_4:  TFIIH C1-like d  54.9     6.6 0.00014   22.4   0.9   19  214-232    22-40  (51)
157 PF13824 zf-Mss51:  Zinc-finger  54.9      11 0.00025   21.8   1.8   14  239-252    12-25  (55)
158 PF13453 zf-TFIIB:  Transcripti  54.8      10 0.00022   20.4   1.6   19  240-258    18-36  (41)
159 KOG2636|consensus               54.7       8 0.00017   32.9   1.7   26  265-290   396-422 (497)
160 PTZ00255 60S ribosomal protein  54.4       5 0.00011   26.0   0.3   32  212-253    35-66  (90)
161 PF09416 UPF1_Zn_bind:  RNA hel  54.4      18 0.00038   26.2   3.1   41  238-278    11-68  (152)
162 KOG2807|consensus               54.0      25 0.00054   28.8   4.2   24  241-264   345-368 (378)
163 PRK00432 30S ribosomal protein  53.4       8 0.00017   22.0   1.0    8  214-221    38-45  (50)
164 TIGR00280 L37a ribosomal prote  51.8     4.9 0.00011   26.0   0.0   32  212-253    34-65  (91)
165 KOG4124|consensus               51.7     4.6  0.0001   33.1  -0.1   23  239-261   396-418 (442)
166 PF15135 UPF0515:  Uncharacteri  51.6      18  0.0004   28.3   3.0   16  184-199   154-169 (278)
167 KOG3408|consensus               51.4     9.9 0.00021   26.0   1.4   24  240-263    56-79  (129)
168 cd00065 FYVE FYVE domain; Zinc  51.4     9.8 0.00021   22.0   1.3    9  188-196     5-13  (57)
169 PF01780 Ribosomal_L37ae:  Ribo  51.0       3 6.4E-05   27.0  -1.1   32  212-253    34-65  (90)
170 smart00154 ZnF_AN1 AN1-like Zi  50.2     8.5 0.00018   20.5   0.8   14  241-254    12-25  (39)
171 TIGR00100 hypA hydrogenase nic  50.1     8.5 0.00019   26.4   1.0   13  213-225    70-82  (115)
172 PF04810 zf-Sec23_Sec24:  Sec23  49.7      10 0.00022   20.3   1.1   10  239-248    22-31  (40)
173 COG3091 SprT Zn-dependent meta  49.3     8.7 0.00019   27.5   0.9    7  241-247   140-146 (156)
174 PRK12380 hydrogenase nickel in  49.1     9.8 0.00021   26.0   1.2   12  213-224    70-81  (113)
175 KOG3408|consensus               48.6     9.1  0.0002   26.2   0.9   26  266-291    53-78  (129)
176 PRK03824 hypA hydrogenase nick  48.5     7.9 0.00017   27.5   0.7   15  184-198    69-83  (135)
177 COG1655 Uncharacterized protei  46.7     7.8 0.00017   29.9   0.4   14  185-198    19-32  (267)
178 KOG0717|consensus               46.6      11 0.00024   32.4   1.3   22  242-263   293-314 (508)
179 PF07282 OrfB_Zn_ribbon:  Putat  46.5      15 0.00033   22.3   1.7   12  240-251    45-56  (69)
180 PF13878 zf-C2H2_3:  zinc-finge  46.2      28  0.0006   18.8   2.4   10   11-20     15-24  (41)
181 COG2331 Uncharacterized protei  45.8      13 0.00028   23.0   1.2   10   94-103    13-22  (82)
182 PF01428 zf-AN1:  AN1-like Zinc  45.5     8.9 0.00019   20.9   0.4   15  240-254    12-26  (43)
183 smart00064 FYVE Protein presen  45.1      16 0.00034   22.1   1.6   28  214-253    11-38  (68)
184 PF03811 Zn_Tnp_IS1:  InsA N-te  44.7      14  0.0003   19.3   1.0   18  230-247    18-35  (36)
185 KOG1701|consensus               44.6      15 0.00032   31.2   1.7   39  215-253   396-439 (468)
186 PRK03976 rpl37ae 50S ribosomal  44.5     6.9 0.00015   25.4  -0.1   32  212-253    35-66  (90)
187 TIGR00595 priA primosomal prot  44.0      21 0.00046   31.8   2.7   10  239-248   238-247 (505)
188 KOG0717|consensus               43.8      11 0.00024   32.4   0.9   21  271-291   293-313 (508)
189 PF04959 ARS2:  Arsenite-resist  43.5       8 0.00017   29.8   0.1   30  181-210    73-102 (214)
190 PRK00420 hypothetical protein;  43.1      17 0.00038   24.7   1.6    9  242-250    41-49  (112)
191 KOG1280|consensus               42.9      25 0.00053   29.1   2.7   23  213-235    79-101 (381)
192 PF13451 zf-trcl:  Probable zin  42.7      12 0.00026   21.2   0.7   39  239-277     2-40  (49)
193 PRK14559 putative protein seri  42.6      28  0.0006   32.1   3.3    9  215-223    17-25  (645)
194 PRK00564 hypA hydrogenase nick  42.1      13 0.00028   25.6   0.9   13  213-225    71-83  (117)
195 KOG2636|consensus               41.5      18 0.00038   31.0   1.7   26   32-57    396-422 (497)
196 PF04780 DUF629:  Protein of un  41.2      20 0.00043   31.3   2.0   26  242-267    58-83  (466)
197 PF14311 DUF4379:  Domain of un  39.5      20 0.00044   20.6   1.4   17  185-201    28-44  (55)
198 PF07649 C1_3:  C1-like domain;  39.4      14  0.0003   18.2   0.6    8  241-248    15-22  (30)
199 PF04423 Rad50_zn_hook:  Rad50   39.1      10 0.00022   21.8   0.0   13  272-284    22-34  (54)
200 KOG1842|consensus               38.6      17 0.00037   31.1   1.2   24  242-265    16-39  (505)
201 COG5188 PRP9 Splicing factor 3  38.5      19  0.0004   29.8   1.4   26  265-290   369-395 (470)
202 TIGR00686 phnA alkylphosphonat  38.3      17 0.00037   24.4   1.0   29  215-254     4-32  (109)
203 KOG0782|consensus               38.3     3.7 8.1E-05   36.0  -2.6   27  228-254   240-266 (1004)
204 KOG4727|consensus               38.2      16 0.00034   26.8   0.8   20  242-261    76-95  (193)
205 PF01155 HypA:  Hydrogenase exp  38.1      14 0.00031   25.2   0.7   12  214-225    71-82  (113)
206 cd00924 Cyt_c_Oxidase_Vb Cytoc  37.9      17 0.00036   24.1   0.9   17  235-252    74-90  (97)
207 PF06220 zf-U1:  U1 zinc finger  37.8      30 0.00064   18.3   1.7   10  271-280     4-13  (38)
208 PF10276 zf-CHCC:  Zinc-finger   37.7      16 0.00034   19.7   0.6   12  184-195    28-39  (40)
209 PRK12496 hypothetical protein;  37.7      26 0.00055   25.9   1.9   12  242-253   128-139 (164)
210 smart00661 RPOL9 RNA polymeras  37.2      26 0.00056   19.7   1.5   14  241-254    20-33  (52)
211 COG1773 Rubredoxin [Energy pro  37.1      13 0.00029   21.5   0.3   12  270-281     3-14  (55)
212 PF10263 SprT-like:  SprT-like   36.8      15 0.00032   26.7   0.6    6  187-192   125-130 (157)
213 COG1571 Predicted DNA-binding   36.8      21 0.00046   30.6   1.5   13  241-253   367-379 (421)
214 PRK10220 hypothetical protein;  36.1      24 0.00053   23.7   1.4   29  215-254     5-33  (111)
215 PRK03681 hypA hydrogenase nick  35.7      25 0.00054   24.1   1.5   12  213-224    70-81  (114)
216 KOG1280|consensus               35.0      38 0.00082   28.1   2.6   38  183-220    77-116 (381)
217 PF11931 DUF3449:  Domain of un  34.4      13 0.00029   28.1   0.0   24  236-259    96-120 (196)
218 COG0068 HypF Hydrogenase matur  34.1      11 0.00024   34.4  -0.5   54  188-248   126-180 (750)
219 PF14803 Nudix_N_2:  Nudix N-te  34.0      19 0.00041   18.5   0.5    7  242-248    23-29  (34)
220 PF07295 DUF1451:  Protein of u  33.6      16 0.00034   26.4   0.2    8  214-221   113-120 (146)
221 KOG0782|consensus               33.1      14 0.00029   32.8  -0.1   53  197-255   237-290 (1004)
222 PF08209 Sgf11:  Sgf11 (transcr  33.1      32  0.0007   17.6   1.3   22  241-263     4-25  (33)
223 COG1327 Predicted transcriptio  32.9      19 0.00041   25.8   0.6   11  215-225    30-40  (156)
224 PF09963 DUF2197:  Uncharacteri  32.7      16 0.00035   21.3   0.2   36  215-250     4-40  (56)
225 PF04780 DUF629:  Protein of un  32.5      26 0.00057   30.5   1.5   21  271-291    58-78  (466)
226 COG0068 HypF Hydrogenase matur  32.1     8.9 0.00019   35.0  -1.4   29   39-73    153-181 (750)
227 KOG0978|consensus               32.0      22 0.00047   32.7   0.9   12  186-197   644-655 (698)
228 PRK05978 hypothetical protein;  32.0      23  0.0005   25.5   0.9   10  215-224    54-63  (148)
229 PRK14873 primosome assembly pr  31.9      37  0.0008   31.5   2.4   10  270-279   422-431 (665)
230 KOG2071|consensus               31.9      32 0.00069   30.8   1.8   27  183-209   416-442 (579)
231 PRK14892 putative transcriptio  30.6      25 0.00053   23.4   0.8    8  185-192    21-28  (99)
232 COG1571 Predicted DNA-binding   30.5      26 0.00056   30.1   1.1   14   65-78    367-380 (421)
233 smart00132 LIM Zinc-binding do  30.1      25 0.00054   17.9   0.7    8  271-278    28-35  (39)
234 PF13821 DUF4187:  Domain of un  29.9      63  0.0014   18.8   2.3   16  272-287    29-44  (55)
235 PF04216 FdhE:  Protein involve  29.8      13 0.00029   30.3  -0.7   77  186-281   173-249 (290)
236 KOG4727|consensus               29.2      30 0.00065   25.3   1.1   21  213-233    75-95  (193)
237 KOG3214|consensus               28.9      19 0.00041   23.7   0.0   14  271-284    48-61  (109)
238 PF11789 zf-Nse:  Zinc-finger o  28.9      47   0.001   19.4   1.7   10  215-224    26-35  (57)
239 KOG0978|consensus               28.8      16 0.00035   33.5  -0.4   18  272-289   680-697 (698)
240 COG3677 Transposase and inacti  28.7      26 0.00057   24.6   0.7   17  238-254    50-66  (129)
241 PF04606 Ogr_Delta:  Ogr/Delta-  28.7     9.3  0.0002   21.3  -1.2   14  240-253    24-39  (47)
242 COG4896 Uncharacterized protei  28.6      40 0.00087   19.9   1.3    8   93-100    31-38  (68)
243 cd00730 rubredoxin Rubredoxin;  28.5      25 0.00054   20.0   0.5   11  271-281     2-12  (50)
244 PF11672 DUF3268:  Protein of u  28.4      45 0.00097   22.4   1.7    8  185-192     2-9   (102)
245 COG4338 Uncharacterized protei  28.4      25 0.00054   19.6   0.4   13  272-284    14-26  (54)
246 TIGR00310 ZPR1_znf ZPR1 zinc f  27.8      26 0.00056   26.6   0.6   11  242-252    31-41  (192)
247 COG3364 Zn-ribbon containing p  27.2      36 0.00078   22.5   1.1   13  213-225     2-14  (112)
248 PLN02294 cytochrome c oxidase   26.8      30 0.00065   25.5   0.7   13  269-281   140-152 (174)
249 PF00301 Rubredoxin:  Rubredoxi  26.8      23 0.00049   19.9   0.1   11  271-281     2-12  (47)
250 COG4640 Predicted membrane pro  26.8      43 0.00092   28.4   1.7   19  241-259    15-33  (465)
251 PF06397 Desulfoferrod_N:  Desu  25.9      33 0.00071   18.0   0.6   12  240-251     5-16  (36)
252 PLN03238 probable histone acet  25.8      40 0.00087   27.3   1.3   24  239-262    46-69  (290)
253 smart00504 Ubox Modified RING   25.7 1.1E+02  0.0024   17.7   3.1   46  214-282     2-47  (63)
254 COG1675 TFA1 Transcription ini  25.6      70  0.0015   23.9   2.5   11  185-195   113-123 (176)
255 PF11023 DUF2614:  Protein of u  25.6      46   0.001   22.6   1.4   10  241-250    69-78  (114)
256 COG4306 Uncharacterized protei  25.4      32  0.0007   23.7   0.7   41  214-254    40-81  (160)
257 KOG1842|consensus               25.4      47   0.001   28.6   1.7   26    9-34     15-40  (505)
258 PTZ00448 hypothetical protein;  25.1      48   0.001   27.9   1.7   23    9-31    314-336 (373)
259 TIGR03830 CxxCG_CxxCG_HTH puta  24.9      35 0.00076   23.6   0.8   19  241-259    31-49  (127)
260 KOG4377|consensus               24.7      67  0.0014   27.4   2.4  104  183-292   269-425 (480)
261 PF13639 zf-RING_2:  Ring finge  24.7      52  0.0011   17.7   1.3   30  239-276    14-43  (44)
262 COG5112 UFD2 U1-like Zn-finger  24.5      27 0.00058   23.2   0.2   22  240-261    54-75  (126)
263 PRK04351 hypothetical protein;  24.4      30 0.00066   25.0   0.4   13  269-281   131-143 (149)
264 PF05129 Elf1:  Transcription e  24.3      24 0.00052   22.5  -0.1    9  184-192    21-29  (81)
265 PTZ00448 hypothetical protein;  24.2      50  0.0011   27.8   1.6   24  241-264   314-337 (373)
266 PRK00762 hypA hydrogenase nick  23.7      35 0.00075   23.8   0.6   14  184-198    69-82  (124)
267 smart00109 C1 Protein kinase C  23.7      59  0.0013   17.6   1.5    8  215-222    13-20  (49)
268 PF14690 zf-ISL3:  zinc-finger   23.3      42 0.00091   18.3   0.8    7  214-220     3-9   (47)
269 PHA02998 RNA polymerase subuni  23.1      39 0.00084   25.1   0.7   10  242-251   172-181 (195)
270 PF12773 DZR:  Double zinc ribb  22.9      49  0.0011   18.4   1.0   10  215-224    14-23  (50)
271 KOG3362|consensus               22.2      28 0.00062   24.7  -0.1   23  241-263   129-151 (156)
272 KOG3002|consensus               21.9      77  0.0017   26.1   2.3   81  183-267    78-165 (299)
273 cd00162 RING RING-finger (Real  21.7 1.3E+02  0.0029   15.4   3.2    9  271-279    36-44  (45)
274 PRK05580 primosome assembly pr  21.5      83  0.0018   29.4   2.7   10  270-279   421-430 (679)
275 COG4391 Uncharacterized protei  21.4      48   0.001   19.7   0.8   12  270-281    48-59  (62)
276 COG1594 RPB9 DNA-directed RNA   21.2      43 0.00094   22.9   0.7   10  214-223   101-110 (113)
277 PRK12860 transcriptional activ  21.0      58  0.0013   24.6   1.3   31  193-224   115-145 (189)
278 PRK01343 zinc-binding protein;  21.0      57  0.0012   19.1   1.0   11  271-281    10-20  (57)
279 PF09082 DUF1922:  Domain of un  21.0      42  0.0009   20.5   0.5   10  240-250    19-28  (68)
280 PF01844 HNH:  HNH endonuclease  21.0      23  0.0005   19.3  -0.6   11  273-283     1-11  (47)
281 PLN03239 histone acetyltransfe  20.7      47   0.001   27.8   0.9   23  239-261   104-126 (351)
282 PF05741 zf-nanos:  Nanos RNA b  20.7      42 0.00091   19.5   0.4   11  240-250    32-42  (55)
283 PF11781 RRN7:  RNA polymerase   20.3      48   0.001   17.3   0.5    6  216-221    11-16  (36)
284 PF00130 C1_1:  Phorbol esters/  20.3      77  0.0017   17.8   1.5   10  213-222    11-20  (53)
285 KOG4118|consensus               20.2      83  0.0018   18.9   1.6   26   38-63     39-64  (74)

No 1  
>KOG2462|consensus
Probab=100.00  E-value=8.8e-35  Score=217.92  Aligned_cols=105  Identities=36%  Similarity=0.789  Sum_probs=97.5

Q ss_pred             CCCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhh
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLR  262 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  262 (292)
                      .+.+.|++|||.|.+...|..|+++|+  -+++|.+|||.|.+.+.|+.|+++|+|||||.|+.|++.|+++++|+.||+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            356889999999999999999999997  589999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCcccCCCCCCccChHHHHhhh
Q psy4830         263 THHTVGANHVCNVCGRSFVRDSYLIRHQ  290 (292)
Q Consensus       263 ~hh~~~~~~~C~~C~~~f~~~~~l~~H~  290 (292)
                      +| .+.++|+|..|+|+|...+.|.+|.
T Consensus       237 TH-S~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  237 TH-SDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             hh-cCCccccCcchhhHHHHHHHHHHhh
Confidence            96 6778999999999999999999995


No 2  
>KOG2462|consensus
Probab=99.98  E-value=2.4e-33  Score=210.23  Aligned_cols=137  Identities=34%  Similarity=0.687  Sum_probs=104.6

Q ss_pred             CceecCccccccCChHHHHHHHHHhhcccCCCCCCccCCCchhhhchhHHHhhhhhhhhcccCCCCCCCcchhhhhcchh
Q psy4830          92 RPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLF  171 (292)
Q Consensus        92 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (292)
                      ..|.|+.||+.+.+.++|.+|.++|....  +.+.+.|..|++.|.+...|                             
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~--s~ka~~C~~C~K~YvSmpAL-----------------------------  177 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLD--SKKAFSCKYCGKVYVSMPAL-----------------------------  177 (279)
T ss_pred             Cceeccccccccccccccchhhccccccc--ccccccCCCCCceeeehHHH-----------------------------
Confidence            44677777777777777777777765432  34556777777777655544                             


Q ss_pred             hhhhhcccCCCCCCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCcccccc
Q psy4830         172 SHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTF  251 (292)
Q Consensus       172 ~~~~h~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f  251 (292)
                        ..|+++|+  -+++|.+|||.|....-|+-|+|+|+|||||.|+.|+|.|+.+++|+.||++|.+.|+|+|..|+|+|
T Consensus       178 --kMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  178 --KMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSF  253 (279)
T ss_pred             --hhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHH
Confidence              34555554  46788888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             CChhHHHHHhhh
Q psy4830         252 TSKSQFAVHLRT  263 (292)
Q Consensus       252 ~~~~~L~~H~~~  263 (292)
                      +.++.|..|...
T Consensus       254 sl~SyLnKH~ES  265 (279)
T KOG2462|consen  254 ALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHhhhh
Confidence            888888888754


No 3  
>KOG1074|consensus
Probab=99.97  E-value=1.2e-32  Score=233.35  Aligned_cols=84  Identities=29%  Similarity=0.618  Sum_probs=71.4

Q ss_pred             eecccccccCCChhHHHHHHHhcCCCCceecCccccccCChHHHHHHHHHhhcccCCCCCCccCC---CchhhhchhHHH
Q psy4830          66 YYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCT---GCDAAFSRKQYL  142 (292)
Q Consensus        66 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~---~C~~~f~~~~~l  142 (292)
                      -.|-+|-++..-++.|+.|.++|+||+||+|.+||+.|.++.+|+.|+-+|-.. +.-...+.|+   +|.+.|...-.|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~-p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAK-PPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccC-ccccccccCCchhhhcccccccccc
Confidence            469999999999999999999999999999999999999999999999887532 3334678899   999999988888


Q ss_pred             hhhhhhhh
Q psy4830         143 EVNHTTVL  150 (292)
Q Consensus       143 ~~~~~~~~  150 (292)
                      ..|...+.
T Consensus       685 pQhIriH~  692 (958)
T KOG1074|consen  685 PQHIRIHL  692 (958)
T ss_pred             cceEEeec
Confidence            77766654


No 4  
>KOG3608|consensus
Probab=99.97  E-value=4.8e-31  Score=203.18  Aligned_cols=247  Identities=26%  Similarity=0.505  Sum_probs=205.5

Q ss_pred             CccC--CcchhhcCC-hhHHHHHHhhhcC----------------------------------CCCcccc--cchhhcCC
Q psy4830           9 PYHC--TACDASFCR-KPYLEIHMRTHTG----------------------------------ERPFQCV--VCLKRFSQ   49 (292)
Q Consensus         9 ~~~C--~~C~~~f~~-~~~l~~H~~~h~~----------------------------------~~~~~C~--~C~~~f~~   49 (292)
                      .+.|  ..|++...+ ..+|.+|.-.|.-                                  ...|.|.  .|+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            3555  457777666 4788999765520                                  0125664  59999999


Q ss_pred             hhHHHHHHhhcCCC-------------cceec--ccccccCCChhHHHHHHHhcCCCCceecCccccccCChHHHHHHHH
Q psy4830          50 KSALNTHKRMHIPY-------------IQYYC--DACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKR  114 (292)
Q Consensus        50 ~~~l~~H~~~h~~~-------------~~~~C--~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  114 (292)
                      ...+..|+..|...             ..+.|  ..|-+.|.++..|++|++.|++++...|+.||..|.++..|..|.+
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~r  228 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLR  228 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHH
Confidence            99999998877421             12445  4688999999999999999999999999999999999999999998


Q ss_pred             HhhcccCCCCCCccCCCchhhhchhHHHhhhhhhhhcccCCCCCCCcchhhhhcchhhhhhhcccCCCCCCccccccccc
Q psy4830         115 IHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKR  194 (292)
Q Consensus       115 ~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~C~~C~k~  194 (292)
                      .-..   ....+|.|..|.+.|.++..|..|...+.                                 .-|+|+.|+.+
T Consensus       229 Rqt~---l~~n~fqC~~C~KrFaTeklL~~Hv~rHv---------------------------------n~ykCplCdmt  272 (467)
T KOG3608|consen  229 RQTE---LNTNSFQCAQCFKRFATEKLLKSHVVRHV---------------------------------NCYKCPLCDMT  272 (467)
T ss_pred             hhhh---hcCCchHHHHHHHHHhHHHHHHHHHHHhh---------------------------------hcccccccccC
Confidence            7542   24568999999999999998876543322                                 24899999999


Q ss_pred             cCCchHHHHHHhh-hcCCCCccccccccccccchhhhhhhccccCCcceeCCc--cccccCChhHHHHHhhhhcCCC--C
Q psy4830         195 FTQKSSLNTHKRV-HTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTS--CHLTFTSKSQFAVHLRTHHTVG--A  269 (292)
Q Consensus       195 f~~~~~L~~H~~~-h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~--C~~~f~~~~~L~~H~~~hh~~~--~  269 (292)
                      ....++|.+|++. |...+||+|+.|++.|.+.+.|.+|..+|+ +-.|.|..  |..+|.+..+|++|++.+|.+.  .
T Consensus       273 c~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~  351 (467)
T KOG3608|consen  273 CSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPI  351 (467)
T ss_pred             CCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCC
Confidence            9999999999986 778899999999999999999999999998 77899988  9999999999999999998554  4


Q ss_pred             CcccCCCCCCccChHHHHhhhcC
Q psy4830         270 NHVCNVCGRSFVRDSYLIRHQNK  292 (292)
Q Consensus       270 ~~~C~~C~~~f~~~~~l~~H~rk  292 (292)
                      +|.|..|++.|++-.+|.+|.+|
T Consensus       352 ~Y~CH~Cdr~ft~G~~L~~HL~k  374 (467)
T KOG3608|consen  352 LYACHCCDRFFTSGKSLSAHLMK  374 (467)
T ss_pred             ceeeecchhhhccchhHHHHHHH
Confidence            69999999999999999999764


No 5  
>KOG3608|consensus
Probab=99.96  E-value=1.8e-29  Score=194.53  Aligned_cols=222  Identities=29%  Similarity=0.575  Sum_probs=192.7

Q ss_pred             CccC--CcchhhcCChhHHHHHHhhhcC------------CCC-cccc--cchhhcCChhHHHHHHhhcCCCcceecccc
Q psy4830           9 PYHC--TACDASFCRKPYLEIHMRTHTG------------ERP-FQCV--VCLKRFSQKSALNTHKRMHIPYIQYYCDAC   71 (292)
Q Consensus         9 ~~~C--~~C~~~f~~~~~l~~H~~~h~~------------~~~-~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C   71 (292)
                      .|.|  ..|+..|.+...|.+|...|..            ++| +.|.  .|.+.|.++..|++|++.|.+++...|+.|
T Consensus       134 ~f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~C  213 (467)
T KOG3608|consen  134 NFRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHC  213 (467)
T ss_pred             hhccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchH
Confidence            3566  5799999999999999987742            112 4565  599999999999999999999999999999


Q ss_pred             cccCCChhHHHHHHHhcC--CCCceecCccccccCChHHHHHHHHHhhcccCCCCCCccCCCchhhhchhHHHhhhhhhh
Q psy4830          72 DATFTTKQNLEVHMRTHT--GERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTV  149 (292)
Q Consensus        72 ~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~  149 (292)
                      |..|.++..|-.|++..+  ...+|.|..|.|.|.+...|..|+..|.+       -|+|+.|+.+....++|..|... 
T Consensus       214 g~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn-------~ykCplCdmtc~~~ssL~~H~r~-  285 (467)
T KOG3608|consen  214 GELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN-------CYKCPLCDMTCSSASSLTTHIRY-  285 (467)
T ss_pred             HHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh-------cccccccccCCCChHHHHHHHHh-
Confidence            999999999999987654  56789999999999999999999999864       48999999999888888644321 


Q ss_pred             hcccCCCCCCCcchhhhhcchhhhhhhcccCCCCCCccccccccccCCchHHHHHHhhhcCCCCccccc--cccccccch
Q psy4830         150 LAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDI--CDKRFAVKS  227 (292)
Q Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~--C~k~f~~~~  227 (292)
                                                   .|..++||+|+.|++.|.+.+.|.+|..+|. +-.|+|+.  |..+|.+..
T Consensus       286 -----------------------------rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~  335 (467)
T KOG3608|consen  286 -----------------------------RHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYT  335 (467)
T ss_pred             -----------------------------hhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHH
Confidence                                         4667899999999999999999999999998 67899998  999999999


Q ss_pred             hhhhhhcccc-CC--cceeCCccccccCChhHHHHHhhhhcCCC
Q psy4830         228 YVTSHRWSHV-GD--KPFGCTSCHLTFTSKSQFAVHLRTHHTVG  268 (292)
Q Consensus       228 ~L~~H~~~h~-~~--~~~~C~~C~~~f~~~~~L~~H~~~hh~~~  268 (292)
                      .|++|++.++ |.  -+|.|..|++.|++..+|.+|++..|.-.
T Consensus       336 q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  336 QMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             HHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhccc
Confidence            9999998765 44  57999999999999999999998877543


No 6  
>KOG1074|consensus
Probab=99.95  E-value=1.8e-28  Score=208.20  Aligned_cols=193  Identities=25%  Similarity=0.458  Sum_probs=136.8

Q ss_pred             ceecCccccccCChHHHHHHHHHhhcccCCCCCCccCCCchhhhchhHHHhhhhhhhhcccCCCCCCCc-----chhhhh
Q psy4830          93 PYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNT-----WSAKFL  167 (292)
Q Consensus        93 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~~~~~~~~~~-----~~~~~~  167 (292)
                      |..|-+|-++.+-.+.|+.|.++|     +|++||+|.+|+++|+++..|+.|+..+....... ....     .+.+-+
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtH-----tGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R-~q~ScP~~~ic~~kf  678 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTH-----TGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPAR-VQFSCPSTFICQKKF  678 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcc-----cCcCccccccccchhccccchhhcccccccCcccc-ccccCCchhhhcccc
Confidence            467999999999999999999985     59999999999999999999998876654332211 1111     111222


Q ss_pred             cchhhhhhhcccCCCC-C------------CccccccccccCCchHHHHHHhhhcC----------------CC----Cc
Q psy4830         168 TSLFSHQVHMRTHTGE-R------------PFQCAVCSKRFTQKSSLNTHKRVHTG----------------ER----PY  214 (292)
Q Consensus       168 ~~~~~~~~h~~~~~~~-~------------~~~C~~C~k~f~~~~~L~~H~~~h~~----------------~~----~~  214 (292)
                      .....++.|+++|.+. .            .-+|..|.+.|.....+..++..|.+                +.    +.
T Consensus       679 tn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~  758 (958)
T KOG1074|consen  679 TNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPP  758 (958)
T ss_pred             cccccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCc
Confidence            2234556777777622 1            23688888888887777777665521                12    45


Q ss_pred             cccccccccccchhhhhhhccc-----------------------cCC--------------------------------
Q psy4830         215 ACDICDKRFAVKSYVTSHRWSH-----------------------VGD--------------------------------  239 (292)
Q Consensus       215 ~C~~C~k~f~~~~~L~~H~~~h-----------------------~~~--------------------------------  239 (292)
                      .+..|+..+.....+..+-..+                       +++                                
T Consensus       759 ~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~  838 (958)
T KOG1074|consen  759 PENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLN  838 (958)
T ss_pred             cccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccc
Confidence            5666777665544443331100                       000                                


Q ss_pred             ---------------------------------------cceeCCccccccCChhHHHHHhhhhcCCCCCcccCCCCCCc
Q psy4830         240 ---------------------------------------KPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSF  280 (292)
Q Consensus       240 ---------------------------------------~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C~~~f  280 (292)
                                                             ....|.+||+.|.+.+.|..|+++| +++++|.|.+|++.|
T Consensus       839 eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTH-tg~KPF~C~fC~~aF  917 (958)
T KOG1074|consen  839 EGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTH-TGPKPFFCHFCEEAF  917 (958)
T ss_pred             cccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcC-CCCCCccchhhhhhh
Confidence                                                   0257999999999999999999995 889999999999999


Q ss_pred             cChHHHHhhhcC
Q psy4830         281 VRDSYLIRHQNK  292 (292)
Q Consensus       281 ~~~~~l~~H~rk  292 (292)
                      ..+.+|+.||.+
T Consensus       918 ttrgnLKvHMgt  929 (958)
T KOG1074|consen  918 TTRGNLKVHMGT  929 (958)
T ss_pred             hhhhhhhhhhcc
Confidence            999999999974


No 7  
>KOG3623|consensus
Probab=99.95  E-value=4.8e-28  Score=202.57  Aligned_cols=106  Identities=32%  Similarity=0.744  Sum_probs=96.2

Q ss_pred             CccCCcchhhcCChhHHHHHHhhhc--CCCCcccccchhhcCChhHHHHHHhhcCCC-------------cceecccccc
Q psy4830           9 PYHCTACDASFCRKPYLEIHMRTHT--GERPFQCVVCLKRFSQKSALNTHKRMHIPY-------------IQYYCDACDA   73 (292)
Q Consensus         9 ~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-------------~~~~C~~C~~   73 (292)
                      ...|++|++.+.....|..|++.-+  .+..|.|..|.++|..+..|.+|+.+|.+.             ..|+|.+||+
T Consensus       210 lltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgK  289 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGK  289 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccch
Confidence            3679999999999999999998643  456799999999999999999999998643             3599999999


Q ss_pred             cCCChhHHHHHHHhcCCCCceecCccccccCChHHHHHHHH
Q psy4830          74 TFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKR  114 (292)
Q Consensus        74 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  114 (292)
                      .|..+..|+.|+++|.|++||.|+.|+|.|+...++..|+-
T Consensus       290 AFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  290 AFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            99999999999999999999999999999999999999974


No 8  
>KOG3576|consensus
Probab=99.82  E-value=1.7e-21  Score=139.35  Aligned_cols=111  Identities=29%  Similarity=0.605  Sum_probs=102.1

Q ss_pred             CCCCCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHH
Q psy4830         181 TGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVH  260 (292)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H  260 (292)
                      .+...|.|.+|+|.|....-|.+|++-|...+.|-|..||+.|.....|++|+++|+|.+||+|..|+|+|.++-+|..|
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            34567999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcCC----------CCCcccCCCCCCccChHHHHhhhc
Q psy4830         261 LRTHHTV----------GANHVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       261 ~~~hh~~----------~~~~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      ++..|+.          .+.|+|+.||.+-.....+..|+.
T Consensus       193 l~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~  233 (267)
T KOG3576|consen  193 LKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLK  233 (267)
T ss_pred             HHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHH
Confidence            9988764          356899999999888888877753


No 9  
>KOG3576|consensus
Probab=99.75  E-value=3.7e-19  Score=127.50  Aligned_cols=115  Identities=32%  Similarity=0.622  Sum_probs=63.5

Q ss_pred             CCCcccccchhhcCChhHHHHHHhhcCCCcceecccccccCCChhHHHHHHHhcCCCCceecCccccccCChHHHHHHHH
Q psy4830          35 ERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKR  114 (292)
Q Consensus        35 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  114 (292)
                      ...|.|.+|++.|.-...|.+|++-|.+.+.+-|..||+.|.+.-.|++|+++|+|.+||+|..|+++|+..-+|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            34455666666666666666666666555556666666666666666666666666666666666666666666666654


Q ss_pred             Hhhc------ccCCCCCCccCCCchhhhchhHHHhhhhhhh
Q psy4830         115 IHIN------YLHTEDKPYHCTGCDAAFSRKQYLEVNHTTV  149 (292)
Q Consensus       115 ~h~~------~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~  149 (292)
                      .-..      +....++.|.|+.||.+-.....+..|...+
T Consensus       195 kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~  235 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLH  235 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhc
Confidence            3211      1112344566666665555554444444333


No 10 
>KOG3623|consensus
Probab=99.70  E-value=2.4e-18  Score=145.07  Aligned_cols=80  Identities=39%  Similarity=0.840  Sum_probs=73.9

Q ss_pred             CCCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhh
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLR  262 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  262 (292)
                      +.+|.|+.|+|.|...++|.+|.--|+|.+||+|.+|.|.|+.+..|..|++.|.|||||.|..|+|.|+...++.+||.
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            45699999999999999999999999999999999999999999999999999999999999999999999999999985


No 11 
>PHA00733 hypothetical protein
Probab=99.48  E-value=2.6e-14  Score=99.33  Aligned_cols=81  Identities=17%  Similarity=0.304  Sum_probs=42.2

Q ss_pred             CCCccccccccccCCchHHHHH--Hh---hhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHH
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTH--KR---VHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQF  257 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H--~~---~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L  257 (292)
                      .+++.|.+|.+.|.+...|..+  ++   .+.+.+||.|+.||+.|.+...|..|++.|  +.+|.|++|+++|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            4556666666666555554444  11   122344555555555555555555555543  2345555555555555555


Q ss_pred             HHHhhhhc
Q psy4830         258 AVHLRTHH  265 (292)
Q Consensus       258 ~~H~~~hh  265 (292)
                      ..|+...|
T Consensus       116 ~~H~~~~h  123 (128)
T PHA00733        116 LDHVCKKH  123 (128)
T ss_pred             HHHHHHhc
Confidence            55555444


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.45  E-value=2.5e-13  Score=115.42  Aligned_cols=99  Identities=21%  Similarity=0.433  Sum_probs=82.9

Q ss_pred             CCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCC----------
Q psy4830         184 RPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS----------  253 (292)
Q Consensus       184 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~----------  253 (292)
                      ..+.|+.|++.|. ...|..|+.+++  +++.|+ ||+.+ .+..|..|+.+|.+.+++.|+.|++.|..          
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhh
Confidence            4478999999996 688999999985  789999 99755 67899999999999999999999999952          


Q ss_pred             hhHHHHHhhhhcCCCCCcccCCCCCCccChHHHHhhh
Q psy4830         254 KSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQ  290 (292)
Q Consensus       254 ~~~L~~H~~~hh~~~~~~~C~~C~~~f~~~~~l~~H~  290 (292)
                      .+.|..|..+.  +.+++.|..||+.+..+. |..|+
T Consensus       527 ~s~Lt~HE~~C--G~rt~~C~~Cgk~Vrlrd-m~~H~  560 (567)
T PLN03086        527 LRGMSEHESIC--GSRTAPCDSCGRSVMLKE-MDIHQ  560 (567)
T ss_pred             hhhHHHHHHhc--CCcceEccccCCeeeehh-HHHHH
Confidence            45899999884  678999999999887653 44454


No 13 
>PHA00733 hypothetical protein
Probab=99.43  E-value=1e-13  Score=96.28  Aligned_cols=92  Identities=17%  Similarity=0.357  Sum_probs=75.9

Q ss_pred             chHHHHHHhhhcCCCCccccccccccccchhhhhh--h---ccccCCcceeCCccccccCChhHHHHHhhhhcCCCCCcc
Q psy4830         198 KSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSH--R---WSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHV  272 (292)
Q Consensus       198 ~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H--~---~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~  272 (292)
                      ...|.++-..-...+++.|.+|++.|.....|..+  +   ..+.+++||.|+.||+.|.+..+|..|++.+   ..+|.
T Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~  101 (128)
T PHA00733         25 LEELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKV  101 (128)
T ss_pred             HHHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCcc
Confidence            45666665555557889999999999988777766  1   2344588999999999999999999999974   35799


Q ss_pred             cCCCCCCccChHHHHhhhcC
Q psy4830         273 CNVCGRSFVRDSYLIRHQNK  292 (292)
Q Consensus       273 C~~C~~~f~~~~~l~~H~rk  292 (292)
                      |++|++.|.....|.+|+++
T Consensus       102 C~~CgK~F~~~~sL~~H~~~  121 (128)
T PHA00733        102 CPVCGKEFRNTDSTLDHVCK  121 (128)
T ss_pred             CCCCCCccCCHHHHHHHHHH
Confidence            99999999999999999874


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.41  E-value=8.1e-13  Score=112.38  Aligned_cols=146  Identities=20%  Similarity=0.442  Sum_probs=107.1

Q ss_pred             eecccccccCCChhHHHHHHHhcCCCCceecCc--cccccCChHHHHHHHHHhhcccCCCCCCccCCCchhhhchhHHHh
Q psy4830          66 YYCDACDATFTTKQNLEVHMRTHTGERPYQCEV--CNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLE  143 (292)
Q Consensus        66 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~  143 (292)
                      -.|+.|..... ...|..|.... ....-.|+.  |+..|.. ..+.              ..+.|+.|++.|. ...|.
T Consensus       408 V~C~NC~~~i~-l~~l~lHe~~C-~r~~V~Cp~~~Cg~v~~r-~el~--------------~H~~C~~Cgk~f~-~s~Le  469 (567)
T PLN03086        408 VECRNCKHYIP-SRSIALHEAYC-SRHNVVCPHDGCGIVLRV-EEAK--------------NHVHCEKCGQAFQ-QGEME  469 (567)
T ss_pred             EECCCCCCccc-hhHHHHHHhhC-CCcceeCCcccccceeec-cccc--------------cCccCCCCCCccc-hHHHH
Confidence            46888877654 34566776432 233456874  8888843 2233              3357889988885 34443


Q ss_pred             hhhhhhhcccCCCCCCCcchhhhhcchhhhhhhcccCCCCCCccccccccccCCchHHHHHHhhhcCCCCcccccccccc
Q psy4830         144 VNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRF  223 (292)
Q Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f  223 (292)
                                                     .|+.+++  .++.|+ ||+.+ .+..|..|+.+|.+++++.|+.|++.|
T Consensus       470 -------------------------------kH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        470 -------------------------------KHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             -------------------------------HHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence                                           4555543  679999 99755 679999999999999999999999999


Q ss_pred             cc----------chhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhcC
Q psy4830         224 AV----------KSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHT  266 (292)
Q Consensus       224 ~~----------~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~  266 (292)
                      ..          ...|..|..+. |.+++.|..||+.+.. ..|..|+...|.
T Consensus       515 ~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrl-rdm~~H~~~~h~  565 (567)
T PLN03086        515 QAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVML-KEMDIHQIAVHQ  565 (567)
T ss_pred             ccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeee-hhHHHHHHHhhc
Confidence            52          35899999885 9999999999999887 468889877664


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.22  E-value=3.2e-12  Score=72.74  Aligned_cols=42  Identities=19%  Similarity=0.453  Sum_probs=19.6

Q ss_pred             ccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYV  229 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L  229 (292)
                      |+|+.||+.|...++|..|+++|+  ++|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            444444444444444444444444  344444444444444433


No 16 
>KOG3993|consensus
Probab=99.20  E-value=4.7e-12  Score=101.25  Aligned_cols=215  Identities=18%  Similarity=0.254  Sum_probs=119.3

Q ss_pred             CcccccchhhcCChhHHHHHHhhcCCCcceecccccccCCChhHHHHHHHhcCCCCcee--cCcccc-ccCChHHHHHHH
Q psy4830          37 PFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQ--CEVCNK-RFSQKSSLNTHK  113 (292)
Q Consensus        37 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~--C~~C~~-~f~~~~~l~~H~  113 (292)
                      .|.|.+|...|.+...|.+|.-.-+-...|+|++|++.|.-..+|..|.++|.....-.  =..=.+ .-.+....+.=.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            37888888888888888888654444456888888888888888888888875321100  000000 000000000000


Q ss_pred             HHhhcccCCCCCCccCCCchhhhchhHHHhhhhhhhhcccCCCCCCCcchhhhhcchhhhhhhcccCCCCCCcccccccc
Q psy4830         114 RIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSK  193 (292)
Q Consensus       114 ~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~C~~C~k  193 (292)
                      +   ......+.-|.|..|++.|.+..+|+.|..++..........-    +|..+.          ...-.+-|+.|+-
T Consensus       347 r---sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~----~f~~s~----------~~~l~~~~~~~a~  409 (500)
T KOG3993|consen  347 R---SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAP----KFLLSR----------VIPLMHFNQAVAT  409 (500)
T ss_pred             c---cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhccc----Ccchhh----------ccccccccccccc
Confidence            0   0011234468888888888888888888766654332221100    000000          0001133444444


Q ss_pred             ccCCchHHHHHHhhhcC-CCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhcCCC
Q psy4830         194 RFTQKSSLNTHKRVHTG-ERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVG  268 (292)
Q Consensus       194 ~f~~~~~L~~H~~~h~~-~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~~~  268 (292)
                      .+...+.--.+...+.+ .....|++|+..+.++..--.+.+.-..+..|.|.+|.-+|.+...|.+|+...|..+
T Consensus       410 h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hpse  485 (500)
T KOG3993|consen  410 HSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPSE  485 (500)
T ss_pred             ccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChHH
Confidence            44433322222222221 1123467777777777666666666666777888899999998889998887776543


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=99.20  E-value=7.8e-12  Score=71.17  Aligned_cols=44  Identities=16%  Similarity=0.425  Sum_probs=41.0

Q ss_pred             CccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHH
Q psy4830         213 PYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFA  258 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~  258 (292)
                      -|+|+.||+.|...+.|..|+++|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999998  7999999999999888775


No 18 
>KOG3993|consensus
Probab=99.02  E-value=5.6e-11  Score=95.19  Aligned_cols=194  Identities=19%  Similarity=0.248  Sum_probs=124.2

Q ss_pred             cceecccccccCCChhHHHHHHHhcCCCCceecCccccccCChHHHHHHHHHhhcccCC---CCCCccCCCchhhhchhH
Q psy4830          64 IQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHT---EDKPYHCTGCDAAFSRKQ  140 (292)
Q Consensus        64 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~---~~~~~~C~~C~~~f~~~~  140 (292)
                      ..|.|..|...|.+.-.|.+|.-.-.-.-.|+|+.|+|.|+-..+|..|.|.|--....   +..|-+     ....+. 
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k-----~~~~~r-  339 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPK-----QAVETR-  339 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChh-----hhhhhh-
Confidence            35899999999999999999964322233599999999999999999999997421100   011100     000000 


Q ss_pred             HHhhhhhhhhcccCCCCCCCcchhhhhcchhhhhhhcccCCCCCCccccccccccCCchHHHHHHhhhcCCC--------
Q psy4830         141 YLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGER--------  212 (292)
Q Consensus       141 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~--------  212 (292)
                      .+          .+...                 + .-....+..|.|.+|++.|.+...|+.|+.+|....        
T Consensus       340 ae----------~~ea~-----------------r-sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~  391 (500)
T KOG3993|consen  340 AE----------VQEAE-----------------R-SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPK  391 (500)
T ss_pred             hh----------hhhcc-----------------c-cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccC
Confidence            00          00000                 0 000123347999999999999999999988875321        


Q ss_pred             ---------CccccccccccccchhhhhhhccccCC-cceeCCccccccCChhHHHHHhhhhcCCCCCcccCCCCCCccC
Q psy4830         213 ---------PYACDICDKRFAVKSYVTSHRWSHVGD-KPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVR  282 (292)
Q Consensus       213 ---------~~~C~~C~k~f~~~~~L~~H~~~h~~~-~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C~~~f~~  282 (292)
                               .+-|+.|+-.+...+.--.+...+.+. ..-.|+.|+-.+.++..--.+.+.-+ ....|.|.+|...|.+
T Consensus       392 f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~-~~q~f~~ky~~atfys  470 (500)
T KOG3993|consen  392 FLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGI-AEQGFTCKYCPATFYS  470 (500)
T ss_pred             cchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccc-hhhccccccchHhhhc
Confidence                     133555555555444433443333322 23468889988888776666654422 3456899999999999


Q ss_pred             hHHHHhhhcC
Q psy4830         283 DSYLIRHQNK  292 (292)
Q Consensus       283 ~~~l~~H~rk  292 (292)
                      ..+|.+|++|
T Consensus       471 s~~ltrhin~  480 (500)
T KOG3993|consen  471 SPGLTRHINK  480 (500)
T ss_pred             CcchHhHhhh
Confidence            9999999864


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.00  E-value=1.8e-10  Score=56.24  Aligned_cols=24  Identities=54%  Similarity=1.146  Sum_probs=12.9

Q ss_pred             HHHHHhhhcCCCCccccccccccc
Q psy4830         201 LNTHKRVHTGERPYACDICDKRFA  224 (292)
Q Consensus       201 L~~H~~~h~~~~~~~C~~C~k~f~  224 (292)
                      |.+|+++|++++||.|++|+++|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            455555555555555555555553


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.97  E-value=2.1e-10  Score=55.99  Aligned_cols=24  Identities=33%  Similarity=0.880  Sum_probs=17.1

Q ss_pred             hhhhhccccCCcceeCCccccccC
Q psy4830         229 VTSHRWSHVGDKPFGCTSCHLTFT  252 (292)
Q Consensus       229 L~~H~~~h~~~~~~~C~~C~~~f~  252 (292)
                      |..|+++|+|++||.|+.|+++|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            666777777777777777777765


No 21 
>PHA00732 hypothetical protein
Probab=98.79  E-value=3.9e-09  Score=66.43  Aligned_cols=46  Identities=17%  Similarity=0.423  Sum_probs=38.4

Q ss_pred             Cccccccccccccchhhhhhhcc-ccCCcceeCCccccccCChhHHHHHhhhh
Q psy4830         213 PYACDICDKRFAVKSYVTSHRWS-HVGDKPFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L~~H~~~-h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      ||.|++||+.|.+...|..|++. |.+   +.|+.||++|.   .|..|+++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhccc
Confidence            68899999999999999999884 553   58999999997   588888765


No 22 
>PHA00616 hypothetical protein
Probab=98.75  E-value=3.6e-09  Score=57.31  Aligned_cols=34  Identities=18%  Similarity=0.321  Sum_probs=23.5

Q ss_pred             CccccccccccCCchHHHHHHhhhcCCCCccccc
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDI  218 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~  218 (292)
                      ||+|+.||+.|..+++|.+|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4667777777777777777777777777766654


No 23 
>PHA00732 hypothetical protein
Probab=98.74  E-value=5.8e-09  Score=65.63  Aligned_cols=48  Identities=27%  Similarity=0.594  Sum_probs=39.2

Q ss_pred             CccccccccccCCchHHHHHHhh-hcCCCCccccccccccccchhhhhhhccccC
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRV-HTGERPYACDICDKRFAVKSYVTSHRWSHVG  238 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~-h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~  238 (292)
                      ||.|+.||+.|.+.++|..|++. |.   ++.|+.||+.|.   .|..|..++.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCC
Confidence            58899999999999999999984 54   358999999998   47888866543


No 24 
>PHA00616 hypothetical protein
Probab=98.65  E-value=1.5e-08  Score=54.86  Aligned_cols=35  Identities=17%  Similarity=0.317  Sum_probs=28.8

Q ss_pred             CccCCcchhhcCChhHHHHHHhhhcCCCCcccccc
Q psy4830           9 PYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVC   43 (292)
Q Consensus         9 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C   43 (292)
                      ||+|..||+.|...++|.+|++.|+|++++.|+.=
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEE
Confidence            67888888888888888888888888888887653


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.54  E-value=8.7e-08  Score=56.09  Aligned_cols=47  Identities=34%  Similarity=0.579  Sum_probs=28.9

Q ss_pred             eeCCccccccCChhHHHHHhhhhcCCC-CCcccCCCCCCccChHHHHhhhc
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHHTVG-ANHVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh~~~-~~~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      |.||+|++ ..+...|..|+...|..+ +.+.||+|...+.  .+|..||+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~   50 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLN   50 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHH
Confidence            66777777 344566777766655543 3566777776544  36666654


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.34  E-value=3.1e-07  Score=43.46  Aligned_cols=22  Identities=36%  Similarity=0.803  Sum_probs=15.0

Q ss_pred             eeCCccccccCChhHHHHHhhh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      |.|+.|++.|.++.+|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5666777777777777777665


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.28  E-value=6.9e-07  Score=52.28  Aligned_cols=20  Identities=40%  Similarity=0.609  Sum_probs=9.8

Q ss_pred             ccccccccccCCchHHHHHHh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKR  206 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~  206 (292)
                      |.||+|++ ..+...|..|..
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~   22 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCE   22 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHH
Confidence            45555555 233445555543


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.25  E-value=5.4e-07  Score=42.63  Aligned_cols=23  Identities=43%  Similarity=1.003  Sum_probs=15.5

Q ss_pred             ccccccccccCCchHHHHHHhhh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVH  208 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h  208 (292)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            46777777777777777776653


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.19  E-value=1.2e-06  Score=41.88  Aligned_cols=24  Identities=50%  Similarity=0.962  Sum_probs=16.5

Q ss_pred             eeCCccccccCChhHHHHHhhhhc
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      |.|++|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777777764


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.15  E-value=1.3e-06  Score=58.76  Aligned_cols=73  Identities=23%  Similarity=0.422  Sum_probs=21.9

Q ss_pred             cccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhh
Q psy4830         187 QCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       187 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      +|..|+..|.+...|..|+...++-..-    ....+.....+..+...-. ...+.|.+|++.|.+...|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            5899999999999999999765543211    1222234444444443322 23699999999999999999999975


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.09  E-value=2e-06  Score=42.42  Aligned_cols=25  Identities=44%  Similarity=0.812  Sum_probs=17.8

Q ss_pred             ceeCCccccccCChhHHHHHhhhhc
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      ||.|..|++.|.+..+|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4677777777777777777776654


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.03  E-value=2e-06  Score=57.84  Aligned_cols=71  Identities=20%  Similarity=0.330  Sum_probs=20.5

Q ss_pred             cccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhcCCCCCcccCCCCCCccChHHHHhhhc
Q psy4830         215 ACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       215 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      +|.+|+..|.+...|..|+...++-..   + ....+.....|..+++..  ....+.|.+|++.|.+...|..||+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~---~-~~~~l~~~~~~~~~~~~~--~~~~~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI---P-DQKYLVDPNRLLNYLRKK--VKESFRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHH
T ss_pred             Ccccccccccccccccccccccccccc---c-cccccccccccccccccc--cCCCCCCCccCCCCcCHHHHHHHHc
Confidence            589999999999999999976655321   1 223334555666665542  3346999999999999999999996


No 33 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.99  E-value=1.9e-06  Score=67.18  Aligned_cols=22  Identities=27%  Similarity=0.854  Sum_probs=11.2

Q ss_pred             CCccccc--cccccccchhhhhhh
Q psy4830         212 RPYACDI--CDKRFAVKSYVTSHR  233 (292)
Q Consensus       212 ~~~~C~~--C~k~f~~~~~L~~H~  233 (292)
                      +||+|++  |.|.+++...|+-|+
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~  371 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHM  371 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhh
Confidence            4555544  555555555555554


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.95  E-value=3e-06  Score=66.13  Aligned_cols=53  Identities=21%  Similarity=0.521  Sum_probs=45.6

Q ss_pred             CCcceeCCc--cccccCChhHHHHHhhhhc------------------CCCCCcccCCCCCCccChHHHHhhh
Q psy4830         238 GDKPFGCTS--CHLTFTSKSQFAVHLRTHH------------------TVGANHVCNVCGRSFVRDSYLIRHQ  290 (292)
Q Consensus       238 ~~~~~~C~~--C~~~f~~~~~L~~H~~~hh------------------~~~~~~~C~~C~~~f~~~~~l~~H~  290 (292)
                      ++|||+|++  |+|++.+...|+-|+.-=|                  ...+||.|++|+|.|++...|+-|.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            459999988  9999999999999986433                  1347999999999999999998875


No 35 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.93  E-value=5.9e-06  Score=39.39  Aligned_cols=23  Identities=52%  Similarity=1.038  Sum_probs=14.2

Q ss_pred             ccccccccccCCchHHHHHHhhh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVH  208 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h  208 (292)
                      |.|++|++.|.+...|+.|++.|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45777777777777777776654


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.90  E-value=6.6e-06  Score=40.52  Aligned_cols=24  Identities=50%  Similarity=1.020  Sum_probs=14.3

Q ss_pred             CccccccccccCCchHHHHHHhhh
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRVH  208 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~h  208 (292)
                      ||.|+.|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355666666666666666666554


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.42  E-value=0.0001  Score=35.59  Aligned_cols=23  Identities=43%  Similarity=0.870  Sum_probs=17.5

Q ss_pred             eeCCccccccCChhHHHHHhhhh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            46778888888888888887754


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.40  E-value=0.00014  Score=35.16  Aligned_cols=24  Identities=42%  Similarity=0.830  Sum_probs=15.6

Q ss_pred             ccccccccccCCchHHHHHHhhhc
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHT  209 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~  209 (292)
                      |.|+.|++.|.+...|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            456667777777777776666553


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.39  E-value=0.00021  Score=39.76  Aligned_cols=30  Identities=20%  Similarity=0.456  Sum_probs=20.3

Q ss_pred             CCcceeCCccccccCChhHHHHHhhhhcCC
Q psy4830         238 GDKPFGCTSCHLTFTSKSQFAVHLRTHHTV  267 (292)
Q Consensus       238 ~~~~~~C~~C~~~f~~~~~L~~H~~~hh~~  267 (292)
                      .+.|-.|++|+..+.+..+|.+|+...|..
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            467888999999999999999998877653


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.36  E-value=0.00015  Score=34.37  Aligned_cols=23  Identities=35%  Similarity=0.836  Sum_probs=16.2

Q ss_pred             eeCCccccccCChhHHHHHhhhhc
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      |.|+.|+.... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67888887777 778888887765


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.32  E-value=0.00022  Score=39.66  Aligned_cols=32  Identities=25%  Similarity=0.600  Sum_probs=21.4

Q ss_pred             CCCCccccccccccCCchHHHHHHhhhcCCCC
Q psy4830         182 GERPFQCAVCSKRFTQKSSLNTHKRVHTGERP  213 (292)
Q Consensus       182 ~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~  213 (292)
                      .+.|-.|++|+..+.+..+|++|+.+.++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45678899999999988999999888777665


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.31  E-value=0.00016  Score=34.75  Aligned_cols=22  Identities=36%  Similarity=0.816  Sum_probs=14.0

Q ss_pred             eeCCccccccCChhHHHHHhhh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666654


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=97.20  E-value=0.00018  Score=52.17  Aligned_cols=38  Identities=32%  Similarity=0.848  Sum_probs=28.3

Q ss_pred             CccccccccccCCchHHHHHHhhhcCCCCccccccccccccc
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVK  226 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~  226 (292)
                      +|.|. |+.   ...++.+|.++|.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            57787 776   666777888888887788888887777644


No 44 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.19  E-value=0.00024  Score=34.81  Aligned_cols=21  Identities=24%  Similarity=0.665  Sum_probs=14.9

Q ss_pred             cccCCCCCCccChHHHHhhhc
Q psy4830         271 HVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       271 ~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      |.|.+|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567777777777777777764


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.16  E-value=0.00025  Score=34.02  Aligned_cols=22  Identities=41%  Similarity=0.907  Sum_probs=13.3

Q ss_pred             ccccccccccCCchHHHHHHhh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRV  207 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~  207 (292)
                      |.|++|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666554


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=97.13  E-value=0.00015  Score=52.56  Aligned_cols=37  Identities=27%  Similarity=0.630  Sum_probs=21.0

Q ss_pred             CccccccccccccchhhhhhhccccCCcceeCCccccccCC
Q psy4830         213 PYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS  253 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~  253 (292)
                      +|.|. |+.   ....+..|.++|+++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            45665 555   44455566666666666666666655543


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.02  E-value=0.00029  Score=34.53  Aligned_cols=22  Identities=32%  Similarity=0.789  Sum_probs=13.9

Q ss_pred             eeCCccccccCChhHHHHHhhh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666666654


No 48 
>KOG2231|consensus
Probab=96.94  E-value=0.0013  Score=57.93  Aligned_cols=69  Identities=22%  Similarity=0.467  Sum_probs=44.9

Q ss_pred             ccccccccccCCchHHHHHHhhhcCCCCcccccc------ccccccchhhhhhhccccCCcceeCC--ccc-cccCChhH
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHTGERPYACDIC------DKRFAVKSYVTSHRWSHVGDKPFGCT--SCH-LTFTSKSQ  256 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C------~k~f~~~~~L~~H~~~h~~~~~~~C~--~C~-~~f~~~~~  256 (292)
                      -.|..|...|.....|.+|++.++    |.|..|      +.-|.....|..|-+.++    |.|+  .|. +.|.....
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~  254 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFE  254 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhH
Confidence            468888888988889988887654    445555      355667777887776544    6676  453 34444434


Q ss_pred             HHHHhh
Q psy4830         257 FAVHLR  262 (292)
Q Consensus       257 L~~H~~  262 (292)
                      +..+++
T Consensus       255 ~ei~lk  260 (669)
T KOG2231|consen  255 LEIELK  260 (669)
T ss_pred             HHHHHH
Confidence            444444


No 49 
>KOG2785|consensus
Probab=96.84  E-value=0.0036  Score=50.87  Aligned_cols=111  Identities=19%  Similarity=0.258  Sum_probs=75.5

Q ss_pred             CCCCCccccccccccCCchHHHHHHhh--hc---------CC------CCcc-------------ccccccccccchhhh
Q psy4830         181 TGERPFQCAVCSKRFTQKSSLNTHKRV--HT---------GE------RPYA-------------CDICDKRFAVKSYVT  230 (292)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~L~~H~~~--h~---------~~------~~~~-------------C~~C~k~f~~~~~L~  230 (292)
                      .++-++.|.+|.+.|.+......|+..  |.         ++      ....             +..+...+.......
T Consensus        64 ~~~~~~~c~~c~k~~~s~~a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~  143 (390)
T KOG2785|consen   64 EAESVVYCEACNKSFASPKAHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSE  143 (390)
T ss_pred             hcccceehHHhhccccChhhHHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccch
Confidence            355678999999999999999999753  21         00      0111             333333333322222


Q ss_pred             hhhccc------------cCCcceeCCccccccCChhHHHHHhhhhcC----------------------CCCCcccCCC
Q psy4830         231 SHRWSH------------VGDKPFGCTSCHLTFTSKSQFAVHLRTHHT----------------------VGANHVCNVC  276 (292)
Q Consensus       231 ~H~~~h------------~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~----------------------~~~~~~C~~C  276 (292)
                      .+...-            ...-|-.|-.|++.|.+...-..||-.+|+                      .+..|.|-.|
T Consensus       144 e~~~dd~~Edi~~d~~~e~e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~C  223 (390)
T KOG2785|consen  144 EEEEDDEEEDIEEDGDDEDELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFC  223 (390)
T ss_pred             hhccCcchhhhhhccchhcccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEe
Confidence            322110            112357899999999999999999999885                      2345789999


Q ss_pred             C---CCccChHHHHhhhc
Q psy4830         277 G---RSFVRDSYLIRHQN  291 (292)
Q Consensus       277 ~---~~f~~~~~l~~H~r  291 (292)
                      +   +.|.+-...+.||+
T Consensus       224 N~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  224 NELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             ccccCcccccHHHHHHHh
Confidence            9   99999999999996


No 50 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.82  E-value=0.00085  Score=31.75  Aligned_cols=23  Identities=35%  Similarity=0.700  Sum_probs=13.4

Q ss_pred             ccccccccccCCchHHHHHHhhhc
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHT  209 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~  209 (292)
                      |+|+.|+.... ...|.+|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666766665 666666666654


No 51 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.71  E-value=0.0016  Score=51.91  Aligned_cols=99  Identities=24%  Similarity=0.500  Sum_probs=53.0

Q ss_pred             ccccc--cccccCCchHHHHHHhhhcCCCCcccccccc---ccc------cchhhhhhhccccCCcce----eCCccccc
Q psy4830         186 FQCAV--CSKRFTQKSSLNTHKRVHTGERPYACDICDK---RFA------VKSYVTSHRWSHVGDKPF----GCTSCHLT  250 (292)
Q Consensus       186 ~~C~~--C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k---~f~------~~~~L~~H~~~h~~~~~~----~C~~C~~~  250 (292)
                      |.|+.  |..+...-..|..|.++-++  .+.|.+|-.   .|.      ++..|+.|...-..+.-|    .|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            55653  55555555566667665443  244555532   222      345566665443222111    47777777


Q ss_pred             cCChhHHHHHhhhhcCCCCCcccCCCCCC-------ccChHHHHhhhc
Q psy4830         251 FTSKSQFAVHLRTHHTVGANHVCNVCGRS-------FVRDSYLIRHQN  291 (292)
Q Consensus       251 f~~~~~L~~H~~~hh~~~~~~~C~~C~~~-------f~~~~~l~~H~r  291 (292)
                      |.+-..|..|+|..|.     .|-+|+++       |.+-.+|..|.+
T Consensus       230 FYdDDEL~~HcR~~HE-----~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         230 FYDDDELRRHCRLRHE-----ACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             ecChHHHHHHHHhhhh-----hhhhhhccCccchhhhhCHHHHHHHhh
Confidence            7777777777766543     25555543       555566666644


No 52 
>KOG1146|consensus
Probab=96.46  E-value=0.0012  Score=61.83  Aligned_cols=104  Identities=20%  Similarity=0.376  Sum_probs=77.2

Q ss_pred             ccccccccCCchHHHHHHhh-hcCCCCccccccccccccchhhhhhhcccc-------------------------CCcc
Q psy4830         188 CAVCSKRFTQKSSLNTHKRV-HTGERPYACDICDKRFAVKSYVTSHRWSHV-------------------------GDKP  241 (292)
Q Consensus       188 C~~C~k~f~~~~~L~~H~~~-h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~-------------------------~~~~  241 (292)
                      |..|+..+.....+..|+.+ +.-.+.|+|+.|+..|.....|..|+++-+                         +.++
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            44455556666666666543 555678999999999999999999998721                         2358


Q ss_pred             eeCCccccccCChhHHHHHhhhhcC------------------------------------------CCCCcccCCCCCC
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHHT------------------------------------------VGANHVCNVCGRS  279 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh~------------------------------------------~~~~~~C~~C~~~  279 (292)
                      |.|..|..++..+.+|.+|++.--.                                          ....+.|.+|++.
T Consensus       519 ~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~ye  598 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYE  598 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcch
Confidence            9999999999999999999864210                                          0124789999998


Q ss_pred             ccChHHHHhhhc
Q psy4830         280 FVRDSYLIRHQN  291 (292)
Q Consensus       280 f~~~~~l~~H~r  291 (292)
                      -.-..+|..||.
T Consensus       599 tniarnlrihmt  610 (1406)
T KOG1146|consen  599 TNIARNLRIHMT  610 (1406)
T ss_pred             hhhhhccccccc
Confidence            888888888874


No 53 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.33  E-value=0.0029  Score=30.18  Aligned_cols=20  Identities=25%  Similarity=0.906  Sum_probs=15.0

Q ss_pred             ccccccccccCCchHHHHHHh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKR  206 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~  206 (292)
                      .+|+.||+.| ..+.|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4688888888 6677888765


No 54 
>KOG2231|consensus
Probab=96.30  E-value=0.0045  Score=54.70  Aligned_cols=89  Identities=24%  Similarity=0.414  Sum_probs=50.5

Q ss_pred             CCchHHHHHHh-hhcCCCCcccccccc---------ccccchhhhhhhccccC-Cc----ceeCCccccccCChhHHHHH
Q psy4830         196 TQKSSLNTHKR-VHTGERPYACDICDK---------RFAVKSYVTSHRWSHVG-DK----PFGCTSCHLTFTSKSQFAVH  260 (292)
Q Consensus       196 ~~~~~L~~H~~-~h~~~~~~~C~~C~k---------~f~~~~~L~~H~~~h~~-~~----~~~C~~C~~~f~~~~~L~~H  260 (292)
                      .+...|+.|+. .|.   .+.|.+|-.         .--+...|..|+..--. ++    .-.|..|...|.....|..|
T Consensus       125 ~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH  201 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHK---LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRH  201 (669)
T ss_pred             hHHHHHHHHHHHhhh---hhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHh
Confidence            36777888874 342   233443321         22234556666543211 11    12577788888888888888


Q ss_pred             hhhhcCCCCCcccCCC------CCCccChHHHHhhhcC
Q psy4830         261 LRTHHTVGANHVCNVC------GRSFVRDSYLIRHQNK  292 (292)
Q Consensus       261 ~~~hh~~~~~~~C~~C------~~~f~~~~~l~~H~rk  292 (292)
                      ++..|     |.|.+|      +..|..-..|..|.|+
T Consensus       202 ~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~  234 (669)
T KOG2231|consen  202 LRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRK  234 (669)
T ss_pred             hccce-----eheeecCcccccchhcccchHHHHHhhh
Confidence            77665     345555      3556667777777653


No 55 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.92  E-value=0.0063  Score=29.02  Aligned_cols=19  Identities=21%  Similarity=0.557  Sum_probs=10.5

Q ss_pred             eCCccccccCChhHHHHHhh
Q psy4830         243 GCTSCHLTFTSKSQFAVHLR  262 (292)
Q Consensus       243 ~C~~C~~~f~~~~~L~~H~~  262 (292)
                      .|+.||+.| ..+.|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            455666666 4455555544


No 56 
>KOG1146|consensus
Probab=95.90  E-value=0.0034  Score=58.95  Aligned_cols=76  Identities=20%  Similarity=0.344  Sum_probs=61.4

Q ss_pred             ccccccccccchhhhhhhc-cccCCcceeCCccccccCChhHHHHHhhhhcC------------------------CCCC
Q psy4830         216 CDICDKRFAVKSYVTSHRW-SHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHT------------------------VGAN  270 (292)
Q Consensus       216 C~~C~k~f~~~~~L~~H~~-~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~------------------------~~~~  270 (292)
                      |.-|+..+.++..+..|+. .+.-.+.|+|+.|+..|.....|..|||..|.                        .+++
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            4445566666666766654 45666899999999999999999999998542                        3367


Q ss_pred             cccCCCCCCccChHHHHhhhc
Q psy4830         271 HVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       271 ~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      |.|..|..+++.+.+|.+||.
T Consensus       519 ~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ccceeeeeeeecchHHHHHHH
Confidence            999999999999999999985


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.80  E-value=0.0074  Score=31.48  Aligned_cols=21  Identities=19%  Similarity=0.529  Sum_probs=12.4

Q ss_pred             CcccCCCCCCccChHHHHhhh
Q psy4830         270 NHVCNVCGRSFVRDSYLIRHQ  290 (292)
Q Consensus       270 ~~~C~~C~~~f~~~~~l~~H~  290 (292)
                      +|.|++|++.|.+...+..|+
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHHHHHHHH
Confidence            355666666666666666554


No 58 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.48  E-value=0.011  Score=30.82  Aligned_cols=23  Identities=35%  Similarity=0.714  Sum_probs=18.3

Q ss_pred             ceeCCccccccCChhHHHHHhhh
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      +|.|++|++.|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888888888888754


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.37  E-value=0.0055  Score=52.98  Aligned_cols=53  Identities=32%  Similarity=0.767  Sum_probs=41.9

Q ss_pred             ceecccccccCCChhHHHHHHH--hcCCC--CceecC--ccccccCChHHHHHHHHHhh
Q psy4830          65 QYYCDACDATFTTKQNLEVHMR--THTGE--RPYQCE--VCNKRFSQKSSLNTHKRIHI  117 (292)
Q Consensus        65 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~  117 (292)
                      ++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.....+..|...|.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~  347 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHT  347 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccccc
Confidence            5678888888888888888888  68888  788888  68888888888877777654


No 60 
>KOG2785|consensus
Probab=95.31  E-value=0.067  Score=43.82  Aligned_cols=76  Identities=21%  Similarity=0.380  Sum_probs=44.9

Q ss_pred             CcccccchhhcCChhHHHHHHhh--cC-------CCcceecccccccCCChhHHHHHHH---hcCCCCceecCccccccC
Q psy4830          37 PFQCVVCLKRFSQKSALNTHKRM--HI-------PYIQYYCDACDATFTTKQNLEVHMR---THTGERPYQCEVCNKRFS  104 (292)
Q Consensus        37 ~~~C~~C~~~f~~~~~l~~H~~~--h~-------~~~~~~C~~C~~~f~~~~~l~~H~~---~h~~~~~~~C~~C~~~f~  104 (292)
                      .|.|.-|...|.+...-+.|+++  |.       ...|   ++=-..|..+..-..-..   .-.++.++.|.+|.+.|.
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lP---PItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~   79 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLP---PITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFA   79 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCC---CcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhcccc
Confidence            47899999999998888888753  21       0111   111122222211111100   123455788999999999


Q ss_pred             ChHHHHHHHHH
Q psy4830         105 QKSSLNTHKRI  115 (292)
Q Consensus       105 ~~~~l~~H~~~  115 (292)
                      +......|+..
T Consensus        80 s~~a~~~hl~S   90 (390)
T KOG2785|consen   80 SPKAHENHLKS   90 (390)
T ss_pred             ChhhHHHHHHH
Confidence            98888888764


No 61 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.22  E-value=0.015  Score=29.82  Aligned_cols=10  Identities=60%  Similarity=1.185  Sum_probs=6.1

Q ss_pred             CCcccCCCCC
Q psy4830         269 ANHVCNVCGR  278 (292)
Q Consensus       269 ~~~~C~~C~~  278 (292)
                      .++.|++||.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4566666665


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.78  E-value=0.013  Score=50.72  Aligned_cols=107  Identities=29%  Similarity=0.513  Sum_probs=79.8

Q ss_pred             CCccccccccccCCchHHHHHHh--hhcCC--CCcccc--ccccccccchhhhhhhccccCCcceeCCc--cccccC---
Q psy4830         184 RPFQCAVCSKRFTQKSSLNTHKR--VHTGE--RPYACD--ICDKRFAVKSYVTSHRWSHVGDKPFGCTS--CHLTFT---  252 (292)
Q Consensus       184 ~~~~C~~C~k~f~~~~~L~~H~~--~h~~~--~~~~C~--~C~k~f~~~~~L~~H~~~h~~~~~~~C~~--C~~~f~---  252 (292)
                      .++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.+...+..|...|.+..++.+..  +...+.   
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            46899999999999999999999  89999  999999  89999999999999999998776655533  333333   


Q ss_pred             --------------------------------ChhHHHHHhhhhcCCC--CCcccCCCCCCccChHHHHhhhc
Q psy4830         253 --------------------------------SKSQFAVHLRTHHTVG--ANHVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       253 --------------------------------~~~~L~~H~~~hh~~~--~~~~C~~C~~~f~~~~~l~~H~r  291 (292)
                                                      ....+..|...+ ...  ..+.+..|.+.|.....+..|++
T Consensus       368 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  439 (467)
T COG5048         368 NNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITH-LSFRPYNCKNPPCSKSFNRHYNLIPHKK  439 (467)
T ss_pred             CCCCccchhhccCccCCccccccccchhhhhccccccccccccc-cccCCcCCCCCcchhhccCccccccccc
Confidence                                            333333333222 111  24667888888888888877765


No 63 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=94.72  E-value=0.036  Score=44.53  Aligned_cols=99  Identities=24%  Similarity=0.479  Sum_probs=56.7

Q ss_pred             ccCC--cchhhcCChhHHHHHHhhhcCCCCcccccchh---hcC------ChhHHHHHHhhcCCCcc----eeccccccc
Q psy4830          10 YHCT--ACDASFCRKPYLEIHMRTHTGERPFQCVVCLK---RFS------QKSALNTHKRMHIPYIQ----YYCDACDAT   74 (292)
Q Consensus        10 ~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~---~f~------~~~~l~~H~~~h~~~~~----~~C~~C~~~   74 (292)
                      |.|+  .|..+-.....|..|.+..++  .+-|.+|-.   .|.      ++..|..|...-..+..    -.|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            5665  366666667778888876544  245666532   222      23455566543322211    257777777


Q ss_pred             CCChhHHHHHHHhcCCCCceecCcccc-------ccCChHHHHHHHH
Q psy4830          75 FTTKQNLEVHMRTHTGERPYQCEVCNK-------RFSQKSSLNTHKR  114 (292)
Q Consensus        75 f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~  114 (292)
                      |.+...|..|++..+.    .|-+|++       -|.+..+|..|.+
T Consensus       230 FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         230 FYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             ecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhh
Confidence            7777777777765442    3444443       3566666776654


No 64 
>KOG2893|consensus
Probab=94.59  E-value=0.013  Score=44.38  Aligned_cols=46  Identities=24%  Similarity=0.585  Sum_probs=35.1

Q ss_pred             cccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhh-hccc
Q psy4830         187 QCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSH-RWSH  236 (292)
Q Consensus       187 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H-~~~h  236 (292)
                      .|-+|++.|....-|.+|++.    +-|+|.+|-|...+-..|..| |.+|
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhh
Confidence            488888888888888888764    458888888887777777777 3444


No 65 
>KOG4173|consensus
Probab=94.27  E-value=0.016  Score=42.82  Aligned_cols=85  Identities=21%  Similarity=0.515  Sum_probs=64.6

Q ss_pred             CCccccc--cccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhcc----------ccCCcceeCC--cccc
Q psy4830         184 RPFQCAV--CSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWS----------HVGDKPFGCT--SCHL  249 (292)
Q Consensus       184 ~~~~C~~--C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~----------h~~~~~~~C~--~C~~  249 (292)
                      ..|.|++  |...|.....+..|..+-++.   .|..|.+.|.+...|..|+..          -.|...|.|-  .|+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            4577876  778898888888886554442   699999999999999988642          2356679994  4999


Q ss_pred             ccCChhHHHHHhhhhcCCCCCc
Q psy4830         250 TFTSKSQFAVHLRTHHTVGANH  271 (292)
Q Consensus       250 ~f~~~~~L~~H~~~hh~~~~~~  271 (292)
                      .|.+...-+.|+-..|.-...|
T Consensus       155 KFkT~r~RkdH~I~~Hk~Pa~f  176 (253)
T KOG4173|consen  155 KFKTSRDRKDHMIRMHKYPADF  176 (253)
T ss_pred             hhhhhhhhhhHHHHhccCCcce
Confidence            9999999999987666544443


No 66 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.20  E-value=0.092  Score=35.34  Aligned_cols=79  Identities=19%  Similarity=0.439  Sum_probs=39.6

Q ss_pred             CCcccccchhhcCChhHHHHHHhhcCCC------------cceecccccccCCChhHHHHHHHhcCCCCceecCcccccc
Q psy4830          36 RPFQCVVCLKRFSQKSALNTHKRMHIPY------------IQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRF  103 (292)
Q Consensus        36 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  103 (292)
                      -|..|++||-..-....|.+----=.+.            ....|-.|...|........  ..-.....|.|+.|...|
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCcc
Confidence            4566777776666665555431100000            11237777777765421110  001123357777777777


Q ss_pred             CChHHHHHHHHHh
Q psy4830         104 SQKSSLNTHKRIH  116 (292)
Q Consensus       104 ~~~~~l~~H~~~h  116 (292)
                      -..-..-.|...|
T Consensus        92 C~dCD~fiHe~Lh  104 (112)
T TIGR00622        92 CVDCDVFVHESLH  104 (112)
T ss_pred             ccccchhhhhhcc
Confidence            7666666665543


No 67 
>KOG2482|consensus
Probab=93.62  E-value=0.058  Score=43.35  Aligned_cols=105  Identities=24%  Similarity=0.415  Sum_probs=66.9

Q ss_pred             CccccccccccCCchHHHHHHhh--hcCCCCcccccccccc------ccchhhhhhh----ccc---------------c
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRV--HTGERPYACDICDKRF------AVKSYVTSHR----WSH---------------V  237 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~--h~~~~~~~C~~C~k~f------~~~~~L~~H~----~~h---------------~  237 (292)
                      .+.|-.|.+.|+.+..|+.||+.  |..-.|-. ..=++-|      ..++.+..|.    .+-               .
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPkn-reYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed  273 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKN-REYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNED  273 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCc-cccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcC
Confidence            47899999999999999999975  32211100 0001101      0011111111    000               1


Q ss_pred             CCcc--eeCCccccccCChhHHHHHhhhhcCCC--------------------------CCcccCCCCCCccChHHHHhh
Q psy4830         238 GDKP--FGCTSCHLTFTSKSQFAVHLRTHHTVG--------------------------ANHVCNVCGRSFVRDSYLIRH  289 (292)
Q Consensus       238 ~~~~--~~C~~C~~~f~~~~~L~~H~~~hh~~~--------------------------~~~~C~~C~~~f~~~~~l~~H  289 (292)
                      +..+  .+|-.|....-+...|..||++.|.-+                          ..-.|..|+-.|.....|..|
T Consensus       274 ~a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~h  353 (423)
T KOG2482|consen  274 DAEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIH  353 (423)
T ss_pred             CCCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhh
Confidence            1123  589999999999999999999887311                          123599999999999999999


Q ss_pred             h
Q psy4830         290 Q  290 (292)
Q Consensus       290 ~  290 (292)
                      |
T Consensus       354 m  354 (423)
T KOG2482|consen  354 M  354 (423)
T ss_pred             c
Confidence            8


No 68 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.09  E-value=0.3  Score=32.97  Aligned_cols=84  Identities=20%  Similarity=0.370  Sum_probs=55.1

Q ss_pred             CCCccccccccccCCchHHHHHHhhhc--------------CCCCccccccccccccchhhhhhhccccCCcceeCCccc
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHT--------------GERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCH  248 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~--------------~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~  248 (292)
                      +-|..|++||-+......|.+-.  |+              ....-.|--|+..|........  ..-.....|.|+.|.
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~   88 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSY--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCK   88 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhh--hccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCC
Confidence            35788999999999888887742  21              0111248888888876532110  001223478899999


Q ss_pred             cccCChhHHHHHhhhhcCCCCCcccCCCC
Q psy4830         249 LTFTSKSQFAVHLRTHHTVGANHVCNVCG  277 (292)
Q Consensus       249 ~~f~~~~~L~~H~~~hh~~~~~~~C~~C~  277 (292)
                      ..|-..-+.-.|...|       .|+-|.
T Consensus        89 ~~FC~dCD~fiHe~Lh-------~CPGC~  110 (112)
T TIGR00622        89 NVFCVDCDVFVHESLH-------CCPGCI  110 (112)
T ss_pred             Cccccccchhhhhhcc-------CCcCCC
Confidence            9998888888887664       377665


No 69 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.81  E-value=0.054  Score=30.80  Aligned_cols=32  Identities=19%  Similarity=0.575  Sum_probs=25.1

Q ss_pred             cccCCcceeCCccccccCChhHHHHHhhhhcC
Q psy4830         235 SHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHT  266 (292)
Q Consensus       235 ~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~  266 (292)
                      .-.||.-+.||-||..|....++.+|....|.
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34567778899999999988888888876653


No 70 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.63  E-value=0.11  Score=26.78  Aligned_cols=26  Identities=23%  Similarity=0.654  Sum_probs=15.6

Q ss_pred             ceeCCccccccCChhHHHHHhhhhcCCCCCcccCCCCCC
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRS  279 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C~~~  279 (292)
                      .|.|.+||..+...             ..|-.|++||..
T Consensus         2 ~~~C~~CG~i~~g~-------------~~p~~CP~Cg~~   27 (34)
T cd00729           2 VWVCPVCGYIHEGE-------------EAPEKCPICGAP   27 (34)
T ss_pred             eEECCCCCCEeECC-------------cCCCcCcCCCCc
Confidence            36777777655331             245677777763


No 71 
>KOG2893|consensus
Probab=92.61  E-value=0.034  Score=42.18  Aligned_cols=46  Identities=26%  Similarity=0.567  Sum_probs=38.9

Q ss_pred             ccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhc
Q psy4830         216 CDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       216 C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      |-+|++.|.....|.+|++    .|.|+|.+|.|...+--.|..|-...|
T Consensus        13 cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceeehhhhh
Confidence            9999999999999999876    467999999999988888888854433


No 72 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.31  E-value=0.058  Score=41.59  Aligned_cols=13  Identities=15%  Similarity=0.496  Sum_probs=9.5

Q ss_pred             eeCCccccccCCh
Q psy4830         242 FGCTSCHLTFTSK  254 (292)
Q Consensus       242 ~~C~~C~~~f~~~  254 (292)
                      ..||.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            4688888877654


No 73 
>KOG4173|consensus
Probab=92.13  E-value=0.041  Score=40.78  Aligned_cols=76  Identities=21%  Similarity=0.425  Sum_probs=61.1

Q ss_pred             CCccccc--cccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhcC---------CCCCcccCC--CCC
Q psy4830         212 RPYACDI--CDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHT---------VGANHVCNV--CGR  278 (292)
Q Consensus       212 ~~~~C~~--C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~---------~~~~~~C~~--C~~  278 (292)
                      ..|.|++  |...|........|-.+-++.   .|.+|.+.|.+.--|..|+..-|.         +...|+|-+  |+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            4578887  888999988888887554442   799999999999999999876552         334688965  999


Q ss_pred             CccChHHHHhhh
Q psy4830         279 SFVRDSYLIRHQ  290 (292)
Q Consensus       279 ~f~~~~~l~~H~  290 (292)
                      .|.+...-..||
T Consensus       155 KFkT~r~RkdH~  166 (253)
T KOG4173|consen  155 KFKTSRDRKDHM  166 (253)
T ss_pred             hhhhhhhhhhHH
Confidence            999999988886


No 74 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.85  E-value=0.12  Score=34.77  Aligned_cols=13  Identities=31%  Similarity=0.851  Sum_probs=6.2

Q ss_pred             ceeCCccccccCC
Q psy4830         241 PFGCTSCHLTFTS  253 (292)
Q Consensus       241 ~~~C~~C~~~f~~  253 (292)
                      |-.||.||..|.-
T Consensus        26 PivCP~CG~~~~~   38 (108)
T PF09538_consen   26 PIVCPKCGTEFPP   38 (108)
T ss_pred             CccCCCCCCccCc
Confidence            4445555544443


No 75 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.68  E-value=0.098  Score=29.76  Aligned_cols=26  Identities=23%  Similarity=0.489  Sum_probs=14.4

Q ss_pred             CCCCccCCcchhhcCChhHHHHHHhh
Q psy4830           6 GNKPYHCTACDASFCRKPYLEIHMRT   31 (292)
Q Consensus         6 ~~~~~~C~~C~~~f~~~~~l~~H~~~   31 (292)
                      |+--+.|+-|+..|....++.+|...
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhH
Confidence            44445566666666555555555543


No 76 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.25  E-value=0.2  Score=29.16  Aligned_cols=11  Identities=36%  Similarity=0.757  Sum_probs=6.4

Q ss_pred             CCCcccCCCCC
Q psy4830         268 GANHVCNVCGR  278 (292)
Q Consensus       268 ~~~~~C~~C~~  278 (292)
                      +.+|.|+.||.
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            35566666654


No 77 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.34  E-value=0.18  Score=26.75  Aligned_cols=11  Identities=27%  Similarity=0.896  Sum_probs=5.1

Q ss_pred             eCCccccccCC
Q psy4830         243 GCTSCHLTFTS  253 (292)
Q Consensus       243 ~C~~C~~~f~~  253 (292)
                      .|+.|+..|.-
T Consensus         4 ~CP~C~~~~~v   14 (38)
T TIGR02098         4 QCPNCKTSFRV   14 (38)
T ss_pred             ECCCCCCEEEe
Confidence            44555444443


No 78 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.95  E-value=0.25  Score=25.88  Aligned_cols=11  Identities=36%  Similarity=0.975  Sum_probs=5.6

Q ss_pred             CcccCCCCCCc
Q psy4830         270 NHVCNVCGRSF  280 (292)
Q Consensus       270 ~~~C~~C~~~f  280 (292)
                      ..+|+.|+..|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            44555555544


No 79 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.09  E-value=0.28  Score=35.77  Aligned_cols=10  Identities=50%  Similarity=1.208  Sum_probs=5.4

Q ss_pred             CCCcccCCCC
Q psy4830         268 GANHVCNVCG  277 (292)
Q Consensus       268 ~~~~~C~~C~  277 (292)
                      +.|-+||+||
T Consensus       147 e~P~~CPiCg  156 (166)
T COG1592         147 EAPEVCPICG  156 (166)
T ss_pred             CCCCcCCCCC
Confidence            4455555555


No 80 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.63  E-value=0.086  Score=40.68  Aligned_cols=44  Identities=27%  Similarity=0.584  Sum_probs=31.2

Q ss_pred             CCCccccccccccCCchHHHHHHhhh----------cCCCC-----ccccccccccccc
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVH----------TGERP-----YACDICDKRFAVK  226 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h----------~~~~~-----~~C~~C~k~f~~~  226 (292)
                      ++.+.||+|+..|.++.-+....++-          .+..|     ..||.||.+|...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            35689999999999887666665431          12222     4699999988754


No 81 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=88.47  E-value=0.31  Score=27.15  Aligned_cols=10  Identities=20%  Similarity=0.793  Sum_probs=5.0

Q ss_pred             eeCCcccccc
Q psy4830         242 FGCTSCHLTF  251 (292)
Q Consensus       242 ~~C~~C~~~f  251 (292)
                      |.|+.||..|
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            4555555444


No 82 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=88.16  E-value=0.48  Score=26.15  Aligned_cols=27  Identities=22%  Similarity=0.405  Sum_probs=15.2

Q ss_pred             CCcceeCCccccccCCh----hHHHHHhhhh
Q psy4830         238 GDKPFGCTSCHLTFTSK----SQFAVHLRTH  264 (292)
Q Consensus       238 ~~~~~~C~~C~~~f~~~----~~L~~H~~~h  264 (292)
                      ++....|..|++.+...    ++|..|++..
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            34556788888777664    6788887543


No 83 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=87.51  E-value=0.33  Score=23.29  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=3.2

Q ss_pred             CCcccccc
Q psy4830         244 CTSCHLTF  251 (292)
Q Consensus       244 C~~C~~~f  251 (292)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            44444333


No 84 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.48  E-value=0.35  Score=32.64  Aligned_cols=30  Identities=23%  Similarity=0.683  Sum_probs=19.0

Q ss_pred             ccccccccccCCchHHHHHHhhhcCCCCccccccccccccc
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVK  226 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~  226 (292)
                      ..|+.||++|...           +..|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            4677777777542           23566677777777655


No 85 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=87.41  E-value=0.31  Score=36.34  Aligned_cols=17  Identities=24%  Similarity=0.575  Sum_probs=9.1

Q ss_pred             Cccccccccccccchhh
Q psy4830         213 PYACDICDKRFAVKSYV  229 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L  229 (292)
                      -|.|+.|+.+|+...++
T Consensus       117 ~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             EEECCCCCcEEeHHHHh
Confidence            45555555555555444


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=86.80  E-value=0.6  Score=34.10  Aligned_cols=17  Identities=18%  Similarity=0.305  Sum_probs=8.5

Q ss_pred             Cccccccccccccchhh
Q psy4830         213 PYACDICDKRFAVKSYV  229 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L  229 (292)
                      -|.|+.|+.+|+...++
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            34555555555544444


No 87 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.54  E-value=0.55  Score=32.28  Aligned_cols=30  Identities=13%  Similarity=0.165  Sum_probs=16.0

Q ss_pred             ccccccccccccchhhhhhhccccCCcceeCCccccccCCh
Q psy4830         214 YACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSK  254 (292)
Q Consensus       214 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~  254 (292)
                      ..|+.||++|...           +..|-.|+.||..|...
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            3566666666432           22455666666665444


No 88 
>KOG2186|consensus
Probab=86.38  E-value=0.4  Score=37.10  Aligned_cols=45  Identities=22%  Similarity=0.517  Sum_probs=21.9

Q ss_pred             ccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhh
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHR  233 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~  233 (292)
                      |.|.+||....- ..|.+|+..-++ .-|.|-.|++.|.. .....|.
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            455555555432 344445544444 34555555555555 3334443


No 89 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=86.22  E-value=0.31  Score=35.27  Aligned_cols=12  Identities=33%  Similarity=0.725  Sum_probs=5.9

Q ss_pred             eeCCccccccCC
Q psy4830         242 FGCTSCHLTFTS  253 (292)
Q Consensus       242 ~~C~~C~~~f~~  253 (292)
                      ++|+.||++|.+
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            445555555544


No 90 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=86.13  E-value=0.34  Score=33.50  Aligned_cols=13  Identities=54%  Similarity=0.963  Sum_probs=7.4

Q ss_pred             ccCCCCCCccChH
Q psy4830         272 VCNVCGRSFVRDS  284 (292)
Q Consensus       272 ~C~~C~~~f~~~~  284 (292)
                      +||+|.-+|++.+
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            3666666665543


No 91 
>KOG2482|consensus
Probab=85.97  E-value=0.91  Score=36.85  Aligned_cols=139  Identities=19%  Similarity=0.362  Sum_probs=80.5

Q ss_pred             CccCCcchhhcC-ChhHHHHHHhhhcC----------------------CCCcccccchhhcCChhHHHHHHhhc--CCC
Q psy4830           9 PYHCTACDASFC-RKPYLEIHMRTHTG----------------------ERPFQCVVCLKRFSQKSALNTHKRMH--IPY   63 (292)
Q Consensus         9 ~~~C~~C~~~f~-~~~~l~~H~~~h~~----------------------~~~~~C~~C~~~f~~~~~l~~H~~~h--~~~   63 (292)
                      ...|-.|...+. +++....|+-.-++                      -..+.|-.|.+.|+++..|+.||+..  ...
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrri  223 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRI  223 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCccc
Confidence            346888877654 45566666643221                      02378999999999999999999753  211


Q ss_pred             cc--------eecc--cccccCCCh-hHHHHHHHhc--C-------------CCCc--eecCccccccCChHHHHHHHHH
Q psy4830          64 IQ--------YYCD--ACDATFTTK-QNLEVHMRTH--T-------------GERP--YQCEVCNKRFSQKSSLNTHKRI  115 (292)
Q Consensus        64 ~~--------~~C~--~C~~~f~~~-~~l~~H~~~h--~-------------~~~~--~~C~~C~~~f~~~~~l~~H~~~  115 (292)
                      .|        |.-.  .=|++.... ..+.  +.+-  .             +..+  ..|-.|.....+...|..||++
T Consensus       224 nPknreYDkfyiINY~ev~ks~t~~~~e~d--ret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~  301 (423)
T KOG2482|consen  224 NPKNREYDKFYIINYLEVGKSWTIVHSEDD--RETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKI  301 (423)
T ss_pred             CCCccccceEEEEeHhhcCCccchhhhhhh--hhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHH
Confidence            11        1100  111211111 1110  1110  0             1122  5899999888888899999876


Q ss_pred             hhcc----------------------cCCCCCCccCCCchhhhchhHHHhhhhhhh
Q psy4830         116 HINY----------------------LHTEDKPYHCTGCDAAFSRKQYLEVNHTTV  149 (292)
Q Consensus       116 h~~~----------------------~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~  149 (292)
                      -+..                      .........|-.|+-.|..+..|..|+...
T Consensus       302 vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  302 VHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             HHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhcccc
Confidence            4321                      111122346889999999999888877543


No 92 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=85.85  E-value=0.62  Score=25.67  Aligned_cols=11  Identities=27%  Similarity=0.833  Sum_probs=5.4

Q ss_pred             ccccccccccc
Q psy4830         214 YACDICDKRFA  224 (292)
Q Consensus       214 ~~C~~C~k~f~  224 (292)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            44555555443


No 93 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=85.41  E-value=0.75  Score=22.05  Aligned_cols=19  Identities=21%  Similarity=0.511  Sum_probs=11.7

Q ss_pred             eCCccccccCChhHHHHHhh
Q psy4830         243 GCTSCHLTFTSKSQFAVHLR  262 (292)
Q Consensus       243 ~C~~C~~~f~~~~~L~~H~~  262 (292)
                      .||+|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466676666 4456666654


No 94 
>PHA00626 hypothetical protein
Probab=85.15  E-value=0.44  Score=27.30  Aligned_cols=14  Identities=14%  Similarity=0.496  Sum_probs=8.7

Q ss_pred             cceeCCccccccCC
Q psy4830         240 KPFGCTSCHLTFTS  253 (292)
Q Consensus       240 ~~~~C~~C~~~f~~  253 (292)
                      ..|+|+.||..|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            45666666666654


No 95 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=85.11  E-value=0.46  Score=34.69  Aligned_cols=11  Identities=36%  Similarity=0.884  Sum_probs=6.0

Q ss_pred             CCcceeCCccc
Q psy4830         238 GDKPFGCTSCH  248 (292)
Q Consensus       238 ~~~~~~C~~C~  248 (292)
                      |+.|-+||+||
T Consensus       146 ge~P~~CPiCg  156 (166)
T COG1592         146 GEAPEVCPICG  156 (166)
T ss_pred             CCCCCcCCCCC
Confidence            44555555555


No 96 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.05  E-value=0.78  Score=26.82  Aligned_cols=10  Identities=30%  Similarity=0.680  Sum_probs=6.2

Q ss_pred             CCcccCCCCC
Q psy4830         269 ANHVCNVCGR  278 (292)
Q Consensus       269 ~~~~C~~C~~  278 (292)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4566666664


No 97 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=85.00  E-value=0.79  Score=24.14  Aligned_cols=10  Identities=30%  Similarity=0.906  Sum_probs=4.1

Q ss_pred             eecCcccccc
Q psy4830          94 YQCEVCNKRF  103 (292)
Q Consensus        94 ~~C~~C~~~f  103 (292)
                      .+|+.|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            3444444333


No 98 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.80  E-value=0.93  Score=32.70  Aligned_cols=15  Identities=20%  Similarity=0.698  Sum_probs=7.6

Q ss_pred             Cccccccccccccch
Q psy4830         213 PYACDICDKRFAVKS  227 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~  227 (292)
                      -|.|+.|+..|....
T Consensus        99 ~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       99 YYKCPNCQSKYTFLE  113 (147)
T ss_pred             EEECcCCCCEeeHHH
Confidence            455555555555433


No 99 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.59  E-value=0.92  Score=32.72  Aligned_cols=14  Identities=21%  Similarity=0.762  Sum_probs=7.5

Q ss_pred             CCccccccccccCC
Q psy4830         184 RPFQCAVCSKRFTQ  197 (292)
Q Consensus       184 ~~~~C~~C~k~f~~  197 (292)
                      ..|.|+.|+..|..
T Consensus        98 ~~Y~Cp~C~~~y~~  111 (147)
T smart00531       98 AYYKCPNCQSKYTF  111 (147)
T ss_pred             cEEECcCCCCEeeH
Confidence            34555555555554


No 100
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=84.40  E-value=1.1  Score=30.40  Aligned_cols=25  Identities=28%  Similarity=0.571  Sum_probs=23.2

Q ss_pred             eeC----CccccccCChhHHHHHhhhhcC
Q psy4830         242 FGC----TSCHLTFTSKSQFAVHLRTHHT  266 (292)
Q Consensus       242 ~~C----~~C~~~f~~~~~L~~H~~~hh~  266 (292)
                      |.|    +.|+..+.+...+..|++.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998874


No 101
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.11  E-value=0.36  Score=26.00  Aligned_cols=10  Identities=40%  Similarity=1.122  Sum_probs=4.1

Q ss_pred             eeCCcccccc
Q psy4830         242 FGCTSCHLTF  251 (292)
Q Consensus       242 ~~C~~C~~~f  251 (292)
                      |.|+.||..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            3444444433


No 102
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=83.95  E-value=0.36  Score=27.67  Aligned_cols=9  Identities=44%  Similarity=1.401  Sum_probs=3.4

Q ss_pred             ccccccccc
Q psy4830         187 QCAVCSKRF  195 (292)
Q Consensus       187 ~C~~C~k~f  195 (292)
                      .|..||..|
T Consensus         7 ~C~~Cg~~f   15 (52)
T TIGR02605         7 RCTACGHRF   15 (52)
T ss_pred             EeCCCCCEe
Confidence            333333333


No 103
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.70  E-value=0.76  Score=34.32  Aligned_cols=36  Identities=22%  Similarity=0.530  Sum_probs=28.3

Q ss_pred             CCCCCccccccccccCCchHHHHHHhhhcCCCCcccccccccccc
Q psy4830         181 TGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAV  225 (292)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~  225 (292)
                      ....-|.|+.|+..|+....+.         .-|.|+.||.....
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            3446799999999999887763         36999999986543


No 104
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=82.57  E-value=1  Score=32.86  Aligned_cols=30  Identities=20%  Similarity=0.526  Sum_probs=15.3

Q ss_pred             cceecccccccCCChhHHHHHHHhcCCCCceecCccccc
Q psy4830          64 IQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKR  102 (292)
Q Consensus        64 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  102 (292)
                      .-|.|+.|+..|+....+.         ..|.|+.||..
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            3455555555555554443         13556666554


No 105
>KOG2186|consensus
Probab=80.57  E-value=1.5  Score=34.08  Aligned_cols=45  Identities=24%  Similarity=0.616  Sum_probs=20.3

Q ss_pred             eecccccccCCChhHHHHHHHhcCCCCceecCccccccCChHHHHHHH
Q psy4830          66 YYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHK  113 (292)
Q Consensus        66 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  113 (292)
                      |.|..||..... ..+.+|+..-.+ ..|.|-.|++.|.. .++..|.
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            445555544332 233445544444 33555555555544 3344443


No 106
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=80.42  E-value=1.5  Score=24.88  Aligned_cols=23  Identities=26%  Similarity=0.489  Sum_probs=16.0

Q ss_pred             ceeCCccccccCCh-----hHHHHHhhh
Q psy4830         241 PFGCTSCHLTFTSK-----SQFAVHLRT  263 (292)
Q Consensus       241 ~~~C~~C~~~f~~~-----~~L~~H~~~  263 (292)
                      .-.|..|++.++..     ++|.+|++.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            35677777777654     578888773


No 107
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=79.93  E-value=0.69  Score=28.55  Aligned_cols=14  Identities=29%  Similarity=0.747  Sum_probs=6.3

Q ss_pred             cceeCC--ccccccCC
Q psy4830         240 KPFGCT--SCHLTFTS  253 (292)
Q Consensus       240 ~~~~C~--~C~~~f~~  253 (292)
                      .-+.|.  .||.+|..
T Consensus        26 ~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         26 RYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeecCCCCCCCEEEE
Confidence            334444  44444443


No 108
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=79.82  E-value=1.6  Score=22.11  Aligned_cols=11  Identities=18%  Similarity=0.606  Sum_probs=4.9

Q ss_pred             eeCCccccccC
Q psy4830         242 FGCTSCHLTFT  252 (292)
Q Consensus       242 ~~C~~C~~~f~  252 (292)
                      |.|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            34555554443


No 109
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=79.69  E-value=1.5  Score=30.22  Aligned_cols=35  Identities=14%  Similarity=0.279  Sum_probs=26.8

Q ss_pred             CccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhh
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVT  230 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~  230 (292)
                      ...|+.||++|...           +..|..|+.||..|.....++
T Consensus         9 Kr~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300         9 KRICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             cccCCCcCcccccc-----------CCCCccCCCcCCccCcchhhc
Confidence            35799999999753           346899999999987664443


No 110
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=79.67  E-value=0.89  Score=24.74  Aligned_cols=12  Identities=33%  Similarity=1.013  Sum_probs=9.8

Q ss_pred             CccCCCchhhhc
Q psy4830         126 PYHCTGCDAAFS  137 (292)
Q Consensus       126 ~~~C~~C~~~f~  137 (292)
                      .|.|..||..|.
T Consensus         5 ey~C~~Cg~~fe   16 (42)
T PF09723_consen    5 EYRCEECGHEFE   16 (42)
T ss_pred             EEEeCCCCCEEE
Confidence            378999998885


No 111
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=79.34  E-value=0.99  Score=25.39  Aligned_cols=10  Identities=30%  Similarity=1.119  Sum_probs=3.8

Q ss_pred             cccccccccc
Q psy4830         186 FQCAVCSKRF  195 (292)
Q Consensus       186 ~~C~~C~k~f  195 (292)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            3333333333


No 112
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=77.90  E-value=1.4  Score=30.94  Aligned_cols=24  Identities=38%  Similarity=0.677  Sum_probs=15.2

Q ss_pred             cceeCCccccccCChhHHHHHhhhhcC
Q psy4830         240 KPFGCTSCHLTFTSKSQFAVHLRTHHT  266 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~~~L~~H~~~hh~  266 (292)
                      .-..|-+||+.|..   |++|++.||+
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-
T ss_pred             CeeEEccCCcccch---HHHHHHHccC
Confidence            34689999998866   5899999865


No 113
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=77.68  E-value=0.6  Score=36.28  Aligned_cols=13  Identities=38%  Similarity=0.897  Sum_probs=7.8

Q ss_pred             cCCCCcccccchh
Q psy4830          33 TGERPFQCVVCLK   45 (292)
Q Consensus        33 ~~~~~~~C~~C~~   45 (292)
                      +|.+.|+|.+|..
T Consensus       138 hGGrif~CsfC~~  150 (314)
T PF06524_consen  138 HGGRIFKCSFCDN  150 (314)
T ss_pred             CCCeEEEeecCCC
Confidence            3556666666654


No 114
>KOG2807|consensus
Probab=76.69  E-value=3.9  Score=33.15  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=9.6

Q ss_pred             ceecccccccCCChhHHH
Q psy4830          65 QYYCDACDATFTTKQNLE   82 (292)
Q Consensus        65 ~~~C~~C~~~f~~~~~l~   82 (292)
                      |-.|++|+-+......|.
T Consensus       290 P~eCpiC~ltLVss~hLA  307 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLA  307 (378)
T ss_pred             CccCCccceeEecchHHH
Confidence            445666655555554444


No 115
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=76.11  E-value=1.1  Score=22.32  Aligned_cols=9  Identities=44%  Similarity=0.936  Sum_probs=4.5

Q ss_pred             CCcccCCCC
Q psy4830         269 ANHVCNVCG  277 (292)
Q Consensus       269 ~~~~C~~C~  277 (292)
                      ..|.|+.|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            345555554


No 116
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=76.08  E-value=1.6  Score=27.82  Aligned_cols=32  Identities=16%  Similarity=0.512  Sum_probs=18.3

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccccccCC
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS  253 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~  253 (292)
                      .+|.|+.|++.        .+.++  +..-+.|..||..|.-
T Consensus        34 ~~~~Cp~C~~~--------~VkR~--a~GIW~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRI--ATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCc--------ceeee--ccCeEEcCCCCCeecc
Confidence            35777777764        12222  2335677777777753


No 117
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=76.00  E-value=2.7  Score=38.76  Aligned_cols=13  Identities=23%  Similarity=0.560  Sum_probs=8.0

Q ss_pred             CCCCcccCCCCCC
Q psy4830         267 VGANHVCNVCGRS  279 (292)
Q Consensus       267 ~~~~~~C~~C~~~  279 (292)
                      ...|..|+.||-.
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            3456677777654


No 118
>PRK04023 DNA polymerase II large subunit; Validated
Probab=75.42  E-value=3.4  Score=39.08  Aligned_cols=50  Identities=22%  Similarity=0.596  Sum_probs=32.3

Q ss_pred             CCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhh
Q psy4830         184 RPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       184 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      ....|+.||...                -.+.|+.||..               .+..+.|+.|+..             
T Consensus       625 g~RfCpsCG~~t----------------~~frCP~CG~~---------------Te~i~fCP~CG~~-------------  660 (1121)
T PRK04023        625 GRRKCPSCGKET----------------FYRRCPFCGTH---------------TEPVYRCPRCGIE-------------  660 (1121)
T ss_pred             cCccCCCCCCcC----------------CcccCCCCCCC---------------CCcceeCccccCc-------------
Confidence            346789998863                23678888865               2445778888421             


Q ss_pred             hcCCCCCcccCCCCCCcc
Q psy4830         264 HHTVGANHVCNVCGRSFV  281 (292)
Q Consensus       264 hh~~~~~~~C~~C~~~f~  281 (292)
                          ..++.|+.||..-.
T Consensus       661 ----~~~y~CPKCG~El~  674 (1121)
T PRK04023        661 ----VEEDECEKCGREPT  674 (1121)
T ss_pred             ----CCCCcCCCCCCCCC
Confidence                23466888886543


No 119
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=74.94  E-value=2.4  Score=33.14  Aligned_cols=25  Identities=24%  Similarity=0.619  Sum_probs=12.5

Q ss_pred             cceeCCccccccCChhHHHHHhhhh
Q psy4830         240 KPFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      ++++||.||.....-.+|..-.|+|
T Consensus       208 k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  208 KPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCcccccccceeeeecc
Confidence            4555555555555555554444443


No 120
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=74.67  E-value=2.5  Score=28.66  Aligned_cols=26  Identities=23%  Similarity=0.364  Sum_probs=23.3

Q ss_pred             Cccc----cccccccccchhhhhhhccccC
Q psy4830         213 PYAC----DICDKRFAVKSYVTSHRWSHVG  238 (292)
Q Consensus       213 ~~~C----~~C~k~f~~~~~L~~H~~~h~~  238 (292)
                      -|.|    +.|+..+.+...+..|.+.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999987764


No 121
>KOG2071|consensus
Probab=74.00  E-value=2.9  Score=36.91  Aligned_cols=28  Identities=32%  Similarity=0.691  Sum_probs=22.5

Q ss_pred             CCceecCccccccCChHHHHHHHHHhhc
Q psy4830          91 ERPYQCEVCNKRFSQKSSLNTHKRIHIN  118 (292)
Q Consensus        91 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~  118 (292)
                      ..+..|..||..|........||.+|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            4567899999999988888888877753


No 122
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=73.81  E-value=2.9  Score=24.61  Aligned_cols=21  Identities=24%  Similarity=0.619  Sum_probs=9.7

Q ss_pred             hhHHHHHHHhcCCCCceecCc
Q psy4830          78 KQNLEVHMRTHTGERPYQCEV   98 (292)
Q Consensus        78 ~~~l~~H~~~h~~~~~~~C~~   98 (292)
                      +..|..|+...-..++..|+.
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHHccCCCCcEECCC
Confidence            334555555444444455555


No 123
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=73.71  E-value=3.3  Score=33.26  Aligned_cols=23  Identities=30%  Similarity=0.797  Sum_probs=11.7

Q ss_pred             ceecCccccccCChHHHHHHHHH
Q psy4830          93 PYQCEVCNKRFSQKSSLNTHKRI  115 (292)
Q Consensus        93 ~~~C~~C~~~f~~~~~l~~H~~~  115 (292)
                      .|.|+.|...|-.--..-.|...
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~L  410 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETL  410 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHH
Confidence            35555555555554444444443


No 124
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=73.49  E-value=1.7  Score=20.32  Aligned_cols=8  Identities=50%  Similarity=1.481  Sum_probs=4.9

Q ss_pred             ceeCCccc
Q psy4830         241 PFGCTSCH  248 (292)
Q Consensus       241 ~~~C~~C~  248 (292)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            46666665


No 125
>PF14353 CpXC:  CpXC protein
Probab=72.96  E-value=0.79  Score=32.18  Aligned_cols=19  Identities=21%  Similarity=0.677  Sum_probs=9.7

Q ss_pred             ccccccccccccchhhhhh
Q psy4830         214 YACDICDKRFAVKSYVTSH  232 (292)
Q Consensus       214 ~~C~~C~k~f~~~~~L~~H  232 (292)
                      |.|+.||..|.-...+.-|
T Consensus        39 ~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             EECCCCCCceecCCCEEEE
Confidence            4555555555544444443


No 126
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=72.08  E-value=2.6  Score=28.04  Aligned_cols=12  Identities=8%  Similarity=0.188  Sum_probs=6.4

Q ss_pred             cceeCCcccccc
Q psy4830         240 KPFGCTSCHLTF  251 (292)
Q Consensus       240 ~~~~C~~C~~~f  251 (292)
                      .|..|+.||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            345555555555


No 127
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=71.11  E-value=0.93  Score=29.61  Aligned_cols=11  Identities=55%  Similarity=1.074  Sum_probs=5.7

Q ss_pred             cccCCCCCCcc
Q psy4830         271 HVCNVCGRSFV  281 (292)
Q Consensus       271 ~~C~~C~~~f~  281 (292)
                      -.|.+||.+|.
T Consensus        47 ~~Cg~CGls~e   57 (104)
T COG4888          47 AVCGNCGLSFE   57 (104)
T ss_pred             EEcccCcceEE
Confidence            34555555553


No 128
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=70.72  E-value=6.1  Score=32.42  Aligned_cols=22  Identities=23%  Similarity=0.526  Sum_probs=16.4

Q ss_pred             ceecCccccccCChHHHHHHHH
Q psy4830          93 PYQCEVCNKRFSQKSSLNTHKR  114 (292)
Q Consensus        93 ~~~C~~C~~~f~~~~~l~~H~~  114 (292)
                      .+-|+.|++-|.....+..|+.
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHh
Confidence            3568888888887777777764


No 129
>PF12907 zf-met2:  Zinc-binding
Probab=69.82  E-value=2.8  Score=22.52  Aligned_cols=27  Identities=26%  Similarity=0.516  Sum_probs=15.6

Q ss_pred             eeCCccccccC---ChhHHHHHhhhhcCCC
Q psy4830         242 FGCTSCHLTFT---SKSQFAVHLRTHHTVG  268 (292)
Q Consensus       242 ~~C~~C~~~f~---~~~~L~~H~~~hh~~~  268 (292)
                      +.|.+|-.+|.   +...|..|....|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            45667764443   3455777766656543


No 130
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=68.76  E-value=2.4  Score=22.19  Aligned_cols=9  Identities=22%  Similarity=0.944  Sum_probs=4.6

Q ss_pred             ccccccccc
Q psy4830         187 QCAVCSKRF  195 (292)
Q Consensus       187 ~C~~C~k~f  195 (292)
                      .|+.||+.|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            355555554


No 131
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=67.16  E-value=6.1  Score=31.83  Aligned_cols=47  Identities=21%  Similarity=0.463  Sum_probs=24.9

Q ss_pred             ccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhh
Q psy4830         216 CDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       216 C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      |-.|.-.|+....-..-  .-+....|.|+.|...|-.--+.-.|...|
T Consensus       365 Cf~CQ~~fp~~~~~~~~--~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         365 CFVCQGPFPKPPVSPFD--ESTSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceeccCCCCCCCCCccc--ccccccceechhhhhhhhhhhHHHHHHHHh
Confidence            66666666543211100  011223577777777777777766665554


No 132
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=66.88  E-value=1.2  Score=27.54  Aligned_cols=14  Identities=14%  Similarity=0.470  Sum_probs=5.4

Q ss_pred             Cccccccccccccc
Q psy4830         213 PYACDICDKRFAVK  226 (292)
Q Consensus       213 ~~~C~~C~k~f~~~  226 (292)
                      ...|..|+..++..
T Consensus        41 ~v~Cg~C~~~~~~~   54 (71)
T PF05495_consen   41 RVICGKCRTEQPID   54 (71)
T ss_dssp             EEEETTT--EEES-
T ss_pred             CeECCCCCCccChh
Confidence            44455555544443


No 133
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=66.58  E-value=2.6  Score=24.41  Aligned_cols=10  Identities=20%  Similarity=0.823  Sum_probs=5.2

Q ss_pred             cccccccccc
Q psy4830         214 YACDICDKRF  223 (292)
Q Consensus       214 ~~C~~C~k~f  223 (292)
                      +.|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            3455555544


No 134
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=66.33  E-value=3.7  Score=28.61  Aligned_cols=12  Identities=33%  Similarity=0.927  Sum_probs=5.5

Q ss_pred             ccccccccccCC
Q psy4830         186 FQCAVCSKRFTQ  197 (292)
Q Consensus       186 ~~C~~C~k~f~~  197 (292)
                      ++|..||+.|..
T Consensus         2 H~Ct~Cg~~f~d   13 (131)
T PF09845_consen    2 HQCTKCGRVFED   13 (131)
T ss_pred             cccCcCCCCcCC
Confidence            344444444443


No 135
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=65.93  E-value=4  Score=22.19  Aligned_cols=20  Identities=30%  Similarity=0.687  Sum_probs=9.3

Q ss_pred             eeCCccccccCChhHHHHHh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHL  261 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~  261 (292)
                      |+|-.|+.+...++.|-.||
T Consensus        21 ykcfqcpftc~~kshl~nhm   40 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHM   40 (54)
T ss_pred             ceeecCCcccchHHHHHHHH
Confidence            44444444444444444443


No 136
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=65.88  E-value=9.5  Score=21.11  Aligned_cols=9  Identities=22%  Similarity=0.995  Sum_probs=4.0

Q ss_pred             cceeCCccc
Q psy4830         240 KPFGCTSCH  248 (292)
Q Consensus       240 ~~~~C~~C~  248 (292)
                      ..|.|..|+
T Consensus        36 ~~~~C~~C~   44 (46)
T PF12760_consen   36 GRYRCKACR   44 (46)
T ss_pred             CeEECCCCC
Confidence            344444443


No 137
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=64.83  E-value=4.5  Score=37.36  Aligned_cols=13  Identities=31%  Similarity=0.769  Sum_probs=8.1

Q ss_pred             CCCCccCCCchhh
Q psy4830         123 EDKPYHCTGCDAA  135 (292)
Q Consensus       123 ~~~~~~C~~C~~~  135 (292)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            4456667777654


No 138
>KOG4167|consensus
Probab=64.57  E-value=2.3  Score=38.41  Aligned_cols=24  Identities=29%  Similarity=0.647  Sum_probs=12.0

Q ss_pred             CccCCcchhhcCChhHHHHHHhhh
Q psy4830           9 PYHCTACDASFCRKPYLEIHMRTH   32 (292)
Q Consensus         9 ~~~C~~C~~~f~~~~~l~~H~~~h   32 (292)
                      .|.|.+|++.|....++..||++|
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHH
Confidence            344555555555545555555544


No 139
>KOG4167|consensus
Probab=63.57  E-value=1.7  Score=39.16  Aligned_cols=25  Identities=28%  Similarity=0.568  Sum_probs=23.4

Q ss_pred             ceeCCccccccCChhHHHHHhhhhc
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      -|.|..|+|.|....++..||++|-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            5999999999999999999999984


No 140
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=63.33  E-value=4.9  Score=23.19  Aligned_cols=9  Identities=33%  Similarity=0.910  Sum_probs=4.5

Q ss_pred             eCCcccccc
Q psy4830         243 GCTSCHLTF  251 (292)
Q Consensus       243 ~C~~C~~~f  251 (292)
                      .|+.||+.|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            455555554


No 141
>KOG4124|consensus
Probab=62.58  E-value=1.6  Score=35.58  Aligned_cols=19  Identities=21%  Similarity=0.408  Sum_probs=12.4

Q ss_pred             CCcccCCCCCCccChHHHH
Q psy4830         269 ANHVCNVCGRSFVRDSYLI  287 (292)
Q Consensus       269 ~~~~C~~C~~~f~~~~~l~  287 (292)
                      ++|.|++|.++++....|.
T Consensus       397 k~~r~~i~~~~~k~~~~l~  415 (442)
T KOG4124|consen  397 KPYRCEVCSKRYKNLNGLK  415 (442)
T ss_pred             CcccChhhhhhhccCCCCC
Confidence            5677777777766655544


No 142
>KOG2593|consensus
Probab=62.32  E-value=8.4  Score=32.76  Aligned_cols=36  Identities=19%  Similarity=0.534  Sum_probs=19.1

Q ss_pred             CCCcccccchhhcCChhHHHHHHhhcCCCcceecccccc
Q psy4830          35 ERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDA   73 (292)
Q Consensus        35 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   73 (292)
                      ...|.|+.|.+.|.....+..   +-.....|.|..|+-
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGG  161 (436)
T ss_pred             cccccCCccccchhhhHHHHh---hcccCceEEEecCCC
Confidence            345677777776665544432   122233566666654


No 143
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=61.34  E-value=6.5  Score=21.25  Aligned_cols=11  Identities=36%  Similarity=0.833  Sum_probs=5.3

Q ss_pred             CCccccccCCh
Q psy4830         244 CTSCHLTFTSK  254 (292)
Q Consensus       244 C~~C~~~f~~~  254 (292)
                      |++||+.|+-+
T Consensus        11 C~~C~rpf~WR   21 (42)
T PF10013_consen   11 CPVCGRPFTWR   21 (42)
T ss_pred             CcccCCcchHH
Confidence            44555544443


No 144
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=61.02  E-value=3.9  Score=22.28  Aligned_cols=9  Identities=44%  Similarity=0.918  Sum_probs=3.8

Q ss_pred             cccCCCCCC
Q psy4830         271 HVCNVCGRS  279 (292)
Q Consensus       271 ~~C~~C~~~  279 (292)
                      +.|+.||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            445555443


No 145
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=60.91  E-value=5.7  Score=25.53  Aligned_cols=27  Identities=33%  Similarity=0.728  Sum_probs=17.9

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccc
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCH  248 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~  248 (292)
                      +|-.|..||..|....          -.+|-.|+.|.
T Consensus        57 ~Pa~CkkCGfef~~~~----------ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDDK----------IKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCccccccc----------cCCcccCCcch
Confidence            4677888888887521          13466788874


No 146
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=60.28  E-value=5.7  Score=24.21  Aligned_cols=10  Identities=40%  Similarity=1.361  Sum_probs=3.5

Q ss_pred             cccccccccC
Q psy4830         187 QCAVCSKRFT  196 (292)
Q Consensus       187 ~C~~C~k~f~  196 (292)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            4666666663


No 147
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=59.41  E-value=8.7  Score=19.80  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=3.9

Q ss_pred             eCCccccccCC
Q psy4830         243 GCTSCHLTFTS  253 (292)
Q Consensus       243 ~C~~C~~~f~~  253 (292)
                      .|..|++.|..
T Consensus         5 ~C~eC~~~f~d   15 (34)
T PF01286_consen    5 KCDECGKPFMD   15 (34)
T ss_dssp             E-TTT--EES-
T ss_pred             hHhHhCCHHHH
Confidence            45555555554


No 148
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=58.95  E-value=7.2  Score=30.05  Aligned_cols=28  Identities=21%  Similarity=0.571  Sum_probs=15.4

Q ss_pred             CCccccccccccccchhhhhhhccccCC
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGD  239 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~  239 (292)
                      ..|.|++|+|.|.-..-..+|+...+.+
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            3466666666666666666666655554


No 149
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=58.51  E-value=2.9  Score=20.43  Aligned_cols=17  Identities=41%  Similarity=0.831  Sum_probs=7.7

Q ss_pred             cccccccccCCchHHHHH
Q psy4830         187 QCAVCSKRFTQKSSLNTH  204 (292)
Q Consensus       187 ~C~~C~k~f~~~~~L~~H  204 (292)
                      .|-.|++.| .....+.|
T Consensus         2 sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    2 SCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EETTTTEEE-EGGGTTT-
T ss_pred             eeecCCCCc-CcCCcCCC
Confidence            455555555 33344444


No 150
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=57.98  E-value=5.2  Score=21.48  Aligned_cols=10  Identities=30%  Similarity=0.916  Sum_probs=5.0

Q ss_pred             eeCCcccccc
Q psy4830         242 FGCTSCHLTF  251 (292)
Q Consensus       242 ~~C~~C~~~f  251 (292)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5555555443


No 151
>PRK04023 DNA polymerase II large subunit; Validated
Probab=57.30  E-value=8.6  Score=36.58  Aligned_cols=14  Identities=29%  Similarity=0.828  Sum_probs=8.4

Q ss_pred             cceeCCccccccCC
Q psy4830         240 KPFGCTSCHLTFTS  253 (292)
Q Consensus       240 ~~~~C~~C~~~f~~  253 (292)
                      +.|.|..||..|.+
T Consensus      1036 Q~fRC~kC~~kYRR 1049 (1121)
T PRK04023       1036 QEFRCTKCGAKYRR 1049 (1121)
T ss_pred             cceeecccCccccc
Confidence            34666666666644


No 152
>KOG2593|consensus
Probab=57.07  E-value=12  Score=31.80  Aligned_cols=38  Identities=21%  Similarity=0.571  Sum_probs=22.7

Q ss_pred             CCcceecccccccCCChhHHHHHHHhcCCCCceecCccccc
Q psy4830          62 PYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKR  102 (292)
Q Consensus        62 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  102 (292)
                      ....|.|+.|.+.|.....++   ..-.....|.|..|+-.
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccCCccccchhhhHHHH---hhcccCceEEEecCCCc
Confidence            344577888887777655543   22233345777777643


No 153
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=56.75  E-value=2.9  Score=22.31  Aligned_cols=10  Identities=20%  Similarity=0.843  Sum_probs=5.8

Q ss_pred             eeCCcccccc
Q psy4830         242 FGCTSCHLTF  251 (292)
Q Consensus       242 ~~C~~C~~~f  251 (292)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5666666544


No 154
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=56.53  E-value=6.8  Score=27.29  Aligned_cols=22  Identities=27%  Similarity=0.338  Sum_probs=17.0

Q ss_pred             eeCCccccccCChhHHHHHhhhhcC
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHHT  266 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh~  266 (292)
                      ..|-.+|+.|.   +|++|+.+|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            57888888884   48888888764


No 155
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=55.49  E-value=14  Score=36.26  Aligned_cols=54  Identities=17%  Similarity=0.497  Sum_probs=33.0

Q ss_pred             CccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhh
Q psy4830         185 PFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      .+.|+.||..-.                ...|+.||...               +.+|.|+.||.......         
T Consensus       667 ~rkCPkCG~~t~----------------~~fCP~CGs~t---------------e~vy~CPsCGaev~~de---------  706 (1337)
T PRK14714        667 RRRCPSCGTETY----------------ENRCPDCGTHT---------------EPVYVCPDCGAEVPPDE---------  706 (1337)
T ss_pred             EEECCCCCCccc----------------cccCcccCCcC---------------CCceeCccCCCccCCCc---------
Confidence            378999987321                12688888653               23578888887644311         


Q ss_pred             cCCCCCcccCCCCCCcc
Q psy4830         265 HTVGANHVCNVCGRSFV  281 (292)
Q Consensus       265 h~~~~~~~C~~C~~~f~  281 (292)
                       + . ...|+.|+....
T Consensus       707 -s-~-a~~CP~CGtplv  720 (1337)
T PRK14714        707 -S-G-RVECPRCDVELT  720 (1337)
T ss_pred             -c-c-cccCCCCCCccc
Confidence             1 1 346888885443


No 156
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=54.92  E-value=6.6  Score=22.42  Aligned_cols=19  Identities=32%  Similarity=0.756  Sum_probs=5.3

Q ss_pred             ccccccccccccchhhhhh
Q psy4830         214 YACDICDKRFAVKSYVTSH  232 (292)
Q Consensus       214 ~~C~~C~k~f~~~~~L~~H  232 (292)
                      |+|+.|...|=..-.+-.|
T Consensus        22 y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             E--TTTT--B-HHHHHTTT
T ss_pred             EECCCCCCccccCcChhhh
Confidence            3333333333333333333


No 157
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=54.88  E-value=11  Score=21.82  Aligned_cols=14  Identities=21%  Similarity=0.634  Sum_probs=8.4

Q ss_pred             CcceeCCccccccC
Q psy4830         239 DKPFGCTSCHLTFT  252 (292)
Q Consensus       239 ~~~~~C~~C~~~f~  252 (292)
                      .-.|.|+.||-.+.
T Consensus        12 ~v~~~Cp~cGipth   25 (55)
T PF13824_consen   12 HVNFECPDCGIPTH   25 (55)
T ss_pred             ccCCcCCCCCCcCc
Confidence            34567777775544


No 158
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=54.77  E-value=10  Score=20.35  Aligned_cols=19  Identities=16%  Similarity=0.270  Sum_probs=10.6

Q ss_pred             cceeCCccccccCChhHHH
Q psy4830         240 KPFGCTSCHLTFTSKSQFA  258 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~~~L~  258 (292)
                      ..+.|+.|+-.+.....|.
T Consensus        18 ~id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEEECCCCCeEEccHHHHH
Confidence            3455666665555555544


No 159
>KOG2636|consensus
Probab=54.72  E-value=8  Score=32.94  Aligned_cols=26  Identities=23%  Similarity=0.508  Sum_probs=21.0

Q ss_pred             cCCCCCcccCCCC-CCccChHHHHhhh
Q psy4830         265 HTVGANHVCNVCG-RSFVRDSYLIRHQ  290 (292)
Q Consensus       265 h~~~~~~~C~~C~-~~f~~~~~l~~H~  290 (292)
                      |+.+..|.|.||| +++.-+..+.+|-
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHh
Confidence            4677889999998 8888888888774


No 160
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=54.36  E-value=5  Score=25.98  Aligned_cols=32  Identities=22%  Similarity=0.531  Sum_probs=19.4

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccccccCC
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS  253 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~  253 (292)
                      ..|.|+.||+.-...          .+...+.|..|++.|+-
T Consensus        35 a~y~CpfCgk~~vkR----------~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHAVKR----------QAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCceee----------eeeEEEEcCCCCCEEeC
Confidence            467888887532111          12346788888887754


No 161
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=54.35  E-value=18  Score=26.16  Aligned_cols=41  Identities=27%  Similarity=0.446  Sum_probs=17.4

Q ss_pred             CCcceeCCccccccC------ChhHHHHHhhhh-cC----------CCCCcccCCCCC
Q psy4830         238 GDKPFGCTSCHLTFT------SKSQFAVHLRTH-HT----------VGANHVCNVCGR  278 (292)
Q Consensus       238 ~~~~~~C~~C~~~f~------~~~~L~~H~~~h-h~----------~~~~~~C~~C~~  278 (292)
                      ..-..+|..|++.|-      +.+.+..|+..- |.          ++...+|-.||-
T Consensus        11 p~~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen   11 PSCVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             CCCEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             cccEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            344456777776663      345556664322 21          234577888875


No 162
>KOG2807|consensus
Probab=53.99  E-value=25  Score=28.81  Aligned_cols=24  Identities=25%  Similarity=0.562  Sum_probs=15.1

Q ss_pred             ceeCCccccccCChhHHHHHhhhh
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      .|.|+.|...|-.--+.-.|-..|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            466777776676666666665443


No 163
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=53.38  E-value=8  Score=21.99  Aligned_cols=8  Identities=25%  Similarity=0.928  Sum_probs=3.6

Q ss_pred             cccccccc
Q psy4830         214 YACDICDK  221 (292)
Q Consensus       214 ~~C~~C~k  221 (292)
                      +.|..||.
T Consensus        38 ~~C~~Cgy   45 (50)
T PRK00432         38 WHCGKCGY   45 (50)
T ss_pred             EECCCcCC
Confidence            44444443


No 164
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=51.76  E-value=4.9  Score=26.04  Aligned_cols=32  Identities=22%  Similarity=0.595  Sum_probs=19.4

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccccccCC
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS  253 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~  253 (292)
                      ..|.|+.|++.-..          -.+...+.|..|++.|+-
T Consensus        34 a~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        34 AKYVCPFCGKKTVK----------RGSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             cCccCCCCCCCceE----------EEeeEEEEcCCCCCEEeC
Confidence            46788888753211          112345788888887754


No 165
>KOG4124|consensus
Probab=51.74  E-value=4.6  Score=33.06  Aligned_cols=23  Identities=22%  Similarity=0.648  Sum_probs=14.9

Q ss_pred             CcceeCCccccccCChhHHHHHh
Q psy4830         239 DKPFGCTSCHLTFTSKSQFAVHL  261 (292)
Q Consensus       239 ~~~~~C~~C~~~f~~~~~L~~H~  261 (292)
                      .|+|.|++|.+++.....|.-|.
T Consensus       396 nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCcccChhhhhhhccCCCCCcee
Confidence            46677777777776666555553


No 166
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=51.58  E-value=18  Score=28.25  Aligned_cols=16  Identities=25%  Similarity=0.688  Sum_probs=12.1

Q ss_pred             CCccccccccccCCch
Q psy4830         184 RPFQCAVCSKRFTQKS  199 (292)
Q Consensus       184 ~~~~C~~C~k~f~~~~  199 (292)
                      ..|.|+.|+..|....
T Consensus       154 aef~C~~C~h~F~G~~  169 (278)
T PF15135_consen  154 AEFHCPKCRHNFRGFA  169 (278)
T ss_pred             eeeecccccccchhhh
Confidence            3588999998887643


No 167
>KOG3408|consensus
Probab=51.38  E-value=9.9  Score=26.00  Aligned_cols=24  Identities=25%  Similarity=0.564  Sum_probs=18.3

Q ss_pred             cceeCCccccccCChhHHHHHhhh
Q psy4830         240 KPFGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      ..|.|-.|.+-|.+...|..|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            357788888888888888888765


No 168
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=51.38  E-value=9.8  Score=22.01  Aligned_cols=9  Identities=56%  Similarity=1.154  Sum_probs=4.8

Q ss_pred             ccccccccC
Q psy4830         188 CAVCSKRFT  196 (292)
Q Consensus       188 C~~C~k~f~  196 (292)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            555555554


No 169
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=50.98  E-value=3  Score=27.00  Aligned_cols=32  Identities=22%  Similarity=0.547  Sum_probs=18.6

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccccccCC
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS  253 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~  253 (292)
                      ..|.|+.||+.-..        +.-  .-.+.|..|++.|+-
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a--~GIW~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVA--TGIWKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEE--TTEEEETTTTEEEE-
T ss_pred             CCCcCCCCCCceeE--------Eee--eEEeecCCCCCEEeC
Confidence            46788888875321        112  234788888887753


No 170
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.21  E-value=8.5  Score=20.51  Aligned_cols=14  Identities=29%  Similarity=0.698  Sum_probs=11.9

Q ss_pred             ceeCCccccccCCh
Q psy4830         241 PFGCTSCHLTFTSK  254 (292)
Q Consensus       241 ~~~C~~C~~~f~~~  254 (292)
                      ||.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78999999999764


No 171
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=50.06  E-value=8.5  Score=26.41  Aligned_cols=13  Identities=15%  Similarity=0.575  Sum_probs=7.6

Q ss_pred             Ccccccccccccc
Q psy4830         213 PYACDICDKRFAV  225 (292)
Q Consensus       213 ~~~C~~C~k~f~~  225 (292)
                      ...|..||..|..
T Consensus        70 ~~~C~~Cg~~~~~   82 (115)
T TIGR00100        70 ECECEDCSEEVSP   82 (115)
T ss_pred             EEEcccCCCEEec
Confidence            3556666665554


No 172
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=49.70  E-value=10  Score=20.26  Aligned_cols=10  Identities=30%  Similarity=0.727  Sum_probs=4.2

Q ss_pred             CcceeCCccc
Q psy4830         239 DKPFGCTSCH  248 (292)
Q Consensus       239 ~~~~~C~~C~  248 (292)
                      .+.+.|++|+
T Consensus        22 ~~~w~C~~C~   31 (40)
T PF04810_consen   22 GKTWICNFCG   31 (40)
T ss_dssp             TTEEEETTT-
T ss_pred             CCEEECcCCC
Confidence            3444455444


No 173
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=49.33  E-value=8.7  Score=27.54  Aligned_cols=7  Identities=29%  Similarity=1.156  Sum_probs=2.8

Q ss_pred             ceeCCcc
Q psy4830         241 PFGCTSC  247 (292)
Q Consensus       241 ~~~C~~C  247 (292)
                      .|.|..|
T Consensus       140 ~YrC~~C  146 (156)
T COG3091         140 VYRCGKC  146 (156)
T ss_pred             eEEeccC
Confidence            3444444


No 174
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=49.09  E-value=9.8  Score=26.03  Aligned_cols=12  Identities=17%  Similarity=0.227  Sum_probs=6.9

Q ss_pred             Cccccccccccc
Q psy4830         213 PYACDICDKRFA  224 (292)
Q Consensus       213 ~~~C~~C~k~f~  224 (292)
                      ...|..||..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (113)
T PRK12380         70 QAWCWDCSQVVE   81 (113)
T ss_pred             EEEcccCCCEEe
Confidence            355666665554


No 175
>KOG3408|consensus
Probab=48.57  E-value=9.1  Score=26.16  Aligned_cols=26  Identities=27%  Similarity=0.492  Sum_probs=22.6

Q ss_pred             CCCCCcccCCCCCCccChHHHHhhhc
Q psy4830         266 TVGANHVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       266 ~~~~~~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      .+...|.|-.|.+-|.+...|..|.|
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHh
Confidence            34567999999999999999999975


No 176
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=48.48  E-value=7.9  Score=27.45  Aligned_cols=15  Identities=20%  Similarity=0.658  Sum_probs=10.3

Q ss_pred             CCccccccccccCCc
Q psy4830         184 RPFQCAVCSKRFTQK  198 (292)
Q Consensus       184 ~~~~C~~C~k~f~~~  198 (292)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            457788888777653


No 177
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.74  E-value=7.8  Score=29.85  Aligned_cols=14  Identities=29%  Similarity=1.023  Sum_probs=7.4

Q ss_pred             CccccccccccCCc
Q psy4830         185 PFQCAVCSKRFTQK  198 (292)
Q Consensus       185 ~~~C~~C~k~f~~~  198 (292)
                      .+.||+|+-.|...
T Consensus        19 ~ieCPvC~tkFkke   32 (267)
T COG1655          19 TIECPVCNTKFKKE   32 (267)
T ss_pred             eeccCcccchhhhh
Confidence            35555555555543


No 178
>KOG0717|consensus
Probab=46.64  E-value=11  Score=32.42  Aligned_cols=22  Identities=27%  Similarity=0.581  Sum_probs=18.3

Q ss_pred             eeCCccccccCChhHHHHHhhh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      +.|.+|+|+|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7788999999988888888654


No 179
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=46.52  E-value=15  Score=22.27  Aligned_cols=12  Identities=25%  Similarity=0.913  Sum_probs=6.1

Q ss_pred             cceeCCcccccc
Q psy4830         240 KPFGCTSCHLTF  251 (292)
Q Consensus       240 ~~~~C~~C~~~f  251 (292)
                      +.|.|+.||..+
T Consensus        45 r~~~C~~Cg~~~   56 (69)
T PF07282_consen   45 RVFTCPNCGFEM   56 (69)
T ss_pred             ceEEcCCCCCEE
Confidence            345555555443


No 180
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=46.19  E-value=28  Score=18.76  Aligned_cols=10  Identities=20%  Similarity=0.863  Sum_probs=5.3

Q ss_pred             cCCcchhhcC
Q psy4830          11 HCTACDASFC   20 (292)
Q Consensus        11 ~C~~C~~~f~   20 (292)
                      .|+.||..|.
T Consensus        15 ~C~~CgM~Y~   24 (41)
T PF13878_consen   15 TCPTCGMLYS   24 (41)
T ss_pred             CCCCCCCEEC
Confidence            4555555554


No 181
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.78  E-value=13  Score=23.03  Aligned_cols=10  Identities=50%  Similarity=1.444  Sum_probs=6.1

Q ss_pred             eecCcccccc
Q psy4830          94 YQCEVCNKRF  103 (292)
Q Consensus        94 ~~C~~C~~~f  103 (292)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            5666666554


No 182
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=45.51  E-value=8.9  Score=20.88  Aligned_cols=15  Identities=40%  Similarity=0.886  Sum_probs=9.7

Q ss_pred             cceeCCccccccCCh
Q psy4830         240 KPFGCTSCHLTFTSK  254 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~  254 (292)
                      -|+.|+.|++.|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478999999999764


No 183
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=44.67  E-value=14  Score=19.34  Aligned_cols=18  Identities=22%  Similarity=0.599  Sum_probs=9.2

Q ss_pred             hhhhccccCCcceeCCcc
Q psy4830         230 TSHRWSHVGDKPFGCTSC  247 (292)
Q Consensus       230 ~~H~~~h~~~~~~~C~~C  247 (292)
                      .+|-....|...|.|..|
T Consensus        18 ~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   18 KKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCCEeEecCcC
Confidence            344444445555666555


No 185
>KOG1701|consensus
Probab=44.62  E-value=15  Score=31.24  Aligned_cols=39  Identities=18%  Similarity=0.413  Sum_probs=21.0

Q ss_pred             cccccccccccchhhhhhhccccCC-----cceeCCccccccCC
Q psy4830         215 ACDICDKRFAVKSYVTSHRWSHVGD-----KPFGCTSCHLTFTS  253 (292)
Q Consensus       215 ~C~~C~k~f~~~~~L~~H~~~h~~~-----~~~~C~~C~~~f~~  253 (292)
                      +|.+|++-..-...-..=+++-.-+     .=|+|+.|+.-.+.
T Consensus       396 rCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS~  439 (468)
T KOG1701|consen  396 RCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLSS  439 (468)
T ss_pred             chhhccCCccCCCCCcceEEEEEccccccccceehhhcCccccc
Confidence            5888877554433333223322222     24778888876663


No 186
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=44.45  E-value=6.9  Score=25.35  Aligned_cols=32  Identities=22%  Similarity=0.618  Sum_probs=19.3

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccccccCC
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTS  253 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~  253 (292)
                      ..|.|+.|++.-...          .+...+.|..|++.|+-
T Consensus        35 a~y~CpfCgk~~vkR----------~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVKR----------VGTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceEE----------EEEEEEEcCCCCCEEeC
Confidence            467888887542211          12345778888887754


No 187
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=44.00  E-value=21  Score=31.78  Aligned_cols=10  Identities=20%  Similarity=0.713  Sum_probs=5.8

Q ss_pred             CcceeCCccc
Q psy4830         239 DKPFGCTSCH  248 (292)
Q Consensus       239 ~~~~~C~~C~  248 (292)
                      +....|..||
T Consensus       238 ~~~l~Ch~Cg  247 (505)
T TIGR00595       238 EGKLRCHYCG  247 (505)
T ss_pred             CCeEEcCCCc
Confidence            4455666666


No 188
>KOG0717|consensus
Probab=43.83  E-value=11  Score=32.43  Aligned_cols=21  Identities=38%  Similarity=0.736  Sum_probs=19.3

Q ss_pred             cccCCCCCCccChHHHHhhhc
Q psy4830         271 HVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       271 ~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      +.|.+|+++|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            779999999999999999964


No 189
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=43.47  E-value=8  Score=29.81  Aligned_cols=30  Identities=20%  Similarity=0.408  Sum_probs=22.4

Q ss_pred             CCCCCccccccccccCCchHHHHHHhhhcC
Q psy4830         181 TGERPFQCAVCSKRFTQKSSLNTHKRVHTG  210 (292)
Q Consensus       181 ~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~  210 (292)
                      ..+..|.|+.|+|.|.-..-...|+..-+.
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            345579999999999999999999876443


No 190
>PRK00420 hypothetical protein; Validated
Probab=43.14  E-value=17  Score=24.73  Aligned_cols=9  Identities=11%  Similarity=0.099  Sum_probs=4.6

Q ss_pred             eeCCccccc
Q psy4830         242 FGCTSCHLT  250 (292)
Q Consensus       242 ~~C~~C~~~  250 (292)
                      ..|+.||..
T Consensus        41 ~~Cp~Cg~~   49 (112)
T PRK00420         41 VVCPVHGKV   49 (112)
T ss_pred             eECCCCCCe
Confidence            455555543


No 191
>KOG1280|consensus
Probab=42.87  E-value=25  Score=29.08  Aligned_cols=23  Identities=17%  Similarity=0.317  Sum_probs=12.4

Q ss_pred             Cccccccccccccchhhhhhhcc
Q psy4830         213 PYACDICDKRFAVKSYVTSHRWS  235 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L~~H~~~  235 (292)
                      .|.|++|++.=.+...|..|...
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s  101 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLS  101 (381)
T ss_pred             cccCCcccccccchhHHHHHhhh
Confidence            45555555555555555555443


No 192
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=42.74  E-value=12  Score=21.15  Aligned_cols=39  Identities=18%  Similarity=0.342  Sum_probs=22.0

Q ss_pred             CcceeCCccccccCChhHHHHHhhhhcCCCCCcccCCCC
Q psy4830         239 DKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCG  277 (292)
Q Consensus       239 ~~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C~  277 (292)
                      ++.+.|..||..|.--..=..-....--...|-.|+.|.
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHH
Confidence            577899999988876543333322210112355576664


No 193
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=42.59  E-value=28  Score=32.05  Aligned_cols=9  Identities=22%  Similarity=0.796  Sum_probs=5.5

Q ss_pred             ccccccccc
Q psy4830         215 ACDICDKRF  223 (292)
Q Consensus       215 ~C~~C~k~f  223 (292)
                      -|+.||..+
T Consensus        17 FC~~CG~~l   25 (645)
T PRK14559         17 FCQKCGTSL   25 (645)
T ss_pred             cccccCCCC
Confidence            366666655


No 194
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=42.10  E-value=13  Score=25.61  Aligned_cols=13  Identities=23%  Similarity=0.593  Sum_probs=7.7

Q ss_pred             Ccccccccccccc
Q psy4830         213 PYACDICDKRFAV  225 (292)
Q Consensus       213 ~~~C~~C~k~f~~  225 (292)
                      .+.|..||..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3567777655543


No 195
>KOG2636|consensus
Probab=41.47  E-value=18  Score=31.03  Aligned_cols=26  Identities=19%  Similarity=0.487  Sum_probs=16.3

Q ss_pred             hcCCCCcccccch-hhcCChhHHHHHH
Q psy4830          32 HTGERPFQCVVCL-KRFSQKSALNTHK   57 (292)
Q Consensus        32 h~~~~~~~C~~C~-~~f~~~~~l~~H~   57 (292)
                      |.-...|.|.+|| +++..+.++.+|-
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHh
Confidence            4444556777776 6666666666664


No 196
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=41.20  E-value=20  Score=31.30  Aligned_cols=26  Identities=19%  Similarity=0.534  Sum_probs=18.5

Q ss_pred             eeCCccccccCChhHHHHHhhhhcCC
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHHTV  267 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh~~  267 (292)
                      ..|+.|.+.|.+...+..|+..-|.+
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhh
Confidence            56777777777777777777665544


No 197
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=39.52  E-value=20  Score=20.63  Aligned_cols=17  Identities=12%  Similarity=0.444  Sum_probs=11.9

Q ss_pred             CccccccccccCCchHH
Q psy4830         185 PFQCAVCSKRFTQKSSL  201 (292)
Q Consensus       185 ~~~C~~C~k~f~~~~~L  201 (292)
                      -++|+.||-.|...-..
T Consensus        28 ~W~C~~Cgh~w~~~v~~   44 (55)
T PF14311_consen   28 WWKCPKCGHEWKASVND   44 (55)
T ss_pred             EEECCCCCCeeEccHhh
Confidence            47888888877665443


No 198
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=39.45  E-value=14  Score=18.16  Aligned_cols=8  Identities=25%  Similarity=1.057  Sum_probs=2.8

Q ss_pred             ceeCCccc
Q psy4830         241 PFGCTSCH  248 (292)
Q Consensus       241 ~~~C~~C~  248 (292)
                      .|.|..|+
T Consensus        15 ~Y~C~~Cd   22 (30)
T PF07649_consen   15 FYRCSECD   22 (30)
T ss_dssp             EEE-TTT-
T ss_pred             eEECccCC
Confidence            34444444


No 199
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=39.10  E-value=10  Score=21.84  Aligned_cols=13  Identities=31%  Similarity=0.963  Sum_probs=6.6

Q ss_pred             ccCCCCCCccChH
Q psy4830         272 VCNVCGRSFVRDS  284 (292)
Q Consensus       272 ~C~~C~~~f~~~~  284 (292)
                      .||+|+..|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            7888888887543


No 200
>KOG1842|consensus
Probab=38.63  E-value=17  Score=31.11  Aligned_cols=24  Identities=33%  Similarity=0.609  Sum_probs=12.3

Q ss_pred             eeCCccccccCChhHHHHHhhhhc
Q psy4830         242 FGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      |.||+|.+-|.+...|..|...-|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            455555555555555555554444


No 201
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=38.52  E-value=19  Score=29.77  Aligned_cols=26  Identities=23%  Similarity=0.557  Sum_probs=20.8

Q ss_pred             cCCCCCcccCCCC-CCccChHHHHhhh
Q psy4830         265 HTVGANHVCNVCG-RSFVRDSYLIRHQ  290 (292)
Q Consensus       265 h~~~~~~~C~~C~-~~f~~~~~l~~H~  290 (292)
                      |+.+..|.|.+|| +++.-+..+.+|.
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhhh
Confidence            5778889999999 7887777777763


No 202
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=38.28  E-value=17  Score=24.36  Aligned_cols=29  Identities=17%  Similarity=0.630  Sum_probs=16.9

Q ss_pred             cccccccccccchhhhhhhccccCCcceeCCccccccCCh
Q psy4830         215 ACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSK  254 (292)
Q Consensus       215 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~  254 (292)
                      .|+.|+..|.+..           ...|.|+.|+..+...
T Consensus         4 ~CP~C~seytY~d-----------g~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHD-----------GTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEec-----------CCeeECcccccccccc
Confidence            4667766665432           2346777777666544


No 203
>KOG0782|consensus
Probab=38.26  E-value=3.7  Score=36.03  Aligned_cols=27  Identities=26%  Similarity=0.543  Sum_probs=11.5

Q ss_pred             hhhhhhccccCCcceeCCccccccCCh
Q psy4830         228 YVTSHRWSHVGDKPFGCTSCHLTFTSK  254 (292)
Q Consensus       228 ~L~~H~~~h~~~~~~~C~~C~~~f~~~  254 (292)
                      .+.+|-.+|.....=+|..|||+|.++
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQK  266 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQK  266 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhh
Confidence            344444444333333455555555443


No 204
>KOG4727|consensus
Probab=38.16  E-value=16  Score=26.76  Aligned_cols=20  Identities=20%  Similarity=0.557  Sum_probs=11.9

Q ss_pred             eeCCccccccCChhHHHHHh
Q psy4830         242 FGCTSCHLTFTSKSQFAVHL  261 (292)
Q Consensus       242 ~~C~~C~~~f~~~~~L~~H~  261 (292)
                      |-|.+|+-+|....++..|+
T Consensus        76 yyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             eeeeecceeehhhHHHHHHh
Confidence            55666666666665555554


No 205
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=38.14  E-value=14  Score=25.18  Aligned_cols=12  Identities=25%  Similarity=0.623  Sum_probs=6.4

Q ss_pred             cccccccccccc
Q psy4830         214 YACDICDKRFAV  225 (292)
Q Consensus       214 ~~C~~C~k~f~~  225 (292)
                      ..|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            456666666554


No 206
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=37.94  E-value=17  Score=24.09  Aligned_cols=17  Identities=35%  Similarity=0.722  Sum_probs=10.4

Q ss_pred             cccCCcceeCCccccccC
Q psy4830         235 SHVGDKPFGCTSCHLTFT  252 (292)
Q Consensus       235 ~h~~~~~~~C~~C~~~f~  252 (292)
                      .+.| +|+.|+.||..|.
T Consensus        74 l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          74 LEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EeCC-CceeCCCCCcEEE
Confidence            3444 5677777776664


No 207
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=37.78  E-value=30  Score=18.32  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=2.5

Q ss_pred             cccCCCCCCc
Q psy4830         271 HVCNVCGRSF  280 (292)
Q Consensus       271 ~~C~~C~~~f  280 (292)
                      |-|+.|+..|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            4455555544


No 208
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=37.72  E-value=16  Score=19.68  Aligned_cols=12  Identities=33%  Similarity=1.046  Sum_probs=9.5

Q ss_pred             CCcccccccccc
Q psy4830         184 RPFQCAVCSKRF  195 (292)
Q Consensus       184 ~~~~C~~C~k~f  195 (292)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467899998877


No 209
>PRK12496 hypothetical protein; Provisional
Probab=37.66  E-value=26  Score=25.87  Aligned_cols=12  Identities=17%  Similarity=0.581  Sum_probs=8.5

Q ss_pred             eeCCccccccCC
Q psy4830         242 FGCTSCHLTFTS  253 (292)
Q Consensus       242 ~~C~~C~~~f~~  253 (292)
                      |.|+-|++.|..
T Consensus       128 ~~C~gC~~~~~~  139 (164)
T PRK12496        128 KVCKGCKKKYPE  139 (164)
T ss_pred             EECCCCCccccC
Confidence            678888777743


No 210
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=37.22  E-value=26  Score=19.73  Aligned_cols=14  Identities=21%  Similarity=0.472  Sum_probs=8.8

Q ss_pred             ceeCCccccccCCh
Q psy4830         241 PFGCTSCHLTFTSK  254 (292)
Q Consensus       241 ~~~C~~C~~~f~~~  254 (292)
                      .+.|+.||..+.-.
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            56777777655443


No 211
>COG1773 Rubredoxin [Energy production and conversion]
Probab=37.14  E-value=13  Score=21.54  Aligned_cols=12  Identities=33%  Similarity=0.855  Sum_probs=6.5

Q ss_pred             CcccCCCCCCcc
Q psy4830         270 NHVCNVCGRSFV  281 (292)
Q Consensus       270 ~~~C~~C~~~f~  281 (292)
                      .|+|.+||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            355666655543


No 212
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.82  E-value=15  Score=26.68  Aligned_cols=6  Identities=33%  Similarity=1.342  Sum_probs=2.3

Q ss_pred             cccccc
Q psy4830         187 QCAVCS  192 (292)
Q Consensus       187 ~C~~C~  192 (292)
                      .|+.|+
T Consensus       125 ~C~~C~  130 (157)
T PF10263_consen  125 RCPSCG  130 (157)
T ss_pred             EcCCCC
Confidence            333333


No 213
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=36.79  E-value=21  Score=30.56  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=6.0

Q ss_pred             ceeCCccccccCC
Q psy4830         241 PFGCTSCHLTFTS  253 (292)
Q Consensus       241 ~~~C~~C~~~f~~  253 (292)
                      -|+|+.||..+..
T Consensus       367 g~rC~kCg~~~~~  379 (421)
T COG1571         367 GFRCKKCGTRARE  379 (421)
T ss_pred             CcccccccccCCc
Confidence            4444444444443


No 214
>PRK10220 hypothetical protein; Provisional
Probab=36.14  E-value=24  Score=23.69  Aligned_cols=29  Identities=14%  Similarity=0.603  Sum_probs=16.7

Q ss_pred             cccccccccccchhhhhhhccccCCcceeCCccccccCCh
Q psy4830         215 ACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSK  254 (292)
Q Consensus       215 ~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~  254 (292)
                      .|+.|+..|.+..           ...|.|+.|+..+...
T Consensus         5 ~CP~C~seytY~d-----------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED-----------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC-----------CCeEECCcccCcCCcc
Confidence            4666766665432           2346777777666544


No 215
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=35.75  E-value=25  Score=24.10  Aligned_cols=12  Identities=17%  Similarity=0.606  Sum_probs=6.7

Q ss_pred             Cccccccccccc
Q psy4830         213 PYACDICDKRFA  224 (292)
Q Consensus       213 ~~~C~~C~k~f~  224 (292)
                      ...|..||..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (114)
T PRK03681         70 ECWCETCQQYVT   81 (114)
T ss_pred             EEEcccCCCeee
Confidence            355666665443


No 216
>KOG1280|consensus
Probab=35.02  E-value=38  Score=28.06  Aligned_cols=38  Identities=21%  Similarity=0.462  Sum_probs=27.7

Q ss_pred             CCCccccccccccCCchHHHHHHhhhcCCCC--ccccccc
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHTGERP--YACDICD  220 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~--~~C~~C~  220 (292)
                      +..|.|++|+++=.+...|..|+..-+.+-+  ..|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4479999999998899999999865443332  3456555


No 217
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=34.44  E-value=13  Score=28.14  Aligned_cols=24  Identities=17%  Similarity=0.463  Sum_probs=0.0

Q ss_pred             ccCCcceeCCccc-cccCChhHHHH
Q psy4830         236 HVGDKPFGCTSCH-LTFTSKSQFAV  259 (292)
Q Consensus       236 h~~~~~~~C~~C~-~~f~~~~~L~~  259 (292)
                      |--...|.|.+|| .+|.-+..+.+
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFek  120 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEK  120 (196)
T ss_dssp             -------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHH
Confidence            3334567788876 33434444444


No 218
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=34.06  E-value=11  Score=34.38  Aligned_cols=54  Identities=30%  Similarity=0.642  Sum_probs=24.3

Q ss_pred             ccccccccCCchHHHHHHhhhcCCCCc-cccccccccccchhhhhhhccccCCcceeCCccc
Q psy4830         188 CAVCSKRFTQKSSLNTHKRVHTGERPY-ACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCH  248 (292)
Q Consensus       188 C~~C~k~f~~~~~L~~H~~~h~~~~~~-~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~  248 (292)
                      |..||-+|+--..|--- |-.+.-+.| -|+.|.+.+....+-+-|.      .|..|+.||
T Consensus       126 CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfHA------Qp~aCp~CG  180 (750)
T COG0068         126 CTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFHA------QPIACPKCG  180 (750)
T ss_pred             cCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCcccccccc------ccccCcccC
Confidence            66666666544333221 111222222 2566665555555444442      344566665


No 219
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=34.02  E-value=19  Score=18.54  Aligned_cols=7  Identities=29%  Similarity=1.023  Sum_probs=3.3

Q ss_pred             eeCCccc
Q psy4830         242 FGCTSCH  248 (292)
Q Consensus       242 ~~C~~C~  248 (292)
                      +.|+.||
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            4444444


No 220
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=33.59  E-value=16  Score=26.37  Aligned_cols=8  Identities=25%  Similarity=0.987  Sum_probs=4.0

Q ss_pred             cccccccc
Q psy4830         214 YACDICDK  221 (292)
Q Consensus       214 ~~C~~C~k  221 (292)
                      |.|..||.
T Consensus       113 l~C~~Cg~  120 (146)
T PF07295_consen  113 LVCENCGH  120 (146)
T ss_pred             EecccCCC
Confidence            45555553


No 221
>KOG0782|consensus
Probab=33.10  E-value=14  Score=32.76  Aligned_cols=53  Identities=25%  Similarity=0.537  Sum_probs=37.9

Q ss_pred             CchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCC-cceeCCccccccCChh
Q psy4830         197 QKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGD-KPFGCTSCHLTFTSKS  255 (292)
Q Consensus       197 ~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~-~~~~C~~C~~~f~~~~  255 (292)
                      ..+.|.+|-.+|.....=+|..|||.|..+..+      |..+ -...|..|...|..+.
T Consensus       237 rE~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  237 RESGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccccchHHhHhhHhhhccccchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            345788887777665556899999999876543      3333 2468999999988765


No 222
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=33.06  E-value=32  Score=17.58  Aligned_cols=22  Identities=32%  Similarity=0.611  Sum_probs=12.6

Q ss_pred             ceeCCccccccCChhHHHHHhhh
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      .+.|+.|++.+.. +-+..|+..
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHHHH
Confidence            3677777776543 456666544


No 223
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=32.85  E-value=19  Score=25.84  Aligned_cols=11  Identities=36%  Similarity=0.905  Sum_probs=6.3

Q ss_pred             ccccccccccc
Q psy4830         215 ACDICDKRFAV  225 (292)
Q Consensus       215 ~C~~C~k~f~~  225 (292)
                      .|+.||.+|++
T Consensus        30 eC~~C~~RFTT   40 (156)
T COG1327          30 ECLECGERFTT   40 (156)
T ss_pred             cccccccccch
Confidence            45555555555


No 224
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=32.66  E-value=16  Score=21.25  Aligned_cols=36  Identities=19%  Similarity=0.462  Sum_probs=16.6

Q ss_pred             cccccccccccchh-hhhhhccccCCcceeCCccccc
Q psy4830         215 ACDICDKRFAVKSY-VTSHRWSHVGDKPFGCTSCHLT  250 (292)
Q Consensus       215 ~C~~C~k~f~~~~~-L~~H~~~h~~~~~~~C~~C~~~  250 (292)
                      +|-+|++.+.-... +..=...-.....|-|+.|...
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            57777776543221 1111111123345777777543


No 225
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=32.49  E-value=26  Score=30.54  Aligned_cols=21  Identities=19%  Similarity=0.577  Sum_probs=19.2

Q ss_pred             cccCCCCCCccChHHHHhhhc
Q psy4830         271 HVCNVCGRSFVRDSYLIRHQN  291 (292)
Q Consensus       271 ~~C~~C~~~f~~~~~l~~H~r  291 (292)
                      +.|+.|++.|.....+..||.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            679999999999999999974


No 226
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=32.11  E-value=8.9  Score=34.97  Aligned_cols=29  Identities=21%  Similarity=0.474  Sum_probs=15.4

Q ss_pred             ccccchhhcCChhHHHHHHhhcCCCcceecccccc
Q psy4830          39 QCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDA   73 (292)
Q Consensus        39 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   73 (292)
                      .|+.|.+.|.+..+-+-|.      .+..|+.||-
T Consensus       153 lC~~C~~EY~dP~nRRfHA------Qp~aCp~CGP  181 (750)
T COG0068         153 LCPFCDKEYKDPLNRRFHA------QPIACPKCGP  181 (750)
T ss_pred             CCHHHHHHhcCcccccccc------ccccCcccCC
Confidence            3666666666555544442      2345666653


No 227
>KOG0978|consensus
Probab=32.03  E-value=22  Score=32.70  Aligned_cols=12  Identities=33%  Similarity=1.146  Sum_probs=8.3

Q ss_pred             ccccccccccCC
Q psy4830         186 FQCAVCSKRFTQ  197 (292)
Q Consensus       186 ~~C~~C~k~f~~  197 (292)
                      ..|+.|+..+..
T Consensus       644 LkCs~Cn~R~Kd  655 (698)
T KOG0978|consen  644 LKCSVCNTRWKD  655 (698)
T ss_pred             eeCCCccCchhh
Confidence            568888865544


No 228
>PRK05978 hypothetical protein; Provisional
Probab=31.99  E-value=23  Score=25.54  Aligned_cols=10  Identities=30%  Similarity=0.989  Sum_probs=5.9

Q ss_pred             cccccccccc
Q psy4830         215 ACDICDKRFA  224 (292)
Q Consensus       215 ~C~~C~k~f~  224 (292)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            4666666554


No 229
>PRK14873 primosome assembly protein PriA; Provisional
Probab=31.89  E-value=37  Score=31.48  Aligned_cols=10  Identities=30%  Similarity=0.880  Sum_probs=6.9

Q ss_pred             CcccCCCCCC
Q psy4830         270 NHVCNVCGRS  279 (292)
Q Consensus       270 ~~~C~~C~~~  279 (292)
                      +..|+.||-.
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            5678888754


No 230
>KOG2071|consensus
Probab=31.87  E-value=32  Score=30.79  Aligned_cols=27  Identities=30%  Similarity=0.678  Sum_probs=23.0

Q ss_pred             CCCccccccccccCCchHHHHHHhhhc
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHT  209 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~  209 (292)
                      ..+-+|..||.+|........||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456789999999999999988887774


No 231
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=30.60  E-value=25  Score=23.41  Aligned_cols=8  Identities=38%  Similarity=1.157  Sum_probs=4.8

Q ss_pred             Cccccccc
Q psy4830         185 PFQCAVCS  192 (292)
Q Consensus       185 ~~~C~~C~  192 (292)
                      .|.|+.||
T Consensus        21 ~f~CP~Cg   28 (99)
T PRK14892         21 IFECPRCG   28 (99)
T ss_pred             EeECCCCC
Confidence            45666666


No 232
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=30.50  E-value=26  Score=30.07  Aligned_cols=14  Identities=14%  Similarity=0.558  Sum_probs=7.4

Q ss_pred             ceecccccccCCCh
Q psy4830          65 QYYCDACDATFTTK   78 (292)
Q Consensus        65 ~~~C~~C~~~f~~~   78 (292)
                      -|+|+.|+..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            45555555555443


No 233
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=30.14  E-value=25  Score=17.90  Aligned_cols=8  Identities=38%  Similarity=1.236  Sum_probs=3.2

Q ss_pred             cccCCCCC
Q psy4830         271 HVCNVCGR  278 (292)
Q Consensus       271 ~~C~~C~~  278 (292)
                      |.|..|+.
T Consensus        28 f~C~~C~~   35 (39)
T smart00132       28 FKCSKCGK   35 (39)
T ss_pred             CCCcccCC
Confidence            33444443


No 234
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=29.93  E-value=63  Score=18.80  Aligned_cols=16  Identities=25%  Similarity=0.542  Sum_probs=8.7

Q ss_pred             ccCCCCCCccChHHHH
Q psy4830         272 VCNVCGRSFVRDSYLI  287 (292)
Q Consensus       272 ~C~~C~~~f~~~~~l~  287 (292)
                      -|-.||..|.+...|.
T Consensus        29 YC~~Cg~~Y~d~~dL~   44 (55)
T PF13821_consen   29 YCFWCGTKYDDEEDLE   44 (55)
T ss_pred             eeeeeCCccCCHHHHH
Confidence            3555555555555554


No 235
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=29.80  E-value=13  Score=30.30  Aligned_cols=77  Identities=23%  Similarity=0.449  Sum_probs=29.4

Q ss_pred             ccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhc
Q psy4830         186 FQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHH  265 (292)
Q Consensus       186 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh  265 (292)
                      -.|++||..= ..+.|..-..  .|.+-..|..|+-....              ....|+.||..-...-.+-. ... -
T Consensus       173 g~CPvCGs~P-~~s~l~~~~~--~G~R~L~Cs~C~t~W~~--------------~R~~Cp~Cg~~~~~~l~~~~-~e~-~  233 (290)
T PF04216_consen  173 GYCPVCGSPP-VLSVLRGGER--EGKRYLHCSLCGTEWRF--------------VRIKCPYCGNTDHEKLEYFT-VEG-E  233 (290)
T ss_dssp             SS-TTT---E-EEEEEE--------EEEEEETTT--EEE----------------TTS-TTT---SS-EEE---------
T ss_pred             CcCCCCCCcC-ceEEEecCCC--CccEEEEcCCCCCeeee--------------cCCCCcCCCCCCCcceeeEe-cCC-C
Confidence            3699998632 1222211111  25667789999854321              23479999977554432221 000 0


Q ss_pred             CCCCCcccCCCCCCcc
Q psy4830         266 TVGANHVCNVCGRSFV  281 (292)
Q Consensus       266 ~~~~~~~C~~C~~~f~  281 (292)
                      ...+-+.|..|+--++
T Consensus       234 ~~~rve~C~~C~~YlK  249 (290)
T PF04216_consen  234 PAYRVEVCESCGSYLK  249 (290)
T ss_dssp             -SEEEEEETTTTEEEE
T ss_pred             CcEEEEECCcccchHH
Confidence            1123467999985544


No 236
>KOG4727|consensus
Probab=29.20  E-value=30  Score=25.35  Aligned_cols=21  Identities=29%  Similarity=0.498  Sum_probs=18.4

Q ss_pred             Cccccccccccccchhhhhhh
Q psy4830         213 PYACDICDKRFAVKSYVTSHR  233 (292)
Q Consensus       213 ~~~C~~C~k~f~~~~~L~~H~  233 (292)
                      -|-|++|+-+|....++..|+
T Consensus        75 GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             ceeeeecceeehhhHHHHHHh
Confidence            588999999999988888874


No 237
>KOG3214|consensus
Probab=28.94  E-value=19  Score=23.66  Aligned_cols=14  Identities=29%  Similarity=0.712  Sum_probs=7.8

Q ss_pred             cccCCCCCCccChH
Q psy4830         271 HVCNVCGRSFVRDS  284 (292)
Q Consensus       271 ~~C~~C~~~f~~~~  284 (292)
                      ..|.+|+.+|.+..
T Consensus        48 ~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   48 ASCRICEESFQTTI   61 (109)
T ss_pred             eeeeehhhhhccch
Confidence            34666666665543


No 238
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=28.85  E-value=47  Score=19.45  Aligned_cols=10  Identities=20%  Similarity=0.571  Sum_probs=3.1

Q ss_pred             cccccccccc
Q psy4830         215 ACDICDKRFA  224 (292)
Q Consensus       215 ~C~~C~k~f~  224 (292)
                      ....||-.|.
T Consensus        26 ~s~~C~H~fe   35 (57)
T PF11789_consen   26 KSKKCGHTFE   35 (57)
T ss_dssp             EESSS--EEE
T ss_pred             CcCCCCCeec
Confidence            3334444443


No 239
>KOG0978|consensus
Probab=28.83  E-value=16  Score=33.48  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=10.5

Q ss_pred             ccCCCCCCccChHHHHhh
Q psy4830         272 VCNVCGRSFVRDSYLIRH  289 (292)
Q Consensus       272 ~C~~C~~~f~~~~~l~~H  289 (292)
                      +||.|+.+|.-.+-+..|
T Consensus       680 KCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  680 KCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             CCCCCCCCCCcccccccC
Confidence            466666666655554443


No 240
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=28.69  E-value=26  Score=24.61  Aligned_cols=17  Identities=41%  Similarity=0.894  Sum_probs=13.7

Q ss_pred             CCcceeCCccccccCCh
Q psy4830         238 GDKPFGCTSCHLTFTSK  254 (292)
Q Consensus       238 ~~~~~~C~~C~~~f~~~  254 (292)
                      |...|.|+.|+++|...
T Consensus        50 ~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          50 GHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccccCCcCcceeee
Confidence            35679999999999754


No 241
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=28.66  E-value=9.3  Score=21.30  Aligned_cols=14  Identities=36%  Similarity=0.636  Sum_probs=7.4

Q ss_pred             cceeCCc--cccccCC
Q psy4830         240 KPFGCTS--CHLTFTS  253 (292)
Q Consensus       240 ~~~~C~~--C~~~f~~  253 (292)
                      .-|.|..  ||.+|..
T Consensus        24 ~Y~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen   24 LYCQCTNPECGHTFVA   39 (47)
T ss_pred             EEEEECCCcCCCEEEE
Confidence            3455644  6666543


No 242
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.58  E-value=40  Score=19.91  Aligned_cols=8  Identities=38%  Similarity=1.182  Sum_probs=4.0

Q ss_pred             ceecCccc
Q psy4830          93 PYQCEVCN  100 (292)
Q Consensus        93 ~~~C~~C~  100 (292)
                      .|.|+.|.
T Consensus        31 tymC~eC~   38 (68)
T COG4896          31 TYMCPECE   38 (68)
T ss_pred             eEechhhH
Confidence            35555554


No 243
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=28.50  E-value=25  Score=19.99  Aligned_cols=11  Identities=27%  Similarity=0.833  Sum_probs=6.2

Q ss_pred             cccCCCCCCcc
Q psy4830         271 HVCNVCGRSFV  281 (292)
Q Consensus       271 ~~C~~C~~~f~  281 (292)
                      |+|.+||..|.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            55666665554


No 244
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=28.45  E-value=45  Score=22.35  Aligned_cols=8  Identities=38%  Similarity=1.219  Sum_probs=3.8

Q ss_pred             Cccccccc
Q psy4830         185 PFQCAVCS  192 (292)
Q Consensus       185 ~~~C~~C~  192 (292)
                      |..|+.||
T Consensus         2 p~~CpYCg    9 (102)
T PF11672_consen    2 PIICPYCG    9 (102)
T ss_pred             CcccCCCC
Confidence            33455554


No 245
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.41  E-value=25  Score=19.57  Aligned_cols=13  Identities=38%  Similarity=0.946  Sum_probs=7.7

Q ss_pred             ccCCCCCCccChH
Q psy4830         272 VCNVCGRSFVRDS  284 (292)
Q Consensus       272 ~C~~C~~~f~~~~  284 (292)
                      .|++|+..|+...
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            3666666666543


No 246
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=27.80  E-value=26  Score=26.63  Aligned_cols=11  Identities=18%  Similarity=0.368  Sum_probs=5.7

Q ss_pred             eeCCccccccC
Q psy4830         242 FGCTSCHLTFT  252 (292)
Q Consensus       242 ~~C~~C~~~f~  252 (292)
                      |.|+.||....
T Consensus        31 f~C~~CGyr~~   41 (192)
T TIGR00310        31 TICEHCGYRSN   41 (192)
T ss_pred             EECCCCCCccc
Confidence            45555554443


No 247
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=27.18  E-value=36  Score=22.54  Aligned_cols=13  Identities=31%  Similarity=0.741  Sum_probs=6.2

Q ss_pred             Ccccccccccccc
Q psy4830         213 PYACDICDKRFAV  225 (292)
Q Consensus       213 ~~~C~~C~k~f~~  225 (292)
                      |++|..||..|..
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            3445555555543


No 248
>PLN02294 cytochrome c oxidase subunit Vb
Probab=26.84  E-value=30  Score=25.46  Aligned_cols=13  Identities=31%  Similarity=0.708  Sum_probs=6.9

Q ss_pred             CCcccCCCCCCcc
Q psy4830         269 ANHVCNVCGRSFV  281 (292)
Q Consensus       269 ~~~~C~~C~~~f~  281 (292)
                      +++.|+.||..|.
T Consensus       140 kp~RCpeCG~~fk  152 (174)
T PLN02294        140 KSFECPVCTQYFE  152 (174)
T ss_pred             CceeCCCCCCEEE
Confidence            4555555555554


No 249
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=26.79  E-value=23  Score=19.85  Aligned_cols=11  Identities=36%  Similarity=0.842  Sum_probs=6.3

Q ss_pred             cccCCCCCCcc
Q psy4830         271 HVCNVCGRSFV  281 (292)
Q Consensus       271 ~~C~~C~~~f~  281 (292)
                      |+|.+|+..|.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            55666665543


No 250
>COG4640 Predicted membrane protein [Function unknown]
Probab=26.75  E-value=43  Score=28.36  Aligned_cols=19  Identities=37%  Similarity=0.585  Sum_probs=10.9

Q ss_pred             ceeCCccccccCChhHHHH
Q psy4830         241 PFGCTSCHLTFTSKSQFAV  259 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~  259 (292)
                      .+.|+.||..|....++..
T Consensus        15 ~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640          15 DVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             cccccccCCcCCchhhhhh
Confidence            3446666666666554443


No 251
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=25.86  E-value=33  Score=17.97  Aligned_cols=12  Identities=17%  Similarity=0.534  Sum_probs=6.3

Q ss_pred             cceeCCcccccc
Q psy4830         240 KPFGCTSCHLTF  251 (292)
Q Consensus       240 ~~~~C~~C~~~f  251 (292)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458888888654


No 252
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=25.81  E-value=40  Score=27.28  Aligned_cols=24  Identities=25%  Similarity=0.415  Sum_probs=18.6

Q ss_pred             CcceeCCccccccCChhHHHHHhh
Q psy4830         239 DKPFGCTSCHLTFTSKSQFAVHLR  262 (292)
Q Consensus       239 ~~~~~C~~C~~~f~~~~~L~~H~~  262 (292)
                      +..|.|+.|=+-|.+...|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            456888888888888888888864


No 253
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=25.68  E-value=1.1e+02  Score=17.74  Aligned_cols=46  Identities=13%  Similarity=0.161  Sum_probs=27.3

Q ss_pred             ccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhhhcCCCCCcccCCCCCCccC
Q psy4830         214 YACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVR  282 (292)
Q Consensus       214 ~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C~~~f~~  282 (292)
                      +.|++|+..+...                ....||..|.. ..+..+++.      ...|++|++.+..
T Consensus         2 ~~Cpi~~~~~~~P----------------v~~~~G~v~~~-~~i~~~~~~------~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMKDP----------------VILPSGQTYER-RAIEKWLLS------HGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCCCC----------------EECCCCCEEeH-HHHHHHHHH------CCCCCCCcCCCCh
Confidence            5688888776542                12345655643 455555544      1368888888744


No 254
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=25.63  E-value=70  Score=23.93  Aligned_cols=11  Identities=18%  Similarity=0.833  Sum_probs=4.9

Q ss_pred             Ccccccccccc
Q psy4830         185 PFQCAVCSKRF  195 (292)
Q Consensus       185 ~~~C~~C~k~f  195 (292)
                      -|.|+.|.-.|
T Consensus       113 ~y~C~~~~~r~  123 (176)
T COG1675         113 YYVCPNCHVKY  123 (176)
T ss_pred             ceeCCCCCCcc
Confidence            34454444433


No 255
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=25.57  E-value=46  Score=22.57  Aligned_cols=10  Identities=20%  Similarity=0.654  Sum_probs=4.9

Q ss_pred             ceeCCccccc
Q psy4830         241 PFGCTSCHLT  250 (292)
Q Consensus       241 ~~~C~~C~~~  250 (292)
                      ...||.|++.
T Consensus        69 ~V~CP~C~K~   78 (114)
T PF11023_consen   69 QVECPNCGKQ   78 (114)
T ss_pred             eeECCCCCCh
Confidence            3445555543


No 256
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.39  E-value=32  Score=23.65  Aligned_cols=41  Identities=22%  Similarity=0.332  Sum_probs=22.7

Q ss_pred             ccccccccccccchhhhhhhc-cccCCcceeCCccccccCCh
Q psy4830         214 YACDICDKRFAVKSYVTSHRW-SHVGDKPFGCTSCHLTFTSK  254 (292)
Q Consensus       214 ~~C~~C~k~f~~~~~L~~H~~-~h~~~~~~~C~~C~~~f~~~  254 (292)
                      -+|++|............=.- -+.-+.|--|..||+.|..-
T Consensus        40 ~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpwt   81 (160)
T COG4306          40 TQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWT   81 (160)
T ss_pred             hcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcH
Confidence            468888876554433322111 12223466688888888764


No 257
>KOG1842|consensus
Probab=25.39  E-value=47  Score=28.62  Aligned_cols=26  Identities=15%  Similarity=0.245  Sum_probs=22.4

Q ss_pred             CccCCcchhhcCChhHHHHHHhhhcC
Q psy4830           9 PYHCTACDASFCRKPYLEIHMRTHTG   34 (292)
Q Consensus         9 ~~~C~~C~~~f~~~~~l~~H~~~h~~   34 (292)
                      .|.|++|...|.+.+.|..|....++
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhcc
Confidence            58999999999999999999976443


No 258
>PTZ00448 hypothetical protein; Provisional
Probab=25.09  E-value=48  Score=27.89  Aligned_cols=23  Identities=17%  Similarity=0.454  Sum_probs=18.1

Q ss_pred             CccCCcchhhcCChhHHHHHHhh
Q psy4830           9 PYHCTACDASFCRKPYLEIHMRT   31 (292)
Q Consensus         9 ~~~C~~C~~~f~~~~~l~~H~~~   31 (292)
                      .|.|..|+..|.+....+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57788888888877778888775


No 259
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=24.87  E-value=35  Score=23.56  Aligned_cols=19  Identities=11%  Similarity=0.268  Sum_probs=11.0

Q ss_pred             ceeCCccccccCChhHHHH
Q psy4830         241 PFGCTSCHLTFTSKSQFAV  259 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~  259 (292)
                      -+.|+.||..+.+......
T Consensus        31 ~~~C~~CGe~~~~~e~~~~   49 (127)
T TIGR03830        31 GWYCPACGEELLDPEESKR   49 (127)
T ss_pred             eeECCCCCCEEEcHHHHHH
Confidence            3566667666666554443


No 260
>KOG4377|consensus
Probab=24.74  E-value=67  Score=27.40  Aligned_cols=104  Identities=26%  Similarity=0.415  Sum_probs=64.5

Q ss_pred             CCCccc--cccccccCCchHHHHHHhhhcCC------------CCccc--cccccccccchhhhhhhccccCC-------
Q psy4830         183 ERPFQC--AVCSKRFTQKSSLNTHKRVHTGE------------RPYAC--DICDKRFAVKSYVTSHRWSHVGD-------  239 (292)
Q Consensus       183 ~~~~~C--~~C~k~f~~~~~L~~H~~~h~~~------------~~~~C--~~C~k~f~~~~~L~~H~~~h~~~-------  239 (292)
                      ..-|.|  +.|+..+..+..+.+|..+|...            ..|.|  .+|.+   +-+....|...|+..       
T Consensus       269 rEhyhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrr  345 (480)
T KOG4377|consen  269 REHYHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRR  345 (480)
T ss_pred             chhhcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceec
Confidence            345677  56998888899999999887532            12556  46888   445566777666432       


Q ss_pred             cceeCCccccccCChhHHHHHhhhhcCCC----------------CC------------cccC--CCCCCccChHHHHhh
Q psy4830         240 KPFGCTSCHLTFTSKSQFAVHLRTHHTVG----------------AN------------HVCN--VCGRSFVRDSYLIRH  289 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~~~L~~H~~~hh~~~----------------~~------------~~C~--~C~~~f~~~~~l~~H  289 (292)
                      --|.|.-||=++..+  ...|...| ..+                -+            |-|.  -|+..|.+.+.|..|
T Consensus       346 thfhC~r~gCTdtfK--~~khk~yh-~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~sh  422 (480)
T KOG4377|consen  346 THFHCQRIGCTDTFK--DSKHKPYH-YKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASH  422 (480)
T ss_pred             ceeEEeccCCccccc--cccccccc-cCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhh
Confidence            147898877444433  34443322 110                01            2233  288889999999888


Q ss_pred             hcC
Q psy4830         290 QNK  292 (292)
Q Consensus       290 ~rk  292 (292)
                      .||
T Consensus       423 krk  425 (480)
T KOG4377|consen  423 KRK  425 (480)
T ss_pred             hhh
Confidence            775


No 261
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=24.66  E-value=52  Score=17.66  Aligned_cols=30  Identities=23%  Similarity=0.533  Sum_probs=13.7

Q ss_pred             CcceeCCccccccCChhHHHHHhhhhcCCCCCcccCCC
Q psy4830         239 DKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVC  276 (292)
Q Consensus       239 ~~~~~C~~C~~~f~~~~~L~~H~~~hh~~~~~~~C~~C  276 (292)
                      +.....+ |+-.|-..- |..-++..      ..||+|
T Consensus        14 ~~~~~l~-C~H~fh~~C-i~~~~~~~------~~CP~C   43 (44)
T PF13639_consen   14 EKVVKLP-CGHVFHRSC-IKEWLKRN------NSCPVC   43 (44)
T ss_dssp             SCEEEET-TSEEEEHHH-HHHHHHHS------SB-TTT
T ss_pred             CeEEEcc-CCCeeCHHH-HHHHHHhC------CcCCcc
Confidence            3344444 666555432 44444432      267666


No 262
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=24.52  E-value=27  Score=23.22  Aligned_cols=22  Identities=18%  Similarity=0.374  Sum_probs=16.4

Q ss_pred             cceeCCccccccCChhHHHHHh
Q psy4830         240 KPFGCTSCHLTFTSKSQFAVHL  261 (292)
Q Consensus       240 ~~~~C~~C~~~f~~~~~L~~H~  261 (292)
                      ..+.|-.|.+-|.+...|..|.
T Consensus        54 GqhYCieCaryf~t~~aL~~Hk   75 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHK   75 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHh
Confidence            3467888888888888887774


No 263
>PRK04351 hypothetical protein; Provisional
Probab=24.44  E-value=30  Score=25.02  Aligned_cols=13  Identities=15%  Similarity=0.406  Sum_probs=6.7

Q ss_pred             CCcccCCCCCCcc
Q psy4830         269 ANHVCNVCGRSFV  281 (292)
Q Consensus       269 ~~~~C~~C~~~f~  281 (292)
                      ..|.|..|+-.+.
T Consensus       131 ~~yrCg~C~g~L~  143 (149)
T PRK04351        131 KRYRCGKCRGKLK  143 (149)
T ss_pred             CcEEeCCCCcEee
Confidence            3455655554443


No 264
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=24.32  E-value=24  Score=22.48  Aligned_cols=9  Identities=33%  Similarity=1.224  Sum_probs=2.3

Q ss_pred             CCccccccc
Q psy4830         184 RPFQCAVCS  192 (292)
Q Consensus       184 ~~~~C~~C~  192 (292)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            446666665


No 265
>PTZ00448 hypothetical protein; Provisional
Probab=24.17  E-value=50  Score=27.79  Aligned_cols=24  Identities=21%  Similarity=0.598  Sum_probs=20.0

Q ss_pred             ceeCCccccccCChhHHHHHhhhh
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRTH  264 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~h  264 (292)
                      .|.|..|+..|.+....+.|+++-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            578999999998888888888763


No 266
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.71  E-value=35  Score=23.80  Aligned_cols=14  Identities=14%  Similarity=0.330  Sum_probs=9.1

Q ss_pred             CCccccccccccCCc
Q psy4830         184 RPFQCAVCSKRFTQK  198 (292)
Q Consensus       184 ~~~~C~~C~k~f~~~  198 (292)
                      ..+.| .||..|...
T Consensus        69 ~~~~C-~Cg~~~~~~   82 (124)
T PRK00762         69 VEIEC-ECGYEGVVD   82 (124)
T ss_pred             eeEEe-eCcCccccc
Confidence            34678 888776544


No 267
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=23.69  E-value=59  Score=17.62  Aligned_cols=8  Identities=38%  Similarity=1.049  Sum_probs=3.4

Q ss_pred             cccccccc
Q psy4830         215 ACDICDKR  222 (292)
Q Consensus       215 ~C~~C~k~  222 (292)
                      .|.+|++.
T Consensus        13 ~C~~C~~~   20 (49)
T smart00109       13 KCCVCRKS   20 (49)
T ss_pred             Cccccccc
Confidence            34444443


No 268
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=23.27  E-value=42  Score=18.32  Aligned_cols=7  Identities=29%  Similarity=0.785  Sum_probs=3.6

Q ss_pred             ccccccc
Q psy4830         214 YACDICD  220 (292)
Q Consensus       214 ~~C~~C~  220 (292)
                      ..|+.||
T Consensus         3 ~~Cp~Cg    9 (47)
T PF14690_consen    3 PRCPHCG    9 (47)
T ss_pred             ccCCCcC
Confidence            4455555


No 269
>PHA02998 RNA polymerase subunit; Provisional
Probab=23.13  E-value=39  Score=25.06  Aligned_cols=10  Identities=30%  Similarity=0.962  Sum_probs=4.7

Q ss_pred             eeCCcccccc
Q psy4830         242 FGCTSCHLTF  251 (292)
Q Consensus       242 ~~C~~C~~~f  251 (292)
                      |.|..||..|
T Consensus       172 YkC~~CG~~w  181 (195)
T PHA02998        172 HACRDCKKHF  181 (195)
T ss_pred             EEcCCCCCcc
Confidence            4444444444


No 270
>PF12773 DZR:  Double zinc ribbon
Probab=22.94  E-value=49  Score=18.41  Aligned_cols=10  Identities=20%  Similarity=0.647  Sum_probs=5.4

Q ss_pred             cccccccccc
Q psy4830         215 ACDICDKRFA  224 (292)
Q Consensus       215 ~C~~C~k~f~  224 (292)
                      .|+.||....
T Consensus        14 fC~~CG~~l~   23 (50)
T PF12773_consen   14 FCPHCGTPLP   23 (50)
T ss_pred             CChhhcCChh
Confidence            3666665544


No 271
>KOG3362|consensus
Probab=22.16  E-value=28  Score=24.66  Aligned_cols=23  Identities=22%  Similarity=0.525  Sum_probs=15.9

Q ss_pred             ceeCCccccccCChhHHHHHhhh
Q psy4830         241 PFGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       241 ~~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      +|.|..||-.+-+..-|..|..+
T Consensus       129 ~ysC~~CG~kyCsv~C~~~HneT  151 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNET  151 (156)
T ss_pred             hhHHHhcCCceeechhhhhcccc
Confidence            46777777777777777776543


No 272
>KOG3002|consensus
Probab=21.89  E-value=77  Score=26.06  Aligned_cols=81  Identities=16%  Similarity=0.202  Sum_probs=53.7

Q ss_pred             CCCccccccccccCCchHHHHHHhhhcCCCCcccc----ccccccccchhhhhhhccccCCcceeCCccc---cccCChh
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACD----ICDKRFAVKSYVTSHRWSHVGDKPFGCTSCH---LTFTSKS  255 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~----~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~---~~f~~~~  255 (292)
                      +....|+.|...+....  .++|..-.....+.|+    -|.++|..... ..|.+.-.. .||.||.=+   +--....
T Consensus        78 ~~~~~CP~Cr~~~g~~R--~~amEkV~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p~~~C~~~G~~~  153 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGNIR--CRAMEKVAEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVPGAECKYTGSYK  153 (299)
T ss_pred             hhcccCCccccccccHH--HHHHHHHHHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCCcccCCccCcHH
Confidence            34578999998888553  3444443445567787    49999998777 677766555 677776531   2234456


Q ss_pred             HHHHHhhhhcCC
Q psy4830         256 QFAVHLRTHHTV  267 (292)
Q Consensus       256 ~L~~H~~~hh~~  267 (292)
                      .|..|.+.-|..
T Consensus       154 ~l~~H~~~~hk~  165 (299)
T KOG3002|consen  154 DLYAHLNDTHKS  165 (299)
T ss_pred             HHHHHHHhhChh
Confidence            888898776654


No 273
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=21.68  E-value=1.3e+02  Score=15.37  Aligned_cols=9  Identities=22%  Similarity=0.899  Sum_probs=5.3

Q ss_pred             cccCCCCCC
Q psy4830         271 HVCNVCGRS  279 (292)
Q Consensus       271 ~~C~~C~~~  279 (292)
                      ..|++|...
T Consensus        36 ~~Cp~C~~~   44 (45)
T cd00162          36 NTCPLCRTP   44 (45)
T ss_pred             CCCCCCCCc
Confidence            457777653


No 274
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.50  E-value=83  Score=29.38  Aligned_cols=10  Identities=30%  Similarity=0.929  Sum_probs=5.4

Q ss_pred             CcccCCCCCC
Q psy4830         270 NHVCNVCGRS  279 (292)
Q Consensus       270 ~~~C~~C~~~  279 (292)
                      +..|+.||..
T Consensus       421 ~~~Cp~Cg~~  430 (679)
T PRK05580        421 PKACPECGST  430 (679)
T ss_pred             CCCCCCCcCC
Confidence            4456666543


No 275
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.37  E-value=48  Score=19.69  Aligned_cols=12  Identities=25%  Similarity=0.733  Sum_probs=7.6

Q ss_pred             CcccCCCCCCcc
Q psy4830         270 NHVCNVCGRSFV  281 (292)
Q Consensus       270 ~~~C~~C~~~f~  281 (292)
                      .-.|++|+..|.
T Consensus        48 ev~CPYC~t~y~   59 (62)
T COG4391          48 EVVCPYCSTRYR   59 (62)
T ss_pred             cEecCccccEEE
Confidence            445777776664


No 276
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=21.22  E-value=43  Score=22.90  Aligned_cols=10  Identities=40%  Similarity=1.142  Sum_probs=5.4

Q ss_pred             cccccccccc
Q psy4830         214 YACDICDKRF  223 (292)
Q Consensus       214 ~~C~~C~k~f  223 (292)
                      |.|..||.++
T Consensus       101 y~C~~Cg~~w  110 (113)
T COG1594         101 YKCTRCGYRW  110 (113)
T ss_pred             EEecccCCEe
Confidence            5555555544


No 277
>PRK12860 transcriptional activator FlhC; Provisional
Probab=21.03  E-value=58  Score=24.62  Aligned_cols=31  Identities=16%  Similarity=0.156  Sum_probs=14.4

Q ss_pred             cccCCchHHHHHHhhhcCCCCccccccccccc
Q psy4830         193 KRFTQKSSLNTHKRVHTGERPYACDICDKRFA  224 (292)
Q Consensus       193 k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~  224 (292)
                      -.|.....|.+.+..- .-..-.|..||-.|.
T Consensus       115 Ls~tRAw~LvRf~~s~-~L~l~~C~~Cgg~fv  145 (189)
T PRK12860        115 LDLTRAWTLVRFFDAG-MLQLARCCRCGGKFV  145 (189)
T ss_pred             ecHHHHHHHHHHhcCC-CeeeccCCCCCCCee
Confidence            3444555555554422 112344666665554


No 278
>PRK01343 zinc-binding protein; Provisional
Probab=21.01  E-value=57  Score=19.15  Aligned_cols=11  Identities=27%  Similarity=0.785  Sum_probs=7.1

Q ss_pred             cccCCCCCCcc
Q psy4830         271 HVCNVCGRSFV  281 (292)
Q Consensus       271 ~~C~~C~~~f~  281 (292)
                      ..|++|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            45777777654


No 279
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=20.99  E-value=42  Score=20.49  Aligned_cols=10  Identities=40%  Similarity=0.664  Sum_probs=4.6

Q ss_pred             cceeCCccccc
Q psy4830         240 KPFGCTSCHLT  250 (292)
Q Consensus       240 ~~~~C~~C~~~  250 (292)
                      +.-+| +||++
T Consensus        19 kTkkC-~CG~~   28 (68)
T PF09082_consen   19 KTKKC-VCGKT   28 (68)
T ss_dssp             SEEEE-TTTEE
T ss_pred             ceeEe-cCCCe
Confidence            33445 55544


No 280
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=20.96  E-value=23  Score=19.26  Aligned_cols=11  Identities=27%  Similarity=0.848  Sum_probs=3.0

Q ss_pred             cCCCCCCccCh
Q psy4830         273 CNVCGRSFVRD  283 (292)
Q Consensus       273 C~~C~~~f~~~  283 (292)
                      |++|++.|...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            45555555443


No 281
>PLN03239 histone acetyltransferase; Provisional
Probab=20.71  E-value=47  Score=27.75  Aligned_cols=23  Identities=22%  Similarity=0.235  Sum_probs=15.1

Q ss_pred             CcceeCCccccccCChhHHHHHh
Q psy4830         239 DKPFGCTSCHLTFTSKSQFAVHL  261 (292)
Q Consensus       239 ~~~~~C~~C~~~f~~~~~L~~H~  261 (292)
                      +..|.|+.|-+-|.+...|.+|+
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~  126 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQ  126 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHH
Confidence            34567777777666666666664


No 282
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=20.70  E-value=42  Score=19.54  Aligned_cols=11  Identities=27%  Similarity=0.760  Sum_probs=3.4

Q ss_pred             cceeCCccccc
Q psy4830         240 KPFGCTSCHLT  250 (292)
Q Consensus       240 ~~~~C~~C~~~  250 (292)
                      +.|.|++||.+
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            34778888754


No 283
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=20.30  E-value=48  Score=17.29  Aligned_cols=6  Identities=33%  Similarity=1.420  Sum_probs=2.6

Q ss_pred             cccccc
Q psy4830         216 CDICDK  221 (292)
Q Consensus       216 C~~C~k  221 (292)
                      |++|+.
T Consensus        11 C~~C~~   16 (36)
T PF11781_consen   11 CPVCGS   16 (36)
T ss_pred             CCCCCC
Confidence            444443


No 284
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=20.29  E-value=77  Score=17.79  Aligned_cols=10  Identities=50%  Similarity=1.145  Sum_probs=4.1

Q ss_pred             Cccccccccc
Q psy4830         213 PYACDICDKR  222 (292)
Q Consensus       213 ~~~C~~C~k~  222 (292)
                      |-.|.+|++.
T Consensus        11 ~~~C~~C~~~   20 (53)
T PF00130_consen   11 PTYCDVCGKF   20 (53)
T ss_dssp             TEB-TTSSSB
T ss_pred             CCCCcccCcc
Confidence            3445555443


No 285
>KOG4118|consensus
Probab=20.17  E-value=83  Score=18.90  Aligned_cols=26  Identities=19%  Similarity=0.526  Sum_probs=15.4

Q ss_pred             cccccchhhcCChhHHHHHHhhcCCC
Q psy4830          38 FQCVVCLKRFSQKSALNTHKRMHIPY   63 (292)
Q Consensus        38 ~~C~~C~~~f~~~~~l~~H~~~h~~~   63 (292)
                      |+|.+|-........+..|...-++.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk   64 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPK   64 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCC
Confidence            56666666666666666665544443


Done!