Diaphorina citri psyllid: psy484

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MSYSPQFLRRQSQAPVLSLARRKYPRPSLHDLESAISAPSSVSFVIVRHPFERLLSAYRDKIYNSLPNTIHRALSSAILRKYRPLAATKSTSRRATFEEFVLYLLDTFRSNETGLDMHWAPVVQFCTPCLINFNVILKFETLQEDQRYLIELTGLSHLIKPEWINEGKGGSTNQMIGKFYSELSADQLYQLYNVY
ccccHHHHHccccccHHHHHHHHcccccccHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccHHHHHccccccEEccEEEEEccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHccccHHHHHHHHHcc
*SYSP**LRRQSQAPV*SL****************ISAPSSVSFVIVRHPFERLLSAYRDKIYNSLPNTIHRALSSAILRKYRPLAATKSTSRRATFEEFVLYLLDTFRSNETGLDMHWAPVVQFCTPCLINFNVILKFETLQEDQRYLIELTGLSHLIKPEWINEGKGGSTNQMIGKFYSELSADQLYQLYNVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSPQFLRRQSQAPVLSLARRKYPRPSLHDLESAISAPSSVSFVIVRHPFERLLSAYRDKIYNSLPNTIHRALSSAILRKYRPLAATKSTSRRATFEEFVLYLLDTFRSNETGLDMHWAPVVQFCTPCLINFNVILKFETLQEDQRYLIELTGLSHLIKPEWINEGKGGSTNQMIGKFYSELSADQLYQLYNVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001537 [MF]N-acetylgalactosamine 4-O-sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F5F, chain A
Confidence level:probable
Coverage over the Query: 19-71,84-154
View the alignment between query and template
View the model in PyMOL