BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy4833
         (141 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ROV|A Chain A, Lipoxygenase-3 Treated With Cumene Hydroperoxide
          Length = 857

 Score = 30.0 bits (66), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 85  PPVKMQLSDAS-----DIFREVASGVTPS-------YAPKGNSDLQHYGPRSSNKTVRHC 132
           PP  +Q+S ++     +  RE+ +GV P+       + P+   D Q YG  +S  T  H 
Sbjct: 347 PPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLKDFPPRSKLDSQVYGDHTSQITKEHL 406

Query: 133 ESSL 136
           E +L
Sbjct: 407 EPNL 410


>pdb|1IK3|A Chain A, Lipoxygenase-3 (Soybean) Complex With 13(S)-Hydroperoxy-
           9(Z),11(E)-Octadecadienoic Acid
 pdb|1HU9|A Chain A, Lipoxygenase-3 (Soybean) Complex With 4-Hydroperoxy-2-
           Methoxy-Phenol
 pdb|1JNQ|A Chain A, Lipoxygenase-3 (Soybean) Complex With Epigallocathechin
           (Egc)
 pdb|1N8Q|A Chain A, Lipoxygenase In Complex With Protocatechuic Acid
 pdb|1NO3|A Chain A, Refined Structure Of Soybean Lipoxygenase-3 With
           4-nitrocatechol At 2.15 Angstrom Resolution
 pdb|1RRH|A Chain A, Soybean Lipoxygenase (Lox-3) At Ambient Temperatures At
           2.0 A Resolution
 pdb|1RRL|A Chain A, Soybean Lipoxygenase (Lox-3) At 93k At 2.0 A Resolution
 pdb|1RRL|B Chain B, Soybean Lipoxygenase (Lox-3) At 93k At 2.0 A Resolution
 pdb|1LNH|A Chain A, Lipoxygenase-3(Soybean) Non-Heme Fe(Ii) Metalloprotein
          Length = 857

 Score = 30.0 bits (66), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 85  PPVKMQLSDAS-----DIFREVASGVTPS-------YAPKGNSDLQHYGPRSSNKTVRHC 132
           PP  +Q+S ++     +  RE+ +GV P+       + P+   D Q YG  +S  T  H 
Sbjct: 347 PPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLKDFPPRSKLDSQVYGDHTSQITKEHL 406

Query: 133 ESSL 136
           E +L
Sbjct: 407 EPNL 410


>pdb|3IZS|R Chain R, Localization Of The Large Subunit Ribosomal Proteins Into
           A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae
           Translating 80s Ribosome
 pdb|3O58|R Chain R, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit
           Of The First 80s In The Asymmetric Unit.
 pdb|3O5H|R Chain R, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit
           Of The Second 80s In The Asymmetric Unit.
 pdb|3U5E|Q Chain Q, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 60s
           Subunit, Ribosome A
 pdb|3U5I|Q Chain Q, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 60s
           Subunit, Ribosome B
 pdb|4B6A|Q Chain Q, Cryo-Em Structure Of The 60s Ribosomal Subunit In Complex
           With Arx1 And Rei1
          Length = 186

 Score = 27.3 bits (59), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 110 APKGNSDLQHYGPRSSNKTVRH 131
           APKG + L   GPR+S + VRH
Sbjct: 131 APKGQNTLILRGPRNSREAVRH 152


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.396 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,474,091
Number of Sequences: 62578
Number of extensions: 113002
Number of successful extensions: 210
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 3
length of query: 141
length of database: 14,973,337
effective HSP length: 89
effective length of query: 52
effective length of database: 9,403,895
effective search space: 489002540
effective search space used: 489002540
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)