Query         psy4842
Match_columns 95
No_of_seqs    157 out of 1047
Neff          9.5 
Searched_HMMs 46136
Date          Fri Aug 16 19:08:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4842.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4842hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00860 LIC Cation transport 100.0 2.8E-31 6.1E-36  183.6   7.7   94    1-95     82-178 (459)
  2 KOG3643|consensus              100.0 9.7E-31 2.1E-35  176.2   6.1   95    1-95     86-182 (459)
  3 PF02931 Neur_chan_LBD:  Neurot 100.0 3.1E-29 6.6E-34  158.7   8.1   93    1-95     53-148 (217)
  4 KOG3645|consensus              100.0 1.5E-29 3.3E-34  174.6   6.7   92    1-95     82-176 (449)
  5 KOG3646|consensus              100.0 2.7E-29 5.8E-34  170.0   4.3   92    1-95     79-173 (486)
  6 KOG3644|consensus               99.9 4.4E-26 9.5E-31  157.0   8.6   95    1-95     93-192 (457)
  7 KOG3642|consensus               99.9 1.1E-24 2.3E-29  147.8   3.9   95    1-95     95-190 (466)
  8 PF11211 DUF2997:  Protein of u  70.7     3.8 8.3E-05   20.0   1.6   22   53-74      3-24  (48)
  9 KOG1344|consensus               58.0      11 0.00023   25.1   2.3   34   27-62    245-278 (324)
 10 PRK14751 tetracycline resistan  54.8     9.3  0.0002   16.1   1.1   18   74-91      5-22  (28)
 11 PF11455 DUF3018:  Protein  of   47.9       7 0.00015   20.4   0.2    9   26-34     20-28  (65)
 12 PF14494 DUF4436:  Domain of un  45.6      18 0.00038   24.1   1.9   21   73-93     95-116 (256)
 13 PF00928 Adap_comp_sub:  Adapto  43.7      65  0.0014   20.9   4.3   34   53-91     25-58  (262)
 14 PF14208 DUF4320:  Domain of un  38.4      29 0.00064   20.2   1.9   35   57-91     70-105 (116)
 15 PF08076 TetM_leader:  Tetracyc  37.0      18 0.00039   15.4   0.6   19   74-92      5-23  (28)
 16 PF08910 Aida_N:  Aida N-termin  31.6      18  0.0004   20.8   0.3    8   78-85     99-106 (106)
 17 PF13356 DUF4102:  Domain of un  31.4      91   0.002   16.7   3.3   18   50-67     24-41  (89)
 18 PRK04257 hypothetical protein;  28.2 1.1E+02  0.0023   16.5   3.6   15   52-66     60-76  (78)
 19 PF06200 tify:  tify domain;  I  26.7      77  0.0017   14.4   2.0   15   51-65      6-20  (36)
 20 KOG1379|consensus               26.3 1.1E+02  0.0024   21.3   3.3   30   53-82    193-223 (330)
 21 PF13186 SPASM:  Iron-sulfur cl  25.6      62  0.0014   15.6   1.7   12   53-64      8-19  (64)
 22 PF13103 TonB_2:  TonB C termin  25.0 1.2E+02  0.0025   15.8   2.8   14   49-62     28-41  (85)
 23 PF06554 Olfactory_mark:  Olfac  21.3      17 0.00037   21.8  -1.1   10   25-34     72-81  (151)
 24 KOG2139|consensus               21.2 3.2E+02   0.007   19.7   4.7   18   52-69    243-260 (445)
 25 PF08758 Cadherin_pro:  Cadheri  20.5 1.2E+02  0.0025   16.8   2.2   19   51-69     46-64  (90)
 26 PF15016 DUF4520:  Domain of un  20.3 1.7E+02  0.0037   16.1   4.7   20   54-73     19-40  (85)
 27 PF15008 DUF4518:  Domain of un  20.3 1.3E+02  0.0027   20.3   2.6   42   51-92    213-254 (262)

No 1  
>TIGR00860 LIC Cation transporter family protein. selective while glycine receptors are anion selective).
Probab=99.97  E-value=2.8e-31  Score=183.62  Aligned_cols=94  Identities=40%  Similarity=0.847  Sum_probs=84.7

Q ss_pred             CceEEeCCCcccCCCCccccccc---ccCceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecccC
Q psy4842           1 MRYRWVDPRLAHNAKENYLGEIN---LRDRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLMNL   77 (95)
Q Consensus         1 l~~~W~D~rL~w~~~~~~~~~~~---~~~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~d~   77 (95)
                      ++|+|+|+||+|||+ +++++..   +.++||+||++++|++++..+.....+..+++++||+|.|.++++.++.|+||+
T Consensus        82 l~~~W~D~rL~Wnp~-~y~~i~~i~~~~~~IW~PDi~l~N~~~~~~~~~~~~~~~v~~~~~G~V~~~~~~~~~~~C~~d~  160 (459)
T TIGR00860        82 LRQEWTDERLQWNPE-EYPGVTLVRTPDDSIWVPDIFFYNEKDARFHGITMTNVLVRIHPNGSVLYSPRITLTLACPMDL  160 (459)
T ss_pred             eeeEEeCCccCCCCc-cCCCceeccccccccccCcEEeecCccccccccccCceEEEEcCCCcEEEecCceEEeccccee
Confidence            478999999999997 7777654   478999999999999998777666667778888899999999999999999999


Q ss_pred             cccCCCCceeeeEEeecC
Q psy4842          78 KKFPFDEQECPLVLESCK   95 (95)
Q Consensus        78 ~~fPfD~q~C~l~~~S~~   95 (95)
                      ++||||+|+|+|+||||+
T Consensus       161 ~~FPfD~Q~C~l~fgSw~  178 (459)
T TIGR00860       161 RNFPFDVQNCSLKFESWG  178 (459)
T ss_pred             ccCCCCCccccEEEhhhc
Confidence            999999999999999995


No 2  
>KOG3643|consensus
Probab=99.97  E-value=9.7e-31  Score=176.21  Aligned_cols=95  Identities=40%  Similarity=0.738  Sum_probs=86.8

Q ss_pred             CceEEeCCCcccCCC--CcccccccccCceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecccCc
Q psy4842           1 MRYRWVDPRLAHNAK--ENYLGEINLRDRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLMNLK   78 (95)
Q Consensus         1 l~~~W~D~rL~w~~~--~~~~~~~~~~~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~d~~   78 (95)
                      ++|.|+||||+|+..  .+........++||+||.++.|++++.+|..+..|.++++++||+|.+..|++.++.|+|||+
T Consensus        86 ~rq~W~D~RLay~~~~~~slTl~~~~~~~LWvPDTff~N~KkSf~H~~T~~N~~lRl~~dGtVlys~RlT~Ta~C~MDL~  165 (459)
T KOG3643|consen   86 LRQTWRDPRLAYSSKNIDSLTLDVRYVDKLWVPDTFFPNSKKSFFHDVTTHNSLLRLHPDGTVLYSIRLTVTAACPMDLK  165 (459)
T ss_pred             hhhhhcCcccccCCCCCceEEEchhhhhccccCceecccCcccccceeeecceEEEEcCCCeEEEEEEEEEEEecccccc
Confidence            578999999999932  344555566899999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCceeeeEEeecC
Q psy4842          79 KFPFDEQECPLVLESCK   95 (95)
Q Consensus        79 ~fPfD~q~C~l~~~S~~   95 (95)
                      +||+|+|+|++.++||.
T Consensus       166 ~fPmD~Q~C~LeiESYG  182 (459)
T KOG3643|consen  166 LFPMDSQNCKLEIESYG  182 (459)
T ss_pred             cCCCcccceeEEEEecc
Confidence            99999999999999983


No 3  
>PF02931 Neur_chan_LBD:  Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This entry presents the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure. ; GO: 0005230 extracellular ligand-gated ion channel activity, 0006810 transport, 0016020 membrane; PDB: 1LXH_B 1ABT_B 1TOS_A 1LXG_B 1IDG_B 1TOR_A 1IDH_B 3IGQ_B 3TLU_B 3UU5_A ....
Probab=99.96  E-value=3.1e-29  Score=158.69  Aligned_cols=93  Identities=37%  Similarity=0.711  Sum_probs=73.3

Q ss_pred             CceEEeCCCcccCCCCccccccc---ccCceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecccC
Q psy4842           1 MRYRWVDPRLAHNAKENYLGEIN---LRDRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLMNL   77 (95)
Q Consensus         1 l~~~W~D~rL~w~~~~~~~~~~~---~~~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~d~   77 (95)
                      +.+.|.|+||+|+++ +++++..   ..+.||+|++++.|...... ........+.|+++|+|.+..++.+++.|+|++
T Consensus        53 ~~~~W~D~rL~w~~~-~~~~i~~~~v~~~~iW~P~l~~~n~~~~~~-~~~~~~~~~~v~~~G~V~~~~~~~~~~~C~~d~  130 (217)
T PF02931_consen   53 IRLSWKDPRLKWNPS-DYGGIESIRVPSSQIWTPDLYFYNSVSGSF-EITEPNSNVRVYSDGTVRYSPRFTLTFSCPMDL  130 (217)
T ss_dssp             EEEEEEECCGE-STT-TTTTESEEEEEGGGS----EEETTBSSSEE-ECS-SSEEEEEETTSEEEEEEEEEEEEEECETT
T ss_pred             hceeccccccccChh-hccCcccccccccceEecccccccccccce-ecccccccccccccchheeeecccccccccccc
Confidence            368999999999997 6766654   46899999999999554433 233345668899999999999999999999999


Q ss_pred             cccCCCCceeeeEEeecC
Q psy4842          78 KKFPFDEQECPLVLESCK   95 (95)
Q Consensus        78 ~~fPfD~q~C~l~~~S~~   95 (95)
                      .+||||+|.|.|.|+||.
T Consensus       131 ~~fPfD~q~C~i~~~s~~  148 (217)
T PF02931_consen  131 RDFPFDSQNCSIKFGSWS  148 (217)
T ss_dssp             TSSSSSEEEEEEEEEESS
T ss_pred             cccccccceeEEEEeccc
Confidence            999999999999999984


No 4  
>KOG3645|consensus
Probab=99.96  E-value=1.5e-29  Score=174.61  Aligned_cols=92  Identities=25%  Similarity=0.536  Sum_probs=81.1

Q ss_pred             CceEEeCCCcccCCCCcccccccc---cCceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecccC
Q psy4842           1 MRYRWVDPRLAHNAKENYLGEINL---RDRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLMNL   77 (95)
Q Consensus         1 l~~~W~D~rL~w~~~~~~~~~~~~---~~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~d~   77 (95)
                      +.++|+|+||+|||+ ++++++..   .++||+||++++|++.+........+  +.+.++|+|.+.+++..++.|++|+
T Consensus        82 l~~~W~D~~L~Wnp~-~~~~I~~i~vp~~~IW~Pdi~l~N~~~~~~~~~~~~~--v~v~~~G~V~~~~p~i~~s~C~idv  158 (449)
T KOG3645|consen   82 LKQSWTDERLSWDPS-DYGGITKIRVPSSKIWLPDIVLYNNADGDFEVEDLTN--VLVTYTGEVLWYPPAIYKSSCPIDV  158 (449)
T ss_pred             eeeEEeccCcccChH-HcCCceEEEecHHHcCcCcEEEEecccccccccccce--EEEEECCEEEEEcceEEEeeccccc
Confidence            357899999999997 78877664   79999999999998777665555544  7789999999999999999999999


Q ss_pred             cccCCCCceeeeEEeecC
Q psy4842          78 KKFPFDEQECPLVLESCK   95 (95)
Q Consensus        78 ~~fPfD~q~C~l~~~S~~   95 (95)
                      ++||||.|+|.++||||+
T Consensus       159 ~~FPfD~Q~C~i~f~sw~  176 (449)
T KOG3645|consen  159 TYFPFDVQNCSIKFGSWT  176 (449)
T ss_pred             ccCCCcceeEeEEEeccc
Confidence            999999999999999996


No 5  
>KOG3646|consensus
Probab=99.95  E-value=2.7e-29  Score=169.98  Aligned_cols=92  Identities=25%  Similarity=0.528  Sum_probs=83.8

Q ss_pred             CceEEeCCCcccCCCCcccccccc---cCceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecccC
Q psy4842           1 MRYRWVDPRLAHNAKENYLGEINL---RDRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLMNL   77 (95)
Q Consensus         1 l~~~W~D~rL~w~~~~~~~~~~~~---~~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~d~   77 (95)
                      ++++|+|-+|+|||+ +|+|+...   .++||+||+.+||+++..+.....++  +.++++|.|.|.++-+.+++|.+|.
T Consensus        79 l~y~W~D~~LrW~ps-eygnI~dvR~p~~~iWkPDVLLYNSade~FDsTy~tN--~Vv~~tG~v~~vPPGIfk~sCkiDI  155 (486)
T KOG3646|consen   79 LQYQWNDYKLRWDPS-EYGNITDIRFPGGNIWKPDVLLYNSADEQFDSTYKTN--YVVYSTGSVLWVPPGIFKSSCKIDI  155 (486)
T ss_pred             hheeehhhhhccCHH-HhCCceeeccCCccccCCceeccccccccCCCcceee--EEEccCCeeeecCCceeeeeeEEEE
Confidence            467999999999997 88887765   58999999999999999887766666  5589999999999999999999999


Q ss_pred             cccCCCCceeeeEEeecC
Q psy4842          78 KKFPFDEQECPLVLESCK   95 (95)
Q Consensus        78 ~~fPfD~q~C~l~~~S~~   95 (95)
                      +.||||+|.|.++|||||
T Consensus       156 twFPFD~Q~C~mKFGSWT  173 (486)
T KOG3646|consen  156 TWFPFDDQVCYLKFGSWT  173 (486)
T ss_pred             EEecccccEEEEEeeeEE
Confidence            999999999999999997


No 6  
>KOG3644|consensus
Probab=99.93  E-value=4.4e-26  Score=156.96  Aligned_cols=95  Identities=44%  Similarity=0.802  Sum_probs=82.8

Q ss_pred             CceEEeCCCcccC-CC-Ccccccc-ccc--CceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecc
Q psy4842           1 MRYRWVDPRLAHN-AK-ENYLGEI-NLR--DRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLM   75 (95)
Q Consensus         1 l~~~W~D~rL~w~-~~-~~~~~~~-~~~--~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~   75 (95)
                      ++++|.||||+++ .+ +...... ...  .+||.||++|.|++.+.+|.....|..++|++||+|.+..|+.++.+|+|
T Consensus        93 ~~~~W~DpRL~~~~~~~~~~~~~~~~l~~~~~iW~Pd~~F~NsK~a~~H~~~~~N~ll~I~pnGtV~~~~Ri~l~~~C~m  172 (457)
T KOG3644|consen   93 FRERWQDPRLAYNALKFDHILPCKLNLSLKQKIWTPDTFFANSKSAEFHKSTKPNVLLMIFPNGTVWYSYRISLTLPCNM  172 (457)
T ss_pred             eeeeEeCccccccccCcccccccccccccCCceecCceeeecccceeeecCCCCceEEEEecCCeEEEEEEEEEeeceee
Confidence            5789999999988 44 2221111 123  56999999999999999999999999999999999999999999999999


Q ss_pred             cCcccCCCCceeeeEEeecC
Q psy4842          76 NLKKFPFDEQECPLVLESCK   95 (95)
Q Consensus        76 d~~~fPfD~q~C~l~~~S~~   95 (95)
                      |+.+||+|+|+|.+.++||.
T Consensus       173 ~L~~fP~D~Q~C~l~~eSy~  192 (457)
T KOG3644|consen  173 DLSKFPMDSQECKLQLESYA  192 (457)
T ss_pred             ehhhCCCccceeeEEEEEec
Confidence            99999999999999999984


No 7  
>KOG3642|consensus
Probab=99.90  E-value=1.1e-24  Score=147.75  Aligned_cols=95  Identities=33%  Similarity=0.608  Sum_probs=84.9

Q ss_pred             CceEEeCCCcccCCC-CcccccccccCceeecceEEeecccceeeccCcceeEEEEcCCCeEEEeecceEEEEecccCcc
Q psy4842           1 MRYRWVDPRLAHNAK-ENYLGEINLRDRVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVLYSTRLKVTLLCLMNLKK   79 (95)
Q Consensus         1 l~~~W~D~rL~w~~~-~~~~~~~~~~~~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~~~~~~~~~~~C~~d~~~   79 (95)
                      ++|.|.|+||+++.. +..........+||+||.++.|++++..|.....+.+++|..||+|.|..++++.+.|+|++.+
T Consensus        95 FrQ~W~D~RL~f~~~~~~L~Ln~~m~~kiW~PDTfF~NgkkS~~H~iT~pN~l~Ri~~dG~vlyt~RlTi~A~C~m~l~~  174 (466)
T KOG3642|consen   95 FRQTWVDDRLKFNGPQEALPLNSLMLSKIWIPDTFFRNGKKSYAHNITTPNKLVRIYIDGTVLYTMRLTIPAECPMHLAR  174 (466)
T ss_pred             EEEeehhhhhcccCcchhhccchhhhcCcccCCcccccCcccceeeccCCCceEEEeECCcceEEEEEeecccCcchhhc
Confidence            479999999999965 2222223347999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCceeeeEEeecC
Q psy4842          80 FPFDEQECPLVLESCK   95 (95)
Q Consensus        80 fPfD~q~C~l~~~S~~   95 (95)
                      ||+|.|+|.++||||.
T Consensus       175 fPMD~haCpl~fgSy~  190 (466)
T KOG3642|consen  175 FPMDSHACPLKFGSYA  190 (466)
T ss_pred             CCCCcccCcceecccC
Confidence            9999999999999984


No 8  
>PF11211 DUF2997:  Protein of unknown function (DUF2997);  InterPro: IPR021375  This family of proteins has no known function. 
Probab=70.70  E-value=3.8  Score=20.01  Aligned_cols=22  Identities=27%  Similarity=0.333  Sum_probs=17.3

Q ss_pred             EEEcCCCeEEEeecceEEEEec
Q psy4842          53 ISVQPDGTVLYSTRLKVTLLCL   74 (95)
Q Consensus        53 ~~i~~~G~v~~~~~~~~~~~C~   74 (95)
                      ++|++||.|.-...-..-.+|.
T Consensus         3 ~~I~~dG~V~~~v~G~~G~~C~   24 (48)
T PF11211_consen    3 FTIYPDGRVEEEVEGFKGSSCL   24 (48)
T ss_pred             EEECCCcEEEEEEEeccChhHH
Confidence            5789999999887766666663


No 9  
>KOG1344|consensus
Probab=57.97  E-value=11  Score=25.14  Aligned_cols=34  Identities=15%  Similarity=0.402  Sum_probs=22.0

Q ss_pred             ceeecceEEeecccceeeccCcceeEEEEcCCCeEE
Q psy4842          27 RVWTPHLYLVNEHDSRIMGSGRQDILISVQPDGTVL   62 (95)
Q Consensus        27 ~iW~P~i~~~n~~~~~~~~~~~~~~~~~i~~~G~v~   62 (95)
                      .=..||+++||+...-..+..-.+  +.|+++|-+.
T Consensus       245 ~ef~Pd~VvYNAGTDiLeGDpLG~--L~ISp~Gi~~  278 (324)
T KOG1344|consen  245 AEFRPDMVVYNAGTDILEGDPLGN--LAISPEGIIE  278 (324)
T ss_pred             HhhCCcEEEEeCCCccccCCCCCC--eeecccccch
Confidence            446799999998665433333322  5678888654


No 10 
>PRK14751 tetracycline resistance determinant leader peptide; Provisional
Probab=54.85  E-value=9.3  Score=16.12  Aligned_cols=18  Identities=22%  Similarity=0.156  Sum_probs=14.0

Q ss_pred             cccCcccCCCCceeeeEE
Q psy4842          74 LMNLKKFPFDEQECPLVL   91 (95)
Q Consensus        74 ~~d~~~fPfD~q~C~l~~   91 (95)
                      +|-...||-|..-|.-.|
T Consensus         5 ~mi~h~~psdksi~hwdf   22 (28)
T PRK14751          5 PMVMHKNPSDKSIYHWDF   22 (28)
T ss_pred             eeeeecCCCcCceeeeee
Confidence            466778999988887665


No 11 
>PF11455 DUF3018:  Protein  of unknown function (DUF3018);  InterPro: IPR021558  This is a bacterial family of uncharacterised proteins. 
Probab=47.91  E-value=7  Score=20.45  Aligned_cols=9  Identities=22%  Similarity=0.770  Sum_probs=7.1

Q ss_pred             CceeecceE
Q psy4842          26 DRVWTPHLY   34 (95)
Q Consensus        26 ~~iW~P~i~   34 (95)
                      -.||+||+-
T Consensus        20 VqiWVPDtr   28 (65)
T PF11455_consen   20 VQIWVPDTR   28 (65)
T ss_pred             ceeeCCCCC
Confidence            479999983


No 12 
>PF14494 DUF4436:  Domain of unknown function (DUF4436)
Probab=45.63  E-value=18  Score=24.11  Aligned_cols=21  Identities=14%  Similarity=0.411  Sum_probs=15.8

Q ss_pred             ecccCcccCCCCceee-eEEee
Q psy4842          73 CLMNLKKFPFDEQECP-LVLES   93 (95)
Q Consensus        73 C~~d~~~fPfD~q~C~-l~~~S   93 (95)
                      -.-+..+||||+..=. +.+..
T Consensus        95 ~~G~~~~yPFD~Y~~~~i~v~~  116 (256)
T PF14494_consen   95 ADGDINNYPFDRYRTDPIRVSA  116 (256)
T ss_pred             ecCCccCCCCcccccceEEEEE
Confidence            3467889999998877 56544


No 13 
>PF00928 Adap_comp_sub:  Adaptor complexes medium subunit family;  InterPro: IPR008968 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ]. AP (adaptor protein) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and lipids to clathrin at vesicle budding sites, as well as binding accessory proteins that regulate coat assembly and disassembly (such as AP180, epsins and auxilin). There are different AP complexes in mammals. AP1 is responsible for the transport of lysosomal hydrolases between the TGN and endosomes []. AP2 associates with the plasma membrane and is responsible for endocytosis []. AP3 is responsible for protein trafficking to lysosomes and other related organelles []. AP4 is less well characterised. AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). For example, in AP1 these subunits are gamma-1-adaptin, beta-1-adaptin, mu-1 and sigma-1, while in AP2 they are alpha-adaptin, beta-2-adaptin, mu-2 and sigma-2. Each subunit has a specific function. Adaptins recognise and bind to clathrin through their hinge region (clathrin box), and recruit accessory proteins that modulate AP function through their C-terminal ear (appendage) domains. Mu recognises tyrosine-based sorting signals within the cytoplasmic domains of transmembrane cargo proteins []. One function of clathrin and AP2 complex-mediated endocytosis is to regulate the number of GABA(A) receptors available at the cell surface [].  This entry represents the C-terminal domain of the mu subunit from various clathrin adaptors (AP1, AP2 and AP3) []. The C-teminal domain has an immunoglobulin-like beta-sandwich fold consisting of 9 strands in 2 sheets with a Greek key topology, similar to that found in cytochrome f and certain transcription factors []. The mu subunit regulates the coupling of clathrin lattices with particular membrane proteins by self-phosphorylation via a mechanism that is still unclear []. The mu subunit possesses a highly conserved N-terminal domain of around 230 amino acids, which may be the region of interaction with other AP proteins; a linker region of between 10 and 42 amino acids; and a less well-conserved C-terminal domain of around 190 amino acids, which may be the site of specific interaction with the protein being transported in the vesicle []. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030131 clathrin adaptor complex; PDB: 1H6E_A 3L81_A 1W63_V 4EMZ_A 4EN2_A 2VGL_M 3ML6_F 2PR9_A 2JKT_M 1I31_A ....
Probab=43.66  E-value=65  Score=20.87  Aligned_cols=34  Identities=32%  Similarity=0.486  Sum_probs=19.5

Q ss_pred             EEEcCCCeEEEeecceEEEEecccCcccCCCCceeeeEE
Q psy4842          53 ISVQPDGTVLYSTRLKVTLLCLMNLKKFPFDEQECPLVL   91 (95)
Q Consensus        53 ~~i~~~G~v~~~~~~~~~~~C~~d~~~fPfD~q~C~l~~   91 (95)
                      +.+..+|.+.... ......|...+.-.|    .|.|.|
T Consensus        25 ~~~~~~G~~~~~~-v~G~v~~~~~l~g~p----~i~l~l   58 (262)
T PF00928_consen   25 AVLDRDGNILSSE-VKGSVQCKSFLSGMP----EIKLTL   58 (262)
T ss_dssp             EEEETTSEEEEEE-EEEEEEEEEE-SST-----EEEEEE
T ss_pred             EEEccCCcEEEEE-EEEEEEEEEeCCCCC----eEEEEe
Confidence            5567777766654 566666665555555    355554


No 14 
>PF14208 DUF4320:  Domain of unknown function (DUF4320)
Probab=38.37  E-value=29  Score=20.18  Aligned_cols=35  Identities=17%  Similarity=0.209  Sum_probs=28.0

Q ss_pred             CCCeEEEeecceEEEEecccCccc-CCCCceeeeEE
Q psy4842          57 PDGTVLYSTRLKVTLLCLMNLKKF-PFDEQECPLVL   91 (95)
Q Consensus        57 ~~G~v~~~~~~~~~~~C~~d~~~f-PfD~q~C~l~~   91 (95)
                      .+|.|-+...+.++.....++..| ||+...-+|+.
T Consensus        70 ~~~kVq~n~~v~vtvt~~~~~~~F~~~~~~~i~i~a  105 (116)
T PF14208_consen   70 TTGKVQLNEEVTVTVTGEYKIGIFKGFGSFPITIRA  105 (116)
T ss_pred             cCCcccCCCEEEEEEEEEEEEEEECCCCCccEEEEE
Confidence            688888888888888888888777 88877766665


No 15 
>PF08076 TetM_leader:  Tetracycline resistance determinant leader peptide;  InterPro: IPR012992 The antibiotic tetracycline has a broad spectrum of activity, acting to inhibit bacterial protein synthesis by binding to the 30S ribosomal subunit, which prevents the association of the aminoacyl-tRNA to the ribosomal acceptor A site. Tetracycline binding is reversible, therefore diluting out the antibiotic can reverse its effects. Tetracycline resistance genes are often located on mobile elements, such as plasmids, transposons and/or conjugative transposons, which can sometimes be transferred between bacterial species. In certain cases, tetracycline can enhance the transfer of these elements, thereby promoting resistance amongst a bacterial colony. There are three types of tetracycline resistance: tetracycline efflux, ribosomal protection, and tetracycline modification [, ]:    Tetracycline efflux proteins belong to the major facilitator superfamily. Efflux proteins are membrane-associated proteins that recognise and export tetracycline from the cell. They are found in both Gram-positive and Gram-negative bacteria []. There are at least 22 different tetracycline efflux proteins, grouped according to sequence similarity: Group 1 are Tet(A), Tet(B), Tet(C), Tet(D), Tet(E), Tet(G), Tet(H), Tet(J), Tet(Z) and Tet(30); Group 2 are Tet(K) and Tet(L); Group 3 are Otr(B) and Tcr(3); Group 4 is TetA(P); Group 5 is Tet(V). In addition, there are the efflux proteins Tet(31), Tet(33), Tet(V), Tet(Y), Tet(34), and Tet(35).     Ribosomal protection proteins are cytoplasmic proteins that display homology with the elongation factors EF-Tu and EF-G. Protection proteins bind the ribosome, causing an alteration in ribosomal conformation that prevents tetracycline from binding. There are at least ten ribosomal protection proteins: Tet(M), Tet(O), Tet(S), Tet(W), Tet(32), Tet(36), Tet(Q), Tet(T), Otr(A), and TetB(P). Both Tet(M) and Tet(O) have ribosome-dependent GTPase activity, the hydrolysis of GTP providing the energy for the ribosomal conformational changes.      Tetracycline modification proteins include the enzymes Tet(37) and Tet(X), both of which inactivate tetracycline. In addition, there are the tetracycline resistance proteins Tet(U) and Otr(C).   The expression of several of these tet genes is controlled by a family of tetracycline transcriptional regulators known as TetR. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity []. The TetR proteins identified in over 115 genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response.   This entry represents the tetracycline resistance leader peptide, which can be found in Tet(M) ribosomal protection proteins. A short open reading frame corresponding to a 28 amino acid peptide, which contains a number of inverted repeat sequences was found immediately upstream of tet(M). Transcriptional analyses has found that expression of tet(M) resulted from an extension of a small transcript representing the upstream leader region into the resistance determinant. Therefore, this leader sequence is responsible for transcriptional attenuation and thus regulation of the transcription of tet(M) [].
Probab=37.04  E-value=18  Score=15.40  Aligned_cols=19  Identities=21%  Similarity=0.211  Sum_probs=14.7

Q ss_pred             cccCcccCCCCceeeeEEe
Q psy4842          74 LMNLKKFPFDEQECPLVLE   92 (95)
Q Consensus        74 ~~d~~~fPfD~q~C~l~~~   92 (95)
                      |+-+..||-|...|+-.|-
T Consensus         5 p~~m~~fP~D~S~y~WDF~   23 (28)
T PF08076_consen    5 PMFMHHFPSDKSIYHWDFC   23 (28)
T ss_pred             eeeeccCCCccceeehhhh
Confidence            5777889999888876553


No 16 
>PF08910 Aida_N:  Aida N-terminus;  InterPro: IPR015006 This entry represents the axin interactor, dorsalization-associated protein family AIDA [].; PDB: 1UG7_A.
Probab=31.57  E-value=18  Score=20.78  Aligned_cols=8  Identities=75%  Similarity=1.310  Sum_probs=2.0

Q ss_pred             cccCCCCc
Q psy4842          78 KKFPFDEQ   85 (95)
Q Consensus        78 ~~fPfD~q   85 (95)
                      .-||||.|
T Consensus        99 ~~FP~dv~  106 (106)
T PF08910_consen   99 KEFPFDVQ  106 (106)
T ss_dssp             S--SS---
T ss_pred             CCCCCCCC
Confidence            35777765


No 17 
>PF13356 DUF4102:  Domain of unknown function (DUF4102); PDB: 3JU0_A 3RMP_A 3JTZ_A 2KJ8_A.
Probab=31.40  E-value=91  Score=16.72  Aligned_cols=18  Identities=22%  Similarity=0.515  Sum_probs=11.6

Q ss_pred             eeEEEEcCCCeEEEeecc
Q psy4842          50 DILISVQPDGTVLYSTRL   67 (95)
Q Consensus        50 ~~~~~i~~~G~v~~~~~~   67 (95)
                      .-.++|.++|...|..+.
T Consensus        24 GL~l~v~~~G~kt~~~r~   41 (89)
T PF13356_consen   24 GLYLRVTPSGSKTFYFRY   41 (89)
T ss_dssp             TEEEEE-TTS-EEEEEEE
T ss_pred             CcEEEEEeCCCeEEEEEE
Confidence            345788999988887655


No 18 
>PRK04257 hypothetical protein; Provisional
Probab=28.19  E-value=1.1e+02  Score=16.49  Aligned_cols=15  Identities=27%  Similarity=0.736  Sum_probs=11.0

Q ss_pred             EEEEc--CCCeEEEeec
Q psy4842          52 LISVQ--PDGTVLYSTR   66 (95)
Q Consensus        52 ~~~i~--~~G~v~~~~~   66 (95)
                      .+.|.  .+|.|.|.-+
T Consensus        60 I~~I~~~~dG~vvw~r~   76 (78)
T PRK04257         60 ILEIVNKKTGEILYKKR   76 (78)
T ss_pred             EEEEEEcCCCeEEEEEe
Confidence            35677  8999998643


No 19 
>PF06200 tify:  tify domain;  InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability.  Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include:   Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ].  A. thaliana ZIM-like proteins (ZML) [].  A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].   
Probab=26.72  E-value=77  Score=14.43  Aligned_cols=15  Identities=13%  Similarity=0.091  Sum_probs=11.2

Q ss_pred             eEEEEcCCCeEEEee
Q psy4842          51 ILISVQPDGTVLYST   65 (95)
Q Consensus        51 ~~~~i~~~G~v~~~~   65 (95)
                      ..++|.++|.|....
T Consensus         6 ~qLTIfY~G~V~Vfd   20 (36)
T PF06200_consen    6 AQLTIFYGGQVCVFD   20 (36)
T ss_pred             CcEEEEECCEEEEeC
Confidence            347899999987654


No 20 
>KOG1379|consensus
Probab=26.34  E-value=1.1e+02  Score=21.26  Aligned_cols=30  Identities=17%  Similarity=0.187  Sum_probs=21.3

Q ss_pred             EEEcCCCeEEEe-ecceEEEEecccCcccCC
Q psy4842          53 ISVQPDGTVLYS-TRLKVTLLCLMNLKKFPF   82 (95)
Q Consensus        53 ~~i~~~G~v~~~-~~~~~~~~C~~d~~~fPf   82 (95)
                      ..|-.+|+|.+. +.....+.||..|...|-
T Consensus       193 F~VvR~G~vv~~S~~Q~H~FN~PyQLs~~p~  223 (330)
T KOG1379|consen  193 FLVVREGKVVFRSPEQQHYFNTPYQLSSPPE  223 (330)
T ss_pred             eEEEECCEEEEcCchheeccCCceeeccCCc
Confidence            446789998884 445555677888888773


No 21 
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=25.58  E-value=62  Score=15.58  Aligned_cols=12  Identities=33%  Similarity=0.672  Sum_probs=9.4

Q ss_pred             EEEcCCCeEEEe
Q psy4842          53 ISVQPDGTVLYS   64 (95)
Q Consensus        53 ~~i~~~G~v~~~   64 (95)
                      +.|.+||.|.--
T Consensus         8 ~~I~~dG~v~pC   19 (64)
T PF13186_consen    8 LYIDPDGDVYPC   19 (64)
T ss_pred             EEEeeCccEEeC
Confidence            668899998753


No 22 
>PF13103 TonB_2:  TonB C terminal; PDB: 1LR0_A.
Probab=24.97  E-value=1.2e+02  Score=15.84  Aligned_cols=14  Identities=36%  Similarity=0.805  Sum_probs=10.2

Q ss_pred             ceeEEEEcCCCeEE
Q psy4842          49 QDILISVQPDGTVL   62 (95)
Q Consensus        49 ~~~~~~i~~~G~v~   62 (95)
                      ....++|.++|+|.
T Consensus        28 ~~V~i~i~~dG~v~   41 (85)
T PF13103_consen   28 VTVRITIDPDGRVI   41 (85)
T ss_dssp             EEEEEEE-TTSBEE
T ss_pred             EEEEEEECCCCCEE
Confidence            34568899999996


No 23 
>PF06554 Olfactory_mark:  Olfactory marker protein;  InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=21.26  E-value=17  Score=21.81  Aligned_cols=10  Identities=40%  Similarity=1.012  Sum_probs=6.7

Q ss_pred             cCceeecceE
Q psy4842          25 RDRVWTPHLY   34 (95)
Q Consensus        25 ~~~iW~P~i~   34 (95)
                      .+.+|+||+.
T Consensus        72 tsQ~WTPDLT   81 (151)
T PF06554_consen   72 TSQLWTPDLT   81 (151)
T ss_dssp             B-TTS-TTTS
T ss_pred             eccccCcchh
Confidence            5899999985


No 24 
>KOG2139|consensus
Probab=21.20  E-value=3.2e+02  Score=19.70  Aligned_cols=18  Identities=33%  Similarity=0.676  Sum_probs=12.4

Q ss_pred             EEEEcCCCeEEEeecceE
Q psy4842          52 LISVQPDGTVLYSTRLKV   69 (95)
Q Consensus        52 ~~~i~~~G~v~~~~~~~~   69 (95)
                      +++-++||.+.+-.....
T Consensus       243 lLkwSPdgd~lfaAt~da  260 (445)
T KOG2139|consen  243 LLKWSPDGDVLFAATCDA  260 (445)
T ss_pred             eEEEcCCCCEEEEecccc
Confidence            567788998887654443


No 25 
>PF08758 Cadherin_pro:  Cadherin prodomain like;  InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This protein corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions []. ; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1OP4_A.
Probab=20.51  E-value=1.2e+02  Score=16.77  Aligned_cols=19  Identities=21%  Similarity=0.240  Sum_probs=13.0

Q ss_pred             eEEEEcCCCeEEEeecceE
Q psy4842          51 ILISVQPDGTVLYSTRLKV   69 (95)
Q Consensus        51 ~~~~i~~~G~v~~~~~~~~   69 (95)
                      ...+|..||.|.....+.+
T Consensus        46 pdF~V~~DGsVy~~r~v~l   64 (90)
T PF08758_consen   46 PDFRVLEDGSVYAKRPVQL   64 (90)
T ss_dssp             SEEEEETTTEEEEES--S-
T ss_pred             CCEEEcCCCeEEEeeeEec
Confidence            3478999999998776665


No 26 
>PF15016 DUF4520:  Domain of unknown function (DUF4520)
Probab=20.31  E-value=1.7e+02  Score=16.09  Aligned_cols=20  Identities=30%  Similarity=0.494  Sum_probs=10.8

Q ss_pred             EEcCCCeEE--EeecceEEEEe
Q psy4842          54 SVQPDGTVL--YSTRLKVTLLC   73 (95)
Q Consensus        54 ~i~~~G~v~--~~~~~~~~~~C   73 (95)
                      .-++||+|.  +.-+.+++..+
T Consensus        19 ~AysDgrVr~~F~Drt~L~l~~   40 (85)
T PF15016_consen   19 TAYSDGRVRVHFDDRTILTLIW   40 (85)
T ss_pred             EEEcCCeEEEEEcCCCEEEEEe
Confidence            356677643  35555555555


No 27 
>PF15008 DUF4518:  Domain of unknown function (DUF4518)
Probab=20.29  E-value=1.3e+02  Score=20.31  Aligned_cols=42  Identities=21%  Similarity=0.173  Sum_probs=33.6

Q ss_pred             eEEEEcCCCeEEEeecceEEEEecccCcccCCCCceeeeEEe
Q psy4842          51 ILISVQPDGTVLYSTRLKVTLLCLMNLKKFPFDEQECPLVLE   92 (95)
Q Consensus        51 ~~~~i~~~G~v~~~~~~~~~~~C~~d~~~fPfD~q~C~l~~~   92 (95)
                      -+|.|..=|+|--.......+.|-+-+.+=||+..+=+++|.
T Consensus       213 GlV~V~v~GTvH~~~~ClGiFEq~FGLiRdP~~~N~WKiK~~  254 (262)
T PF15008_consen  213 GLVLVAVCGTVHRDNTCLGIFEQIFGLIRDPFAENNWKIKFV  254 (262)
T ss_pred             CcEEEEEeeeEecCCceEeehhhhhhcccCccccCceeEEEE
Confidence            345566667777777788889999999999999998888864


Done!