Diaphorina citri psyllid: psy4843

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MSSRYILGRYLRTAYPIDPETVTENTGLIKLSLPILGQSDVIYYMCTKENRTLGTAGGAAHSSVWVHLGQETFLQIEAYEKLIPFWLAIVIIVTCLGFSSLFSGLNLGLMSLNRTDLKIICNTGTEHERKYAKTIIPVREHGNYLLCSILLGTEHERKYAKTIIPVREHGNYLLCSILLGNVMVNSTFTILLDDITSGLVAVIGSTLAIVIFGEISPQAVCSRHGLMIGAKTINVTKVVMILTFPLAYPISKILDWILGEEIGNVYTRERLKELVKI
cccccccccccccccccccccccccEEEEEEEcccccccccEEEEEEEccccccccccccccccEEEccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcc
****YILGRYLRTAYPIDPETVTENTGLIKLSLPILGQSDVIYYMCTKENRT**TAGGAAHSSVWVHLGQETFLQIEAYEKLIPFWLAIVIIVTCLGFSSLFSGLNLGLMSLNRTDLKIICNTGTEHERKYAKTIIPVREHGNYLLCSILLGTEHERKYAKTIIPVREHGNYLLCSILLGNVMVNSTFTILLDDITSGLVAVIGSTLAIVIFGEISPQAVCSRHGLMIGAKTINVTKVVMILTFPLAYPISKILDWILGEEIGNVYTRERLKELVKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRYILGRYLRTAYPIDPETVTENTGLIKLSLPILGQSDVIYYMCTKENRTLGTAGGAAHSSVWVHLGQETFLQIEAYEKLIPFWLAIVIIVTCLGFSSLFSGLNLGLMSLNRTDLKIICNTGTEHERKYAKTIIPVREHGNYLLCSILLGTEHERKYAKTIIPVREHGNYLLCSILLGNVMVNSTFTILLDDITSGLVAVIGSTLAIVIFGEISPQAVCSRHGLMIGAKTINVTKVVMILTFPLAYPISKILDWILGEEIGNVYTRERLKELVKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal transporter CNNM2 Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg(2+) > Co(2+) > Mn(2+) > Sr(2+) > Ba(2+) > Cu(2+) > Fe(2+).confidentQ3TWN3
Metal transporter CNNM2 Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg(2+) > Co(2+) > Mn(2+) > Sr(2+) > Ba(2+) > Cu(2+) > Fe(2+).confidentQ5U2P1
Metal transporter CNNM2 Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg(2+) > Co(2+) > Mn(2+) > Sr(2+) > Ba(2+) > Cu(2+) > Fe(2+).confidentQ9H8M5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0050801 [BP]ion homeostasisprobableGO:0042592, GO:0008150, GO:0065008, GO:0065007, GO:0048878
GO:0015693 [BP]magnesium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted