Query         psy4850
Match_columns 64
No_of_seqs    153 out of 1023
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 19:17:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4850.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4850hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1253 TlyC Hemolysins and re  99.5   1E-14 2.3E-19  101.4   5.3   58    6-64    183-240 (429)
  2 PRK11573 hypothetical protein;  99.5 8.2E-15 1.8E-19  101.9   3.6   54   10-64    168-221 (413)
  3 TIGR03520 GldE gliding motilit  99.5 4.9E-14 1.1E-18   97.8   4.6   56    7-64    170-225 (408)
  4 PRK15094 magnesium/cobalt effl  99.4 1.9E-13   4E-18   91.6   4.7   58    6-64     44-101 (292)
  5 COG4535 CorC Putative Mg2+ and  99.3 2.6E-13 5.6E-18   90.1   1.6   58    6-64     44-101 (293)
  6 COG4536 CorB Putative Mg2+ and  99.1 3.5E-11 7.5E-16   83.8   3.3   57    7-64    178-234 (423)
  7 KOG2118|consensus               98.4   1E-07 2.2E-12   68.2   1.4   55   10-64    185-239 (498)
  8 TIGR00400 mgtE Mg2+ transporte  97.1 0.00072 1.6E-08   47.7   3.7   48   10-60    112-159 (449)
  9 PF00571 CBS:  CBS domain CBS d  95.9  0.0027 5.9E-08   32.0   0.5   31   31-64      1-31  (57)
 10 TIGR01302 IMP_dehydrog inosine  94.0   0.079 1.7E-06   37.6   3.6   50    7-64     58-112 (450)
 11 COG4109 Predicted transcriptio  93.0   0.055 1.2E-06   38.4   1.5   46   18-64    172-222 (432)
 12 PRK10892 D-arabinose 5-phospha  88.0    0.29 6.2E-06   32.8   1.3   36   27-63    200-235 (326)
 13 cd04801 CBS_pair_M50_like This  87.3    0.51 1.1E-05   26.0   1.9   35   28-63     56-90  (114)
 14 cd04604 CBS_pair_KpsF_GutQ_ass  86.4    0.68 1.5E-05   25.3   2.1   51   10-63     39-90  (114)
 15 COG2239 MgtE Mg/Co/Ni transpor  84.5     1.6 3.5E-05   31.5   3.7   49   11-62    114-162 (451)
 16 PRK07107 inosine 5-monophospha  84.5    0.73 1.6E-05   33.5   2.0   37   26-63    158-194 (502)
 17 cd04597 CBS_pair_DRTGG_assoc2   83.3     1.1 2.3E-05   25.4   2.0   51    9-63     31-89  (113)
 18 cd04617 CBS_pair_4 The CBS dom  81.7       1 2.3E-05   25.1   1.5   37   26-63     55-91  (118)
 19 TIGR01137 cysta_beta cystathio  81.6     0.8 1.7E-05   32.0   1.2   39   20-63    328-366 (454)
 20 cd04623 CBS_pair_10 The CBS do  81.4       1 2.3E-05   24.4   1.4   34   27-63     57-90  (113)
 21 PTZ00314 inosine-5'-monophosph  81.2    0.94   2E-05   32.8   1.5   36   27-63    157-192 (495)
 22 PLN02274 inosine-5'-monophosph  80.9       1 2.2E-05   32.7   1.6   36   27-63    161-196 (505)
 23 cd04585 CBS_pair_ACT_assoc2 Th  79.1     1.4 3.1E-05   24.1   1.5   35   27-64     65-99  (122)
 24 PRK11543 gutQ D-arabinose 5-ph  78.8    0.76 1.7E-05   30.6   0.4   35   28-63    196-230 (321)
 25 cd04584 CBS_pair_ACT_assoc Thi  77.6     1.3 2.9E-05   24.4   1.1   35   26-63     64-98  (121)
 26 cd04603 CBS_pair_KefB_assoc Th  76.8     2.4 5.2E-05   23.4   2.0   34   28-64     55-88  (111)
 27 PRK05567 inosine 5'-monophosph  76.7     4.2 9.1E-05   29.2   3.6   43   14-64     77-119 (486)
 28 cd04592 CBS_pair_EriC_assoc_eu  76.3     1.8 3.9E-05   25.5   1.4   32   31-63     71-109 (133)
 29 PRK10892 D-arabinose 5-phospha  74.9     3.2   7E-05   27.8   2.5   36   25-63    265-300 (326)
 30 cd04613 CBS_pair_SpoIVFB_EriC_  73.8     3.3 7.1E-05   22.3   2.1   35   26-63     55-89  (114)
 31 cd04802 CBS_pair_3 The CBS dom  71.1     3.5 7.5E-05   22.4   1.7   34   27-63     56-89  (112)
 32 cd04621 CBS_pair_8 The CBS dom  70.6     3.2 6.9E-05   24.0   1.6   33   28-63     80-112 (135)
 33 cd04615 CBS_pair_2 The CBS dom  70.4     3.5 7.6E-05   22.4   1.7   34   26-62     55-88  (113)
 34 COG3620 Predicted transcriptio  68.1     3.4 7.4E-05   26.6   1.4   54    8-64     39-97  (187)
 35 cd04589 CBS_pair_CAP-ED_DUF294  67.8     3.3 7.1E-05   22.5   1.2   34   27-63     55-88  (111)
 36 cd04594 CBS_pair_EriC_assoc_ar  67.7     4.9 0.00011   21.7   1.9   32   29-63     50-81  (104)
 37 cd04582 CBS_pair_ABC_OpuCA_ass  67.4     6.7 0.00015   21.0   2.4   32   29-63     51-82  (106)
 38 cd04640 CBS_pair_27 The CBS do  67.4     2.4 5.2E-05   23.9   0.5   37   26-63     61-101 (126)
 39 cd04633 CBS_pair_20 The CBS do  67.0     3.7 8.1E-05   22.6   1.3   35   26-63     64-98  (121)
 40 PF14044 NETI:  NETI protein     66.9       5 0.00011   21.3   1.7   22   42-64      2-23  (57)
 41 cd04636 CBS_pair_23 The CBS do  66.7       4 8.6E-05   23.1   1.4   31   30-63     79-109 (132)
 42 cd04586 CBS_pair_BON_assoc Thi  66.0       4 8.6E-05   23.2   1.3   35   26-63     78-112 (135)
 43 cd04595 CBS_pair_DHH_polyA_Pol  65.8     5.8 0.00013   21.4   1.9   34   27-63     54-87  (110)
 44 cd04622 CBS_pair_9 The CBS dom  65.2     5.1 0.00011   21.7   1.6   36   25-63     54-89  (113)
 45 cd04599 CBS_pair_GGDEF_assoc2   64.8     4.6 9.9E-05   21.5   1.4   33   28-63     50-82  (105)
 46 PRK01862 putative voltage-gate  64.2       3 6.5E-05   30.3   0.7   35   26-63    444-478 (574)
 47 cd04625 CBS_pair_12 The CBS do  63.7     5.1 0.00011   21.7   1.4   34   27-63     56-89  (112)
 48 cd04610 CBS_pair_ParBc_assoc T  63.7       5 0.00011   21.5   1.4   33   28-63     51-83  (107)
 49 cd04632 CBS_pair_19 The CBS do  61.5     4.2 9.1E-05   22.8   0.8   35   26-63     68-102 (128)
 50 cd04643 CBS_pair_30 The CBS do  60.6       4 8.7E-05   22.2   0.6   32   28-62     62-93  (116)
 51 cd04601 CBS_pair_IMPDH This cd  59.2     7.7 0.00017   20.7   1.6   33   28-63     53-86  (110)
 52 cd04630 CBS_pair_17 The CBS do  59.0     7.8 0.00017   21.1   1.7   35   26-63     57-91  (114)
 53 COG3448 CBS-domain-containing   58.8     6.8 0.00015   27.7   1.6   36   25-63    241-276 (382)
 54 cd04587 CBS_pair_CAP-ED_DUF294  57.6      10 0.00023   20.4   2.0   32   29-63     58-89  (113)
 55 cd04634 CBS_pair_21 The CBS do  56.2     6.7 0.00015   22.7   1.1   34   27-63     87-120 (143)
 56 PRK14869 putative manganese-de  55.5     8.6 0.00019   27.7   1.8   34   28-63    245-278 (546)
 57 cd04600 CBS_pair_HPP_assoc Thi  55.4       9  0.0002   21.1   1.5   33   27-62     67-99  (124)
 58 cd04596 CBS_pair_DRTGG_assoc T  55.1     8.3 0.00018   20.8   1.3   34   27-63     51-84  (108)
 59 cd04803 CBS_pair_15 The CBS do  54.7     9.7 0.00021   20.9   1.6   34   27-63     65-98  (122)
 60 cd04598 CBS_pair_GGDEF_assoc T  54.6     7.9 0.00017   21.1   1.2   33   27-62     59-91  (119)
 61 PRK14869 putative manganese-de  54.4     6.6 0.00014   28.3   1.0   33   28-63     67-99  (546)
 62 cd04629 CBS_pair_16 The CBS do  53.6     9.5  0.0002   20.6   1.4   33   27-62     58-90  (114)
 63 cd04800 CBS_pair_CAP-ED_DUF294  53.2      10 0.00022   20.4   1.5   33   28-63     56-88  (111)
 64 cd04635 CBS_pair_22 The CBS do  53.2     9.8 0.00021   20.8   1.4   34   27-63     65-98  (122)
 65 cd04607 CBS_pair_NTP_transfera  53.0      11 0.00024   20.5   1.6   33   28-63     57-89  (113)
 66 cd04611 CBS_pair_PAS_GGDEF_DUF  52.9     9.5 0.00021   20.4   1.3   34   27-63     54-87  (111)
 67 cd04631 CBS_pair_18 The CBS do  52.6     7.9 0.00017   21.3   1.0   33   28-63     69-101 (125)
 68 TIGR00400 mgtE Mg2+ transporte  51.4     8.9 0.00019   27.2   1.3   34   27-63    193-226 (449)
 69 cd04619 CBS_pair_6 The CBS dom  51.3      10 0.00022   20.8   1.3   34   27-63     57-90  (114)
 70 cd04626 CBS_pair_13 The CBS do  50.1      13 0.00028   20.0   1.6   33   28-63     56-88  (111)
 71 cd04602 CBS_pair_IMPDH_2 This   49.8      12 0.00026   20.4   1.5   35   28-63     56-90  (114)
 72 COG0517 FOG: CBS domain [Gener  49.7      28  0.0006   18.7   2.9   41   17-60     48-90  (117)
 73 TIGR01302 IMP_dehydrog inosine  49.6      10 0.00022   27.1   1.3   35   27-63    141-175 (450)
 74 cd04618 CBS_pair_5 The CBS dom  49.5      21 0.00045   19.4   2.4   24   39-63      1-24  (98)
 75 COG2524 Predicted transcriptio  48.9     7.8 0.00017   26.7   0.6   40   21-63    164-203 (294)
 76 PF08899 DUF1844:  Domain of un  47.6      20 0.00043   19.9   2.0   18    7-24     50-67  (74)
 77 PF04545 Sigma70_r4:  Sigma-70,  45.8      17 0.00038   17.6   1.5   23   11-34      4-26  (50)
 78 cd04593 CBS_pair_EriC_assoc_ba  45.7      17 0.00036   19.8   1.6   33   28-63     57-89  (115)
 79 TIGR00393 kpsF KpsF/GutQ famil  45.2      13 0.00029   23.9   1.3   34   27-63    218-251 (268)
 80 cd04641 CBS_pair_28 The CBS do  45.2      23  0.0005   19.4   2.2   24   40-64      2-25  (120)
 81 cd04590 CBS_pair_CorC_HlyC_ass  45.1      25 0.00053   18.8   2.2   24   39-63      1-24  (111)
 82 cd04639 CBS_pair_26 The CBS do  44.4      14 0.00031   19.8   1.2   34   27-63     54-87  (111)
 83 cd04583 CBS_pair_ABC_OpuCA_ass  43.4      20 0.00043   19.0   1.7   31   29-62     54-84  (109)
 84 TIGR01303 IMP_DH_rel_1 IMP deh  41.9      16 0.00036   26.5   1.4   32   29-63    146-177 (475)
 85 cd04638 CBS_pair_25 The CBS do  41.7      30 0.00065   18.4   2.2   23   40-63      2-24  (106)
 86 cd04620 CBS_pair_7 The CBS dom  41.4      26 0.00057   18.9   2.0   33   27-62     56-90  (115)
 87 cd04642 CBS_pair_29 The CBS do  38.5      35 0.00075   18.9   2.2   24   40-64      2-25  (126)
 88 KOG2550|consensus               38.5      19 0.00042   26.4   1.3   34   12-51    158-191 (503)
 89 PRK07807 inosine 5-monophospha  38.0      22 0.00047   25.9   1.6   32   29-63    148-179 (479)
 90 PF04504 DUF573:  Protein of un  37.1      16 0.00035   20.9   0.6   18   13-30      9-26  (98)
 91 cd04605 CBS_pair_MET2_assoc Th  35.7      38 0.00081   18.0   2.0   23   40-63      3-25  (110)
 92 PRK05567 inosine 5'-monophosph  35.7      26 0.00055   25.3   1.6   34   28-63    146-179 (486)
 93 smart00116 CBS Domain in cysta  35.2      43 0.00094   14.3   1.9   21   42-63      3-23  (49)
 94 cd04606 CBS_pair_Mg_transporte  33.0      29 0.00063   18.6   1.3   32   28-62     52-83  (109)
 95 cd04624 CBS_pair_11 The CBS do  32.7      31 0.00067   18.4   1.3   32   28-62     56-87  (112)
 96 cd04591 CBS_pair_EriC_assoc_eu  30.0      59  0.0013   17.6   2.2   25   38-63      1-25  (105)
 97 cd04627 CBS_pair_14 The CBS do  29.2      56  0.0012   17.9   2.1   25   38-63     75-99  (123)
 98 cd04614 CBS_pair_1 The CBS dom  29.1      50  0.0011   17.6   1.8   23   40-63      2-24  (96)
 99 cd07178 terB_like_YebE telluri  28.6      55  0.0012   18.4   1.9   19    7-25     11-29  (95)
100 TIGR02698 CopY_TcrY copper tra  28.5      13 0.00027   22.2  -0.8   50   12-63      2-51  (130)
101 KOG0626|consensus               27.6      26 0.00057   26.1   0.6   27    1-27    312-338 (524)
102 PF02318 FYVE_2:  FYVE-type zin  26.7      38 0.00083   19.7   1.1   15   11-25      2-16  (118)
103 cd02205 CBS_pair The CBS domai  26.5      68  0.0015   16.4   2.0   23   40-63      2-24  (113)
104 cd04637 CBS_pair_24 The CBS do  25.9      70  0.0015   17.3   2.0   23   40-63      2-24  (122)
105 cd04588 CBS_pair_CAP-ED_DUF294  25.2      75  0.0016   16.8   2.1   23   40-63      2-24  (110)
106 PRK04323 hypothetical protein;  25.0      71  0.0015   18.4   2.0   29   33-62     11-41  (91)
107 PF08934 Rb_C:  Rb C-terminal d  24.5      78  0.0017   19.9   2.2   18   32-50     51-68  (155)
108 cd04609 CBS_pair_PALP_assoc2 T  23.9      84  0.0018   16.4   2.1   22   41-63      3-24  (110)
109 KOG0474|consensus               23.1      44 0.00096   25.9   1.0   35   26-63    579-613 (762)

No 1  
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]
Probab=99.53  E-value=1e-14  Score=101.43  Aligned_cols=58  Identities=26%  Similarity=0.413  Sum_probs=55.4

Q ss_pred             ccccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           6 TTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         6 ~~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.+.|.++++|++|++|+|+|++++|++|||||++|++++.+.+.+ ++++.+.++|||
T Consensus       183 ~~~~g~~~~~E~~mi~~v~~l~~~~v~eiMtPR~~i~~l~~~~~~~-~~~~~~~~~~~S  240 (429)
T COG1253         183 SAEEGVLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESGHS  240 (429)
T ss_pred             HHhcCCcCHHHHHHHHHHhccCCcEeeeEeeecccEEEEcCCCCHH-HHHHHHHhCCCC
Confidence            4578999999999999999999999999999999999999999998 799999999998


No 2  
>PRK11573 hypothetical protein; Provisional
Probab=99.52  E-value=8.2e-15  Score=101.87  Aligned_cols=54  Identities=11%  Similarity=0.282  Sum_probs=52.0

Q ss_pred             CCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          10 NDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        10 g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.++++|++|++|+|+|++++|+||||||.+|++++.+.+++ ++++.+.++|||
T Consensus       168 ~~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~~~~~~S  221 (413)
T PRK11573        168 SQISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQLTHSPHG  221 (413)
T ss_pred             hhcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHHHhCCCc
Confidence            369999999999999999999999999999999999999998 799999999998


No 3  
>TIGR03520 GldE gliding motility-associated protein GldE. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype.
Probab=99.47  E-value=4.9e-14  Score=97.79  Aligned_cols=56  Identities=20%  Similarity=0.341  Sum_probs=52.5

Q ss_pred             cccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           7 TEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         7 ~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +++| ++++|++|++|+|+|++++|+||||||.++++++.+.+++ ++++.+.++|||
T Consensus       170 ~~~g-~~~~E~~~i~~vl~l~~~~v~diMtpr~~v~~l~~~~~~~-e~~~~~~~~~~s  225 (408)
T TIGR03520       170 DEED-TTKEEQKILQGIVSFGNTDTKQVMRPRLDIFALDIETSFS-EIIPKIIENGYS  225 (408)
T ss_pred             hhcC-CChHHHHHHHHHhccCCCEeeeeCCchHhEEEEECCCCHH-HHHHHHHhCCCC
Confidence            4445 6899999999999999999999999999999999999998 799999999998


No 4  
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional
Probab=99.42  E-value=1.9e-13  Score=91.59  Aligned_cols=58  Identities=19%  Similarity=0.384  Sum_probs=55.2

Q ss_pred             ccccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           6 TTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         6 ~~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.++|.|+++|++||.|+|+|++++|++||+||.++++++.+.+++ ++++.+.++|||
T Consensus        44 ~~~~g~l~~~e~~~i~~vl~l~~~~V~diMtpr~~i~~l~~~~sl~-e~~~~i~~~~~s  101 (292)
T PRK15094         44 SEQNDLIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLD-ECLDVIIESAHS  101 (292)
T ss_pred             HhhcCCCCHHHHHHHHHHhccCCCEEeEEccchHHEEEEeCCCCHH-HHHHHHHhcCCc
Confidence            3568999999999999999999999999999999999999999999 799999999987


No 5  
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]
Probab=99.35  E-value=2.6e-13  Score=90.12  Aligned_cols=58  Identities=19%  Similarity=0.369  Sum_probs=55.7

Q ss_pred             ccccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           6 TTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         6 ~~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      ++.++.++.+.+.||.|++++++++|+|||+||++|++|..+.+++ +++..+.+++||
T Consensus        44 se~n~LiD~dt~~mlEGvm~iadl~vrDiMIPRSQM~~l~~~~~l~-~~l~~iiesaHS  101 (293)
T COG4535          44 SEQNELIDADTLDMLEGVMDIADLRVRDIMIPRSQMITLKRNQTLD-ECLDVIIESAHS  101 (293)
T ss_pred             hhhccccChhHHHHHHHHHHHHHhhHhhhcccHHHheeccccCCHH-HHHHHHHHhccc
Confidence            4778899999999999999999999999999999999999999999 799999999998


No 6  
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]
Probab=99.13  E-value=3.5e-11  Score=83.78  Aligned_cols=57  Identities=19%  Similarity=0.337  Sum_probs=52.9

Q ss_pred             cccCCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           7 TEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         7 ~~~g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.+|...+.+++||.|+|+|.+.+|+||||||.+|.+++.+.+++ ++++++..+.|+
T Consensus       178 ~~e~~~~~~~rdmL~gvLDLe~~tV~DIMvpR~~i~~id~d~~~e-~iv~ql~~s~Ht  234 (423)
T COG4536         178 GSEGSVNKIDRDMLLGVLDLENLTVSDIMVPRNEIIGIDIDDPWE-EIVRQLLHSPHT  234 (423)
T ss_pred             hcccccccccHHHHhcccccccceeeeeeccccceeeecCCCCHH-HHHHHHhhCCCC
Confidence            566777777899999999999999999999999999999999999 799999999885


No 7  
>KOG2118|consensus
Probab=98.40  E-value=1e-07  Score=68.19  Aligned_cols=55  Identities=53%  Similarity=0.745  Sum_probs=52.8

Q ss_pred             CCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          10 NDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        10 g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      |.+..++..++.|+++|.++.|++||||..++|+++.+..++.+.+..+.++|||
T Consensus       185 g~~~~~e~~ii~g~l~l~ek~~~evmtpi~~~f~l~~n~~l~~~~~~~i~~~g~s  239 (498)
T KOG2118|consen  185 GDLTYDELTIITGALELTEKLVGEVMTPIEDVFALDANTKLDRETVGEIVKHGYS  239 (498)
T ss_pred             CcccchhhhHhhhhHHHHHHHHHHhccchhhheeeccccccchHHHhhHhhcCcc
Confidence            6689999999999999999999999999999999999999998899999999997


No 8  
>TIGR00400 mgtE Mg2+ transporter (mgtE). This family of prokaryotic proteins models a class of Mg++ transporter first described in Bacillus firmus. May form a homodimer.
Probab=97.07  E-value=0.00072  Score=47.70  Aligned_cols=48  Identities=19%  Similarity=0.203  Sum_probs=43.9

Q ss_pred             CCCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHh
Q psy4850          10 NDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMK   60 (64)
Q Consensus        10 g~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~   60 (64)
                      +.+++++++.+++++++.+.+|+++|+  .++.+++.+.++. ++++.+.+
T Consensus       112 ~~l~~~er~~i~~ll~~~e~tvg~iMt--~~~~~v~~~~tv~-eal~~l~~  159 (449)
T TIGR00400       112 ASSTEEERKAINLLLSYSDDSAGRIMT--IEYVELKEDYTVG-KALDYIRR  159 (449)
T ss_pred             HcCCHHHHHHHHHHhCCCcchHHHhCc--CceEEECCCCcHH-HHHHHHHh
Confidence            468999999999999999999999998  5799999999999 79998875


No 9  
>PF00571 CBS:  CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.;  InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations [].  In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=95.91  E-value=0.0027  Score=31.97  Aligned_cols=31  Identities=32%  Similarity=0.392  Sum_probs=27.8

Q ss_pred             ecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          31 VGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        31 v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      |+++|+|  +...++.+.++. ++++.+.+.+++
T Consensus         1 v~~~m~~--~~~~v~~~~~l~-~~~~~~~~~~~~   31 (57)
T PF00571_consen    1 VGDIMTP--PPITVSPDDSLE-EALEIMRKNGIS   31 (57)
T ss_dssp             HHHHSBS--SSEEEETTSBHH-HHHHHHHHHTSS
T ss_pred             CeECCcC--CCEEEcCcCcHH-HHHHHHHHcCCc
Confidence            5789999  999999999999 799999998874


No 10 
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase. This model describes a rather tightly conserved cluster of IMP dehydrogenase sequences, many of which are characterized. The model excludes two related families of proteins proposed also to be IMP dehydrogenases, but without characterized members. These are related families are the subject of separate models.
Probab=93.99  E-value=0.079  Score=37.63  Aligned_cols=50  Identities=6%  Similarity=0.142  Sum_probs=40.8

Q ss_pred             cccCCCC-----HHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           7 TEFNDLE-----KDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         7 ~~~g~l~-----~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +..|.|+     +++.+++++++++.+..++       ++++++.+.++. ++++.+.+++||
T Consensus        58 gg~GvI~~n~~~e~q~~~V~~Vk~~~~~~~~-------~~vtl~~~~tv~-eal~~m~~~~~s  112 (450)
T TIGR01302        58 GGIGVIHRNMSIEEQAEQVKRVKRAENGIIS-------DPVTISPETTVA-DVLELMERKGIS  112 (450)
T ss_pred             CCCceeecCCCHHHHHHHHhhhccccCceec-------CceEeCCCCCHH-HHHHHHHHcCCC
Confidence            3466777     4899999999988876443       678999999999 799999988875


No 11 
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]
Probab=93.04  E-value=0.055  Score=38.43  Aligned_cols=46  Identities=26%  Similarity=0.306  Sum_probs=38.3

Q ss_pred             HHHHhhh-----cccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          18 NIISGAL-----ELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        18 ~ml~~~l-----~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      .||.+|+     .=.=.+|.|||+|..+-..|..+.+++ ++.+...+.|||
T Consensus       172 tmIN~Al~n~lIKkdI~~Vedi~~P~~~~~yL~~~d~v~-d~~~l~~kt~~s  222 (432)
T COG4109         172 TMINKALSNQLIKKDIITVEDIMTPLEDTSYLRETDTVE-DWLDLVEKTGHS  222 (432)
T ss_pred             HHHHHHHHHhhhhhheeeHHHhccccccceeccccccHH-HHHHHHHHcCCC
Confidence            4555544     334468999999999999999999999 799999999997


No 12 
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional
Probab=87.98  E-value=0.29  Score=32.82  Aligned_cols=36  Identities=22%  Similarity=0.227  Sum_probs=31.2

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...+|+++|++..++..++.+.++. ++++.+.++++
T Consensus       200 ~~~~V~dim~~~~~~~~v~~~~sl~-~a~~~~~~~~~  235 (326)
T PRK10892        200 LLLRVSDIMHTGDEIPHVSKTASLR-DALLEITRKNL  235 (326)
T ss_pred             ccCcHHHHhCCCCCCeEECCCCCHH-HHHHHHHhcCC
Confidence            6678999999877999999999999 79998877664


No 13 
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=87.30  E-value=0.51  Score=26.04  Aligned_cols=35  Identities=17%  Similarity=0.137  Sum_probs=29.9

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.++.++|.|......++.+.++. ++++.+.+++.
T Consensus        56 ~~~v~~~~~~~~~~~~v~~~~~l~-~a~~~~~~~~~   90 (114)
T cd04801          56 QTTVIQVMTPAAKLVTVLSEESLA-EVLKLLEEQGL   90 (114)
T ss_pred             ccchhhhhcccccceEECCCCcHH-HHHHHHHHCCC
Confidence            567999999877778999999998 79999988764


No 14 
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein.  These APIs catalyze the conversion of the pentose pathway intermediate D-ribulose 5-phosphate into A5P, a precursor of 3-deoxy-D-manno-octulosonate, which is an integral carbohydrate component of various glycolipids coating the surface of the outer membrane of Gram-negative bacteria, including lipopolysaccharide and many group 2 K-antigen capsules. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other funct
Probab=86.44  E-value=0.68  Score=25.26  Aligned_cols=51  Identities=18%  Similarity=0.212  Sum_probs=35.8

Q ss_pred             CCCCHHH-HHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          10 NDLEKDE-VNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        10 g~l~~~e-~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      |.++... .+.+.+.......++.++|.|.  +..++.+.++. ++++.+.+++.
T Consensus        39 G~v~~~~i~~~~~~~~~~~~~~v~~~~~~~--~~~v~~~~~~~-~~~~~~~~~~~   90 (114)
T cd04604          39 GIFTDGDLRRALEKGLDILTLPVADVMTRN--PKTIDPDALAA-EALELMEENKI   90 (114)
T ss_pred             EEechHHHHHHHhccCccccCCHHHhhccC--CeEECCCCcHH-HHHHHHHHcCC
Confidence            3455433 4455555555667899999874  56789999999 79999887664


No 15 
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]
Probab=84.51  E-value=1.6  Score=31.50  Aligned_cols=49  Identities=22%  Similarity=0.329  Sum_probs=44.9

Q ss_pred             CCCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          11 DLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        11 ~l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      .++++++..++..+...+-+|.-+|++  +.++++.+.+.. +++..+++.+
T Consensus       114 ~l~~~~r~~v~~~l~y~e~taG~~Mt~--e~v~l~~~~Tv~-~al~~ir~~~  162 (451)
T COG2239         114 LLDPEERARVRQLLSYPEDTAGRIMTT--EFVTLPEDVTVD-EALDRIRERA  162 (451)
T ss_pred             hCCHHHHHHHHHhcCCChhhhhcccee--eeEEeccCcCHH-HHHHHHHHhc
Confidence            478899999999999999999999996  789999999999 7999998765


No 16 
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated
Probab=84.50  E-value=0.73  Score=33.49  Aligned_cols=37  Identities=22%  Similarity=0.152  Sum_probs=32.2

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..+.+|+++|+|..++++++.+.++. ++++.+.+++.
T Consensus       158 ~~~~~V~dIMt~~~~~itv~~d~~l~-eAl~lM~e~~i  194 (502)
T PRK07107        158 SLDTKVKDFMTPFEKLVTANEGTTLK-EANDIIWDHKL  194 (502)
T ss_pred             CCCCCHHHHhCCCCCeEEECCCCcHH-HHHHHHHHcCC
Confidence            45678999999988899999999999 79999888764


No 17 
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=83.31  E-value=1.1  Score=25.40  Aligned_cols=51  Identities=12%  Similarity=0.144  Sum_probs=36.0

Q ss_pred             cCCCCHHHHHHHHhhhccc------C--eeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850           9 FNDLEKDEVNIISGALELR------R--KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus         9 ~g~l~~~e~~ml~~~l~~~------~--~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .|...++ .+.+..-|.+.      +  .+|+++|.+  ++..++.+.++. ++++.+.+.++
T Consensus        31 ~g~~n~e-~~~vl~~~~~~~p~ll~~v~~~v~dim~~--~~~~v~~~~~l~-~a~~~~~~~~~   89 (113)
T cd04597          31 LGEPNPQ-TRYVLEYLGIEPPILLADVHPRVRDVINR--KPVTARPNDPLR-EALNLMHEHNI   89 (113)
T ss_pred             cCCCCHH-HHHHHHHcCCCCchhhcchhhhHHHhcCC--CCCEECCcCcHH-HHHHHHHHcCC
Confidence            3444444 45555555532      2  679999986  677889999998 79999887765


No 18 
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=81.68  E-value=1  Score=25.08  Aligned_cols=37  Identities=16%  Similarity=0.336  Sum_probs=30.4

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +...++.++|+.-..+..++.++++. ++++.+.++++
T Consensus        55 ~~~~~~~~~~~~~~~~~~v~~~~~l~-~~~~~~~~~~~   91 (118)
T cd04617          55 LQKVPVGVIMTRMPNITTTTPEESVL-EAAKKLIEHQV   91 (118)
T ss_pred             ccCCCHHHHhCCCCCcEEECCCCcHH-HHHHHHHHcCC
Confidence            45677889997545688999999998 79999998875


No 19 
>TIGR01137 cysta_beta cystathionine beta-synthase. Members of this family closely resemble cysteine synthase but contain an additional C-terminal CBS domain. The function of any bacterial member included in this family is proposed but not proven.
Probab=81.58  E-value=0.8  Score=31.99  Aligned_cols=39  Identities=8%  Similarity=0.077  Sum_probs=32.4

Q ss_pred             HHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          20 ISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        20 l~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.++  |+..+|+++|.|  ++..++.+.++. ++++.+.+.++
T Consensus       328 ~~~~--l~~~~v~~im~~--~~~~v~~~~tl~-ea~~~m~~~~~  366 (454)
T TIGR01137       328 VFDV--LKNATVKDLHLP--APVTVHPTETVG-DAIEILREYGF  366 (454)
T ss_pred             HHHH--hccCCHHHhCcC--CCeEECCCCcHH-HHHHHHHHcCC
Confidence            5555  888999999976  588999999999 79998887765


No 20 
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=81.39  E-value=1  Score=24.37  Aligned_cols=34  Identities=21%  Similarity=0.330  Sum_probs=28.3

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.++.++|.+  .+..++.+.++. ++++.+.++++
T Consensus        57 ~~~~~~~~~~~--~~~~v~~~~~~~-~~l~~~~~~~~   90 (113)
T cd04623          57 LDTPVSEIMTR--NVITVTPDDTVD-EAMALMTERRF   90 (113)
T ss_pred             cccCHHHhcCC--CcEEECCCCcHH-HHHHHHHHcCC
Confidence            35689999966  688899999998 79999988775


No 21 
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional
Probab=81.21  E-value=0.94  Score=32.79  Aligned_cols=36  Identities=22%  Similarity=0.220  Sum_probs=31.1

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+..|+++|+|+.+++.++.+.++. ++++.+.+++.
T Consensus       157 ~~~~V~diMt~~~~lvtv~~~~sl~-eAl~lm~e~~i  192 (495)
T PTZ00314        157 KSTPVSEVMTPREKLVVGNTPISLE-EANEVLRESRK  192 (495)
T ss_pred             CCCCHHHhhCCcCCceEeCCCCCHH-HHHHHHHHcCC
Confidence            3567999999999999999999998 79998887654


No 22 
>PLN02274 inosine-5'-monophosphate dehydrogenase
Probab=80.89  E-value=1  Score=32.72  Aligned_cols=36  Identities=22%  Similarity=0.260  Sum_probs=31.3

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.+|.++|+|...+..++.+.++. ++++.+.+++.
T Consensus       161 ~~~~V~eIMt~~~~lvtv~~~~sL~-eAl~~m~~~~~  196 (505)
T PLN02274        161 RETKLSEVMTSDDDLVTAPAGIDLE-EAEAVLKDSKK  196 (505)
T ss_pred             cCCcHHHHhccCCCcEEECCCCCHH-HHHHHHHHcCC
Confidence            4677999999988899999999999 79999888764


No 23 
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in  the acetoin utilization proteins in bacteria. Acetoin is a product of fermentative metabolism in many prokaryotic and eukaryotic microorganisms.  They produce acetoin as an external carbon storage compound and then later reuse it as a carbon and energy source during their stationary phase and sporulation. In addition these CBS domains are associated with a downstream ACT domain, which is linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The i
Probab=79.08  E-value=1.4  Score=24.09  Aligned_cols=35  Identities=26%  Similarity=0.375  Sum_probs=28.4

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      ...++.++|.+  +..+++.+.++. +++..+.+.+++
T Consensus        65 ~~~~~~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~~   99 (122)
T cd04585          65 SKIKVSDIMTR--DPITVSPDASVE-EAAELMLERKIS   99 (122)
T ss_pred             cccCHHHhccC--CCeEeCCCCcHH-HHHHHHHHcCCC
Confidence            45778899976  688999999998 799988877653


No 24 
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional
Probab=78.84  E-value=0.76  Score=30.60  Aligned_cols=35  Identities=11%  Similarity=0.157  Sum_probs=29.8

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..+|+++|.+..++..++.+.++. ++++.+.+++.
T Consensus       196 ~~~V~~im~~~~~~~~v~~~~sv~-~a~~~~~~~~~  230 (321)
T PRK11543        196 LNKVHHLMRRDDAIPQVALTASVM-DAMLELSRTGL  230 (321)
T ss_pred             HhHHHHHhccCCCCcEeCCCCCHH-HHHHHHHHcCC
Confidence            578999999987789999999999 78888876653


No 25 
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in  the acetoin utilization proteins in bacteria. Acetoin is a product of fermentative metabolism in many prokaryotic and eukaryotic microorganisms.  They produce acetoin as an external carbon storage compound and then later reuse it as a carbon and energy source during their stationary phase and sporulation. In addition these CBS domains are associated with a downstream ACT domain, which is linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The in
Probab=77.64  E-value=1.3  Score=24.36  Aligned_cols=35  Identities=23%  Similarity=0.224  Sum_probs=28.9

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..+.++.++|.+  ...+++.+.++. ++++.+.+.++
T Consensus        64 ~~~~~v~~~~~~--~~~~i~~~~~l~-~~~~~~~~~~~   98 (121)
T cd04584          64 LLKMPVKEIMTK--DVITVHPLDTVE-EAALLMREHRI   98 (121)
T ss_pred             hcCcCHHHHhhC--CCeEECCCCcHH-HHHHHHHHcCC
Confidence            456789999976  678999999999 69988887765


No 26 
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=76.81  E-value=2.4  Score=23.35  Aligned_cols=34  Identities=15%  Similarity=0.132  Sum_probs=27.4

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.++.++|.+  ...+++.+.++. ++++.+.+++.+
T Consensus        55 ~~~v~~~~~~--~~~~v~~~~~l~-~al~~m~~~~~~   88 (111)
T cd04603          55 TLKVCEVYIV--PVPIVYCDSKVT-DLLRIFRETEPP   88 (111)
T ss_pred             ccChhheeec--CCcEECCCCcHH-HHHHHHHHcCCC
Confidence            3569999954  467899999998 799999988753


No 27 
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed
Probab=76.69  E-value=4.2  Score=29.22  Aligned_cols=43  Identities=9%  Similarity=0.121  Sum_probs=35.0

Q ss_pred             HHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          14 KDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        14 ~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +++.+++.++.++.     ++|+  .++.+++.+.++. ++++.+.+.+|+
T Consensus        77 e~~~~~I~~vk~~~-----dim~--~~~v~i~~~~tv~-ea~~~m~~~~~~  119 (486)
T PRK05567         77 EEQAEEVRKVKRSE-----SGVV--TDPVTVTPDTTLA-EALALMARYGIS  119 (486)
T ss_pred             HHHHHHHHHhhhhh-----hccc--CCCeEeCCCCCHH-HHHHHHHHhCCC
Confidence            57789999988865     4555  6788899999999 799999888764


No 28 
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually 
Probab=76.26  E-value=1.8  Score=25.45  Aligned_cols=32  Identities=19%  Similarity=0.096  Sum_probs=26.3

Q ss_pred             ecceeee-------cccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          31 VGDVMTK-------LEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        31 v~dvM~P-------r~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.++|+|       +..+.++..++++. ++++.+.++++
T Consensus        71 v~~i~~~~~~~~~~~~~~~~v~~~~~l~-ea~~~m~~~~~  109 (133)
T cd04592          71 VSSVCTKGISYGGQECGLWTCTPDTDLT-TAKKLMEAKGV  109 (133)
T ss_pred             HHHHhhhhhhhcccCCCCEEECCCCCHH-HHHHHHHHcCC
Confidence            4568875       46799999999999 79999988775


No 29 
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional
Probab=74.86  E-value=3.2  Score=27.77  Aligned_cols=36  Identities=17%  Similarity=0.212  Sum_probs=29.9

Q ss_pred             cccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          25 ELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        25 ~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.+.+|.++|++  ++.+++.+.++. ++++.+.+++.
T Consensus       265 ~~~~~~v~~im~~--~~~~v~~~~~l~-~a~~~m~~~~~  300 (326)
T PRK10892        265 DLRQASIADVMTP--GGIRVRPGILAV-DALNLMQSRHI  300 (326)
T ss_pred             CcccCCHHHhcCC--CCEEECCCCCHH-HHHHHHHHCCC
Confidence            3556789999987  678999999999 79999888764


No 30 
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC.  SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A ), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus).  SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB.  It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. EriC is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase a
Probab=73.81  E-value=3.3  Score=22.35  Aligned_cols=35  Identities=17%  Similarity=0.255  Sum_probs=28.0

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +...++.++|.+.  ..+++.+.++. ++++.+.++++
T Consensus        55 ~~~~~v~~~~~~~--~~~v~~~~~~~-~~~~~~~~~~~   89 (114)
T cd04613          55 YDLVVASDIMTKP--PVVVYPEDSLE-DALKKFEDSDY   89 (114)
T ss_pred             cccEEHHHhccCC--CcEEcCCCCHH-HHHHHHhhCCc
Confidence            3447899999775  78888999998 79988887764


No 31 
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=71.07  E-value=3.5  Score=22.37  Aligned_cols=34  Identities=26%  Similarity=0.350  Sum_probs=27.6

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.++.++|.+  .+.+++.+.++. ++++.+.+++.
T Consensus        56 ~~~~~~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   89 (112)
T cd04802          56 REVPVGEVMST--PLITIDPNASLN-EAAKLMAKHGI   89 (112)
T ss_pred             ccCCHHHhcCC--CcEEECCCCCHH-HHHHHHHHcCC
Confidence            45689999965  588889999998 79999887664


No 32 
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=70.59  E-value=3.2  Score=24.05  Aligned_cols=33  Identities=12%  Similarity=0.254  Sum_probs=26.9

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.+++++|++  ....++.+.++. ++++.+.+.++
T Consensus        80 ~~~v~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~  112 (135)
T cd04621          80 PLVAEDIMTE--EIITVSPNDDVV-DAAKLMLEANI  112 (135)
T ss_pred             cccHHHhcCC--CCeEECCCCCHH-HHHHHHHHcCC
Confidence            5689999976  567899999998 79999887765


No 33 
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=70.44  E-value=3.5  Score=22.37  Aligned_cols=34  Identities=15%  Similarity=0.196  Sum_probs=27.6

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      +.+..+.++|.+  .+.+++.+.++. ++++.+.+++
T Consensus        55 ~~~~~i~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~   88 (113)
T cd04615          55 LKDAKVREVMNS--PVITIDANDSIA-KARWLMSNNN   88 (113)
T ss_pred             hcCCcHHHhccC--CceEECCCCcHH-HHHHHHHHcC
Confidence            456789999975  578899999998 7999887765


No 34 
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]
Probab=68.09  E-value=3.4  Score=26.62  Aligned_cols=54  Identities=17%  Similarity=0.161  Sum_probs=37.1

Q ss_pred             ccCCCCHHH---HHHHHhhhcc--cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850           8 EFNDLEKDE---VNIISGALEL--RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus         8 ~~g~l~~~e---~~ml~~~l~~--~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      +.|.+++.-   ++|+.-..+-  ...+++.+|+  ..++.+..+.++. ++++.+.+.|||
T Consensus        39 E~G~vdPrlSt~k~Il~aL~e~e~~~ita~~iM~--spvv~v~pdDsi~-~vv~lM~~~g~S   97 (187)
T COG3620          39 EAGKVDPRLSTVKRILEALEEAEKTRITAKTIMH--SPVVSVSPDDSIS-DVVNLMRDKGIS   97 (187)
T ss_pred             hcCCCCccHHHHHHHHHHHHHhhcceEeHhhhcc--CCeeEECchhhHH-HHHHHHHHcCCc
Confidence            345555432   3333333333  3356778887  5789999999999 799999999998


No 35 
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or
Probab=67.84  E-value=3.3  Score=22.48  Aligned_cols=34  Identities=15%  Similarity=0.166  Sum_probs=27.7

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.+++++|.+  +...++.+.++. ++++.+.++++
T Consensus        55 ~~~~i~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   88 (111)
T cd04589          55 SSTPVGEIATF--PLITVDPDDFLF-NALLLMTRHRI   88 (111)
T ss_pred             CCCCHHHHhCC--CcEEECCCCcHH-HHHHHHHHhCc
Confidence            35678899965  688999999998 79999888765


No 36 
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS do
Probab=67.74  E-value=4.9  Score=21.74  Aligned_cols=32  Identities=16%  Similarity=0.174  Sum_probs=25.6

Q ss_pred             eeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          29 KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        29 ~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .++.++|.+.  ..+++.+.++. ++++.+.+++.
T Consensus        50 ~~~~~~~~~~--~~~v~~~~~l~-~a~~~~~~~~~   81 (104)
T cd04594          50 GDVVDYIVRG--IPYVRLTSTAE-EAWEVMMKNKT   81 (104)
T ss_pred             cchhhhhhcC--CcEEcCCCCHH-HHHHHHHHcCc
Confidence            4578888654  67899999998 79999887764


No 37 
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzi
Probab=67.41  E-value=6.7  Score=20.95  Aligned_cols=32  Identities=19%  Similarity=0.189  Sum_probs=25.2

Q ss_pred             eeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          29 KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        29 ~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .++.++|.|.  ...++.+.++. ++++.+.+.++
T Consensus        51 ~~~~~~~~~~--~~~~~~~~~~~-~~~~~~~~~~~   82 (106)
T cd04582          51 GCCGDHAEPF--KVTVSVDDDLR-IVLSRMFAHDM   82 (106)
T ss_pred             cchhhhcccC--CEEECCCCCHH-HHHHHHHHCCC
Confidence            3588999764  56688999998 79999888765


No 38 
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=67.40  E-value=2.4  Score=23.91  Aligned_cols=37  Identities=30%  Similarity=0.304  Sum_probs=27.6

Q ss_pred             ccCeeecceeeecccEEEEe----CCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLS----YDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~----~~~~~~~e~l~~i~~~g~   63 (64)
                      ..+.++.++|.+...+..++    .++++. ++++.+.+++.
T Consensus        61 ~~~~~v~~im~~~~~~~~~~~~~~~~~~l~-~~l~~m~~~~~  101 (126)
T cd04640          61 RSELTVADVMTPKEDLKALDLEELENASVG-DVVETLKASGR  101 (126)
T ss_pred             chheEHHHhcCchhhhccccHHHhccCcHH-HHHHHHHHCCC
Confidence            35677999998766555654    577887 69999988775


No 39 
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=66.96  E-value=3.7  Score=22.57  Aligned_cols=35  Identities=23%  Similarity=0.382  Sum_probs=28.4

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.+.++.++|.+  ....++.+.++. ++++.+.+.++
T Consensus        64 ~~~~~~~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   98 (121)
T cd04633          64 IRNLPVSDIMTR--PVITIEPDTSVS-DVASLMLENNI   98 (121)
T ss_pred             hhccCHHHHccC--CceEECCCCcHH-HHHHHHHHcCC
Confidence            356688899964  688999999999 79999988775


No 40 
>PF14044 NETI:  NETI protein
Probab=66.94  E-value=5  Score=21.30  Aligned_cols=22  Identities=5%  Similarity=0.202  Sum_probs=18.9

Q ss_pred             EEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          42 YMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        42 ~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      |-+..+.+++ +.|+++.+.||.
T Consensus         2 FeV~enETI~-~CL~RM~~eGY~   23 (57)
T PF14044_consen    2 FEVEENETIS-DCLARMKKEGYM   23 (57)
T ss_pred             eeccCCCcHH-HHHHHHHHcCCC
Confidence            4567889999 799999999995


No 41 
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=66.68  E-value=4  Score=23.10  Aligned_cols=31  Identities=23%  Similarity=0.347  Sum_probs=25.6

Q ss_pred             eecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          30 IVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        30 ~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++.++|.+  ++..++.+.++. ++++.+.+.|+
T Consensus        79 ~v~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~  109 (132)
T cd04636          79 KVEEIMTK--KVITVDEDTTIE-DVARIMSKKNI  109 (132)
T ss_pred             CHHHhccC--CceEECCCCcHH-HHHHHHHHCCC
Confidence            78889964  578899999998 79998888765


No 42 
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain. BON is a putative phospholipid-binding domain found in a family of osmotic shock protection proteins. It is also found in some secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=66.04  E-value=4  Score=23.20  Aligned_cols=35  Identities=26%  Similarity=0.266  Sum_probs=28.9

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ....++.++|.+  ...+++.+.++. ++++.+.+.|.
T Consensus        78 ~~~~~v~~~~~~--~~~~v~~~~~~~-~~~~~~~~~~~  112 (135)
T cd04586          78 SHGRKVADVMTR--PVVTVGEDTPLA-EVAELMEEHRI  112 (135)
T ss_pred             hcCCCHHHHhCC--CceEeCCCCcHH-HHHHHHHHcCC
Confidence            456789999965  678899999998 79999888775


No 43 
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=65.77  E-value=5.8  Score=21.42  Aligned_cols=34  Identities=24%  Similarity=0.262  Sum_probs=27.9

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.++.++|.+  ...+++.+.++. ++++.+.+.+.
T Consensus        54 ~~~~~~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   87 (110)
T cd04595          54 GHAPVKDYMST--DVVTVPPDTPLS-EVQELMVEHDI   87 (110)
T ss_pred             ccCcHHHHhcC--CCEEECCCCcHH-HHHHHHHHcCC
Confidence            56789999975  678899999998 69998887764


No 44 
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=65.21  E-value=5.1  Score=21.66  Aligned_cols=36  Identities=28%  Similarity=0.375  Sum_probs=27.3

Q ss_pred             cccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          25 ELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        25 ~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .....++.++|.+  ....++.+.++. ++++.+.++++
T Consensus        54 ~~~~~~~~~~~~~--~~~~v~~~~~~~-~~~~~~~~~~~   89 (113)
T cd04622          54 DPDTTTVGDVMTR--GVVTVTEDDDVD-EAARLMREHQV   89 (113)
T ss_pred             CcccCCHHHhccC--CccEECCCCCHH-HHHHHHHHcCC
Confidence            3344459999965  577889999998 69988877664


No 45 
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=64.82  E-value=4.6  Score=21.54  Aligned_cols=33  Identities=27%  Similarity=0.348  Sum_probs=27.2

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +..+.++|.+  ....++.+.++. ++++.+.++++
T Consensus        50 ~~~~~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   82 (105)
T cd04599          50 NRLVADAMTR--EVVTISPEASLL-EAKRLMEEKKI   82 (105)
T ss_pred             cCCHHHHccC--CCEEECCCCCHH-HHHHHHHHcCC
Confidence            4568899965  688899999998 79999988875


No 46 
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional
Probab=64.19  E-value=3  Score=30.31  Aligned_cols=35  Identities=9%  Similarity=0.131  Sum_probs=28.0

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++..+|+|+|+|.  ...++.+.++. ++++.+.++++
T Consensus       444 L~~~~V~dim~~~--~~~v~~~~tl~-ea~~~l~~~~~  478 (574)
T PRK01862        444 LRTTQMRELIQPA--QTVVPPTASVA-DMTRVFLEYPV  478 (574)
T ss_pred             HhhCcHHHHhcCC--CceeCCCCCHH-HHHHHHHhCCC
Confidence            5678999999874  45688899998 68988887764


No 47 
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=63.72  E-value=5.1  Score=21.69  Aligned_cols=34  Identities=18%  Similarity=0.180  Sum_probs=26.9

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.++.++|.+  ....++.+.++. ++++.+.+++.
T Consensus        56 ~~~~v~~~~~~--~~~~v~~~~~l~-~a~~~m~~~~~   89 (112)
T cd04625          56 LDTTVRAIMNP--EPIVASPDDSID-EVRRLMVERHL   89 (112)
T ss_pred             hcCCHHHHhCC--CCeEECCCCCHH-HHHHHHHHcCC
Confidence            45679999954  577899999998 79999887654


No 48 
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=63.66  E-value=5  Score=21.46  Aligned_cols=33  Identities=9%  Similarity=0.161  Sum_probs=25.6

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +..++++|.++  ...++.+.++. ++++.+.+++.
T Consensus        51 ~~~~~~~~~~~--~~~v~~~~~l~-~~~~~~~~~~~   83 (107)
T cd04610          51 DETVEEIMSKD--LVVAVPEMDIM-DAARVMFRTGI   83 (107)
T ss_pred             cccHHHhCCCC--CeEECCCCCHH-HHHHHHHHhCC
Confidence            45688999654  67788999998 68988877653


No 49 
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=61.48  E-value=4.2  Score=22.76  Aligned_cols=35  Identities=17%  Similarity=0.238  Sum_probs=27.8

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.+..++++|.+  ++.+++.+.++. ++++.+.++++
T Consensus        68 ~~~~~~~~~~~~--~~~~v~~~~~l~-~~l~~~~~~~~  102 (128)
T cd04632          68 MLDLPVYDAMSS--PVITASPNDSVR-DAVDRMLENDD  102 (128)
T ss_pred             hccCcHHHHhcC--CCceECCCCcHH-HHHHHHHhCCC
Confidence            345678999964  588899999998 79998887764


No 50 
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=60.57  E-value=4  Score=22.20  Aligned_cols=32  Identities=25%  Similarity=0.206  Sum_probs=26.0

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      +.++.++|.|.  ..+++.+.++. ++++.+.+.+
T Consensus        62 ~~~v~~~~~~~--~~~v~~~~~l~-~a~~~~~~~~   93 (116)
T cd04643          62 DLKVIDVMNTD--VPVIIDDADIE-EILHLLIDQP   93 (116)
T ss_pred             CCcHHHHhcCC--CceecCCCCHH-HHHHHHhcCC
Confidence            67899999774  77788999998 6888887654


No 51 
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein.  IMPDH is an essential enzyme that catalyzes the first step unique to GTP synthesis, playing a key role in the regulation of cell proliferation and differentiation. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain in IMPDH have been associated with retinitis pigmentosa.
Probab=59.16  E-value=7.7  Score=20.73  Aligned_cols=33  Identities=21%  Similarity=0.227  Sum_probs=24.0

Q ss_pred             CeeecceeeecccEEEEeC-CCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSY-DAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~-~~~~~~e~l~~i~~~g~   63 (64)
                      +.++.++|.+...+  +.. +.++. ++++.+.+.++
T Consensus        53 ~~~v~~~~~~~~~~--~~~~~~~l~-~~~~~~~~~~~   86 (110)
T cd04601          53 DKPVSEVMTPENLL--TTVEGTSLE-EALELLHEHKI   86 (110)
T ss_pred             CCCHHHhcccCceE--EecCCCCHH-HHHHHHHHhCC
Confidence            46788999665433  344 88888 79999988775


No 52 
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=59.01  E-value=7.8  Score=21.14  Aligned_cols=35  Identities=20%  Similarity=0.135  Sum_probs=27.5

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..+.++.++|.+  .+..++.+.++. ++++.+.+.+.
T Consensus        57 ~~~~~v~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   91 (114)
T cd04630          57 PDRVNVYEIMTK--PLISVSPDMDIK-YCARLMERTNI   91 (114)
T ss_pred             CCccCHHHHhcC--CCeeECCCCCHH-HHHHHHHHcCC
Confidence            345678999953  688999999998 79998877653


No 53 
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]
Probab=58.80  E-value=6.8  Score=27.67  Aligned_cols=36  Identities=19%  Similarity=0.315  Sum_probs=31.7

Q ss_pred             cccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          25 ELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        25 ~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+++.+..+||.+  +|++++.+++++ ...+++.+++.
T Consensus       241 ~~~~LtcadIMSr--dVvtv~~~ts~d-hA~~ll~~H~i  276 (382)
T COG3448         241 RMGELTCADIMSR--DVVTVSTDTSID-HARKLLQEHRI  276 (382)
T ss_pred             HhccccHHHhcCc--cceecCCcCChH-HHHHHHHHcCc
Confidence            5789999999986  799999999999 69999988864


No 54 
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pai
Probab=57.58  E-value=10  Score=20.37  Aligned_cols=32  Identities=19%  Similarity=0.205  Sum_probs=25.6

Q ss_pred             eeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          29 KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        29 ~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +++.++|.+  ...+++.+.++. ++++.+.+++.
T Consensus        58 ~~v~~i~~~--~~~~v~~~~~l~-~~~~~~~~~~~   89 (113)
T cd04587          58 TLVERVMTP--NPVCATSDTPVL-EALHLMVQGKF   89 (113)
T ss_pred             CCHHHhcCC--CCeEEcCCCCHH-HHHHHHHHcCC
Confidence            678899954  567899999998 69999887663


No 55 
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=56.18  E-value=6.7  Score=22.71  Aligned_cols=34  Identities=26%  Similarity=0.398  Sum_probs=27.2

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ....+.++|.+  ...+++.+.++. +++..+.+.++
T Consensus        87 ~~~~v~~~~~~--~~~~v~~~~~l~-~a~~~~~~~~~  120 (143)
T cd04634          87 GKMKVRDIMTK--KVITISPDASIE-DAAELMVRHKI  120 (143)
T ss_pred             hcCCHHHHcCC--CCeEECCCCcHH-HHHHHHHHcCC
Confidence            45678889965  578999999998 79998887765


No 56 
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional
Probab=55.51  E-value=8.6  Score=27.73  Aligned_cols=34  Identities=29%  Similarity=0.336  Sum_probs=29.2

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...|+++|+ +.+...++.+.++. ++.+.+.++++
T Consensus       245 ~~~V~~iM~-~~~~~~~~~~~~~~-~~~~~m~~~~~  278 (546)
T PRK14869        245 SIPVSYIMT-TEDLVTFSKDDYLE-DVKEVMLKSRY  278 (546)
T ss_pred             CCCHHHhcc-CCCcEEECCCCcHH-HHHHHHHhcCC
Confidence            578999998 46789999999999 79999988775


No 57 
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain. These proteins are integral membrane proteins with four transmembrane spanning helices. The function of these proteins is uncertain, but they are thought to be transporters. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=55.38  E-value=9  Score=21.05  Aligned_cols=33  Identities=24%  Similarity=0.361  Sum_probs=26.6

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      ....+.++|.+  ...+++.+.++. ++++.+.+.+
T Consensus        67 ~~~~i~~~~~~--~~~~~~~~~~l~-~~~~~~~~~~   99 (124)
T cd04600          67 KPETVGDIMSP--PVVTVRPDTPIA-ELVPLLADGG   99 (124)
T ss_pred             ccccHHHhccC--CCeeeCCCCcHH-HHHHHHHhcC
Confidence            34578899965  688899999999 7999988765


No 58 
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=55.13  E-value=8.3  Score=20.83  Aligned_cols=34  Identities=12%  Similarity=0.112  Sum_probs=27.2

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+..+.++|.+  ...+++.+.++. ++++.+.+++.
T Consensus        51 ~~~~v~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   84 (108)
T cd04596          51 PDTTIEKVMTK--NPITVNPKTSVA-SVAHMMIWEGI   84 (108)
T ss_pred             ccccHHHHhcC--CCeEECCCCCHH-HHHHHHHHcCC
Confidence            45679999975  577899999998 79998887653


No 59 
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=54.72  E-value=9.7  Score=20.86  Aligned_cols=34  Identities=26%  Similarity=0.353  Sum_probs=26.8

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ....+.++|.  .....++.+.++. ++++.+.+.+.
T Consensus        65 ~~~~v~~~~~--~~~~~v~~~~~~~-~~~~~~~~~~~   98 (122)
T cd04803          65 RDVPVAEVMK--TDVLTVTPDTPLR-EAAEIMVENKI   98 (122)
T ss_pred             cCcCHHHhhC--CCCeEeCCCCcHH-HHHHHHHHcCC
Confidence            4667888884  4677899999998 79998887664


No 60 
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=54.56  E-value=7.9  Score=21.14  Aligned_cols=33  Identities=24%  Similarity=0.306  Sum_probs=26.7

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      .+.++.++|.+  ....++.+.++. +++..+.+++
T Consensus        59 ~~~~v~~~~~~--~~~~v~~~~~~~-~~~~~~~~~~   91 (119)
T cd04598          59 GKKPVSEVMDP--DPLIVEADTPLE-EVSRLATGRD   91 (119)
T ss_pred             cCCcHHHhcCC--CcEEecCCCCHH-HHHHHHHcCC
Confidence            56789999965  588899999998 6888887665


No 61 
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional
Probab=54.40  E-value=6.6  Score=28.30  Aligned_cols=33  Identities=18%  Similarity=0.145  Sum_probs=28.5

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..+|+++|++  ++..++.+.++. ++++.+.++++
T Consensus        67 ~~~V~dim~~--~~~~v~~~~~l~-~a~~~m~~~~~   99 (546)
T PRK14869         67 KPQVRDLEID--KPVTVSPDTSLK-EAWNLMDENNV   99 (546)
T ss_pred             CCcHHHhcCC--CCcEECCCCcHH-HHHHHHHHcCC
Confidence            3689999985  789999999999 79999988775


No 62 
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=53.59  E-value=9.5  Score=20.57  Aligned_cols=33  Identities=24%  Similarity=0.322  Sum_probs=26.9

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      .+..+.++|.+  ....++.+.++. ++++.+.+.+
T Consensus        58 ~~~~v~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~   90 (114)
T cd04629          58 GVATVRDIMTT--EVLTVSPDDSIV-DLAQLMLKAK   90 (114)
T ss_pred             CCccHHHHhcc--CceEECCCCcHH-HHHHHHHHhC
Confidence            35678899975  578899999999 7999888765


No 63 
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pa
Probab=53.22  E-value=10  Score=20.37  Aligned_cols=33  Identities=21%  Similarity=0.188  Sum_probs=26.8

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.++.++|.+  .+.+++.+.++. ++++.+.+++.
T Consensus        56 ~~~i~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   88 (111)
T cd04800          56 DTPVSEVMTA--PPITIPPDATVF-EALLLMLERGI   88 (111)
T ss_pred             cCCHHHHhCC--CCeEECCCCcHH-HHHHHHHHcCC
Confidence            4678898854  688999999999 79999888764


No 64 
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=53.22  E-value=9.8  Score=20.83  Aligned_cols=34  Identities=18%  Similarity=0.323  Sum_probs=26.9

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...++.++|.  .+..+++.+.++. ++++.+.+++.
T Consensus        65 ~~~~~~~~~~--~~~~~v~~~~~l~-~~~~~~~~~~~   98 (122)
T cd04635          65 ASPTVEKIMS--TPVYSVTPDDSIA-TAVELMLEHDI   98 (122)
T ss_pred             ccCcHHHHhc--CCCeeECCCCCHH-HHHHHHHHcCC
Confidence            4567888885  4678899999998 79998888764


No 65 
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=52.96  E-value=11  Score=20.46  Aligned_cols=33  Identities=12%  Similarity=0.155  Sum_probs=26.3

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +..+.++|.+  .+..++.+.++. ++++.+.+++.
T Consensus        57 ~~~v~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~   89 (113)
T cd04607          57 DDPVSEVMNR--NPITAKVGSSRE-EILALMRERSI   89 (113)
T ss_pred             CCCHHHhhcC--CCEEEcCCCCHH-HHHHHHHHCCC
Confidence            3568899964  477899999998 79999888754


No 66 
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CB
Probab=52.87  E-value=9.5  Score=20.39  Aligned_cols=34  Identities=18%  Similarity=0.217  Sum_probs=27.2

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+..+.++|.+  .+..++.+.++. ++++.+.+.+.
T Consensus        54 ~~~~v~~~~~~--~~~~~~~~~~l~-~~l~~~~~~~~   87 (111)
T cd04611          54 LQTPVGEVMSS--PLLTVPADTSLY-DARQLMREHGI   87 (111)
T ss_pred             CCcCHHHhcCC--CceEECCCCCHH-HHHHHHHHcCC
Confidence            46778999865  678899999998 69998887653


No 67 
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=52.57  E-value=7.9  Score=21.32  Aligned_cols=33  Identities=15%  Similarity=0.331  Sum_probs=26.5

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..++.++|.+  .+..++.+.++. ++++.+.+.+.
T Consensus        69 ~~~~~~~~~~--~~~~v~~~~~l~-~~~~~~~~~~~  101 (125)
T cd04631          69 NEPVRSIMTR--NVITITPDDSIK-DAAELMLEKRV  101 (125)
T ss_pred             hcCHHHHhcC--CceEeCCCCcHH-HHHHHHHHcCC
Confidence            4578888864  689999999998 68988887653


No 68 
>TIGR00400 mgtE Mg2+ transporter (mgtE). This family of prokaryotic proteins models a class of Mg++ transporter first described in Bacillus firmus. May form a homodimer.
Probab=51.39  E-value=8.9  Score=27.23  Aligned_cols=34  Identities=18%  Similarity=0.189  Sum_probs=28.2

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+..++++|+|  +.++++.+.++. ++++.+.++++
T Consensus       193 ~~~~v~~im~~--~~~~v~~~~~~~-eal~~m~~~~~  226 (449)
T TIGR00400       193 PEEILSSIMRS--SVFSIVGVNDQE-EVARLIQKYDF  226 (449)
T ss_pred             CCCcHHHHhCC--CCeeECCCCCHH-HHHHHHHHcCC
Confidence            45689999987  577899999998 79999887764


No 69 
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=51.30  E-value=10  Score=20.78  Aligned_cols=34  Identities=18%  Similarity=0.130  Sum_probs=27.4

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.++.++|.+  ....++.+.++. ++++.+.+++.
T Consensus        57 ~~~~v~~~~~~--~~~~v~~~~~l~-~a~~~m~~~~~   90 (114)
T cd04619          57 CTAPVENVMTR--AVVSCRPGDLLH-DVWQVMKQRGL   90 (114)
T ss_pred             ccCCHHHHhcC--CCeeECCCCCHH-HHHHHHHHcCC
Confidence            34678999954  677899999998 79999888765


No 70 
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=50.10  E-value=13  Score=20.04  Aligned_cols=33  Identities=18%  Similarity=0.384  Sum_probs=26.6

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +.++.++|.  ..+..++.+.++. ++++.+.+++.
T Consensus        56 ~~~v~~~~~--~~~~~v~~~~~l~-~~~~~~~~~~~   88 (111)
T cd04626          56 EKKVFNIVS--QDVFYVNEEDTID-EALDIMREKQI   88 (111)
T ss_pred             cCcHHHHhc--CCcEEEcCCCcHH-HHHHHHHHcCC
Confidence            457888885  4678899999998 79999888764


No 71 
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein.  IMPDH is an essential enzyme that catalyzes the first step unique to GTP synthesis, playing a key role in the regulation of cell proliferation and differentiation. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain in IMPDH have been associated with retinitis pigmentos
Probab=49.79  E-value=12  Score=20.40  Aligned_cols=35  Identities=20%  Similarity=0.204  Sum_probs=26.8

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...++++|.+....+..+.+.++. ++++.+.+++.
T Consensus        56 ~~~v~~~~~~~~~~~~~~~~~~l~-~~l~~~~~~~~   90 (114)
T cd04602          56 ETPLSEVMTPREVLVVAPTGITLE-EANEILRESKK   90 (114)
T ss_pred             CCCHHHhcCCCceEEECCCCCCHH-HHHHHHHhcCC
Confidence            345889998777766666699998 69998887764


No 72 
>COG0517 FOG: CBS domain [General function prediction only]
Probab=49.69  E-value=28  Score=18.68  Aligned_cols=41  Identities=24%  Similarity=0.319  Sum_probs=29.6

Q ss_pred             HHHHHhhhcccCe--eecceeeecccEEEEeCCCCCCHHHHHHHHh
Q psy4850          17 VNIISGALELRRK--IVGDVMTKLEDVYMLSYDAILDFETVSEIMK   60 (64)
Q Consensus        17 ~~ml~~~l~~~~~--~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~   60 (64)
                      ++++.....-...  .+.++|++  .+++++.+.++. ++.+.+.+
T Consensus        48 ~di~~~~~~~~~~~~~v~~v~~~--~~~~~~~~~~~~-~~~~~m~~   90 (117)
T COG0517          48 RDILRALAAGGKRLLPVKEVMTK--PVVTVDPDTPLE-EALELMVE   90 (117)
T ss_pred             HHHHHHHhccCCccccHHHhccC--CcEEECCCCCHH-HHHHHHHH
Confidence            3444444433333  58999998  888999999998 68888776


No 73 
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase. This model describes a rather tightly conserved cluster of IMP dehydrogenase sequences, many of which are characterized. The model excludes two related families of proteins proposed also to be IMP dehydrogenases, but without characterized members. These are related families are the subject of separate models.
Probab=49.62  E-value=10  Score=27.06  Aligned_cols=35  Identities=26%  Similarity=0.355  Sum_probs=29.0

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.+++++|+| .++.+++.+.++. ++++.+.+++.
T Consensus       141 ~~~~V~dvm~~-~~~~~V~~~~sl~-eal~~m~~~~~  175 (450)
T TIGR01302       141 KGKPVSEVMTR-EEVITVPEGIDLE-EALKVLHEHRI  175 (450)
T ss_pred             CCCCHHHhhCC-CCCEEECCCCcHH-HHHHHHHHcCC
Confidence            35679999986 5889999999999 79998887764


No 74 
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=49.48  E-value=21  Score=19.42  Aligned_cols=24  Identities=0%  Similarity=0.131  Sum_probs=19.5

Q ss_pred             ccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          39 EDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        39 ~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++++.++.+.++. ++.+.+.++++
T Consensus         1 ~~~~~v~~~~~l~-~a~~~~~~~~~   24 (98)
T cd04618           1 SKLVVFDTKLPVK-KAFNALVENGI   24 (98)
T ss_pred             CeEEEECCCCcHH-HHHHHHHHcCC
Confidence            3678899999998 68888887764


No 75 
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]
Probab=48.89  E-value=7.8  Score=26.67  Aligned_cols=40  Identities=18%  Similarity=0.248  Sum_probs=33.3

Q ss_pred             HhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          21 SGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        21 ~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .++..+...+|.++|++  +..++..+.++. |....+.+.|.
T Consensus       164 ~~m~siPk~~V~~~~s~--~~i~v~~d~tl~-eaak~f~~~~i  203 (294)
T COG2524         164 SKMVSIPKEKVKNLMSK--KLITVRPDDTLR-EAAKLFYEKGI  203 (294)
T ss_pred             eeeeecCcchhhhhccC--CceEecCCccHH-HHHHHHHHcCc
Confidence            45567788889999986  678899999999 79999998875


No 76 
>PF08899 DUF1844:  Domain of unknown function (DUF1844);  InterPro: IPR014995 This group of proteins are functionally uncharacterised. 
Probab=47.62  E-value=20  Score=19.88  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=15.6

Q ss_pred             cccCCCCHHHHHHHHhhh
Q psy4850           7 TEFNDLEKDEVNIISGAL   24 (64)
Q Consensus         7 ~~~g~l~~~e~~ml~~~l   24 (64)
                      .-.|-|+++|.++|.+++
T Consensus        50 KTkGNL~~~E~~lL~~~L   67 (74)
T PF08899_consen   50 KTKGNLDEEEERLLESAL   67 (74)
T ss_pred             HHccCCCHHHHHHHHHHH
Confidence            457889999999999986


No 77 
>PF04545 Sigma70_r4:  Sigma-70, region 4;  InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors is involved in binding to the -35 promoter element via a helix-turn-helix motif []. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2P7V_B 3IYD_F 1TLH_B 1KU7_A 1RIO_H 3N97_A 1KU3_A 1RP3_C 1SC5_A 1NR3_A ....
Probab=45.82  E-value=17  Score=17.60  Aligned_cols=23  Identities=13%  Similarity=0.196  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHhhhcccCeeecce
Q psy4850          11 DLEKDEVNIISGALELRRKIVGDV   34 (64)
Q Consensus        11 ~l~~~e~~ml~~~l~~~~~~v~dv   34 (64)
                      .|++.|+++|.-.+ +.+.+..+|
T Consensus         4 ~L~~~er~vi~~~y-~~~~t~~eI   26 (50)
T PF04545_consen    4 QLPPREREVIRLRY-FEGLTLEEI   26 (50)
T ss_dssp             TS-HHHHHHHHHHH-TST-SHHHH
T ss_pred             hCCHHHHHHHHHHh-cCCCCHHHH
Confidence            57888899888887 666665554


No 78 
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS d
Probab=45.73  E-value=17  Score=19.77  Aligned_cols=33  Identities=15%  Similarity=0.169  Sum_probs=26.0

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...++++|.+  ....++.+.++. ++++.+.+++.
T Consensus        57 ~~~~~~~~~~--~~~~v~~~~~l~-~~l~~~~~~~~   89 (115)
T cd04593          57 PSAVDEVATP--PLLTVHPDEPLA-HALDRMASRGL   89 (115)
T ss_pred             cccHHHhccC--CceEECCCCCHH-HHHHHHHHcCC
Confidence            3447888864  688899999998 79999887764


No 79 
>TIGR00393 kpsF KpsF/GutQ family protein. This model describes a number of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain. One is GutQ, a protein of the glucitol operon. Another is KpsF, a virulence factor involved in capsular polysialic acid biosynthesis in some pathogenic strains of E. coli.
Probab=45.22  E-value=13  Score=23.86  Aligned_cols=34  Identities=24%  Similarity=0.221  Sum_probs=27.6

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+.+++++|.+  ....++.+.++. ++++.+.+.+.
T Consensus       218 ~~~~v~~im~~--~~~~v~~~~~l~-~a~~~m~~~~~  251 (268)
T TIGR00393       218 LKSEVRDFMTL--GPKTFKLDALLL-EALEFLERRKI  251 (268)
T ss_pred             ccCcHHHhCCC--CCeEECCCCcHH-HHHHHHHHcCC
Confidence            35679999965  477899999998 79999988764


No 80 
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=45.19  E-value=23  Score=19.43  Aligned_cols=24  Identities=8%  Similarity=0.124  Sum_probs=19.1

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      ++..++.+.++. ++++.+.+++++
T Consensus         2 ~~~~i~~~~~l~-~a~~~~~~~~~~   25 (120)
T cd04641           2 NIATARPDTPLI-DVLDMLVERRVS   25 (120)
T ss_pred             CcEEEcCCCCHH-HHHHHHHHcCCC
Confidence            567888899998 688888887754


No 81 
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in magnesium and cobalt efflux, and in association with some proteins of unknown function.  The function of the CorC_HlyC domain is uncertain but it might be involved in modulating transport of ion substrates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role,
Probab=45.10  E-value=25  Score=18.81  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=17.2

Q ss_pred             ccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          39 EDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        39 ~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +++..++.+.++. ++++.+.+.++
T Consensus         1 ~~~~~i~~~~~i~-~a~~~~~~~~~   24 (111)
T cd04590           1 TDIVALDADDTLE-EILELIAESGH   24 (111)
T ss_pred             CceEEEcCCCCHH-HHHHHHhhCCC
Confidence            3567788888888 67777766654


No 82 
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=44.36  E-value=14  Score=19.79  Aligned_cols=34  Identities=24%  Similarity=0.215  Sum_probs=27.1

Q ss_pred             cCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      .+..+.++|.  ..+..++.+.++. ++++.+.+++.
T Consensus        54 ~~~~v~~~~~--~~~~~i~~~~~~~-~~~~~~~~~~~   87 (111)
T cd04639          54 PDAPVRGVMR--RDFPTVSPSATLD-AVLRLMQQGGA   87 (111)
T ss_pred             CCCcHHHHhc--CCCcEECCCCcHH-HHHHHHHhcCC
Confidence            3457889995  4688999999998 79988887654


No 83 
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyz
Probab=43.42  E-value=20  Score=19.02  Aligned_cols=31  Identities=29%  Similarity=0.486  Sum_probs=24.8

Q ss_pred             eeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          29 KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        29 ~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      ..+.++|.+  .+..++.+.++. ++++.+.+.+
T Consensus        54 ~~v~~~~~~--~~~~v~~~~~~~-~~~~~~~~~~   84 (109)
T cd04583          54 KSLEDIMLE--DVFTVQPDASLR-DVLGLVLKRG   84 (109)
T ss_pred             CcHhHhhcC--CceEECCCCcHH-HHHHHHHHcC
Confidence            568888965  578899999998 6888887754


No 84 
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein. This model represents a family of proteins, often annotated as a putative IMP dehydrogenase, related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria. All species in which a member is found so far (Corynebacterium glutamicum, Mycobacterium tuberculosis, Streptomyces coelicolor, etc.) also have IMP dehydrogenase as described by TIGRFAMs entry TIGR01302.
Probab=41.85  E-value=16  Score=26.46  Aligned_cols=32  Identities=16%  Similarity=0.184  Sum_probs=27.3

Q ss_pred             eeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          29 KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        29 ~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..++++|++  ++.+++.+.++. ++++.+.+++.
T Consensus       146 ~~V~dIMt~--~litv~~~~sL~-eAl~lM~~~~i  177 (475)
T TIGR01303       146 TQVRDIMST--DLVTAPADTEPR-KAFDLLEHAPR  177 (475)
T ss_pred             CCHHHHccC--CceEeCCCCcHH-HHHHHHHHcCC
Confidence            569999985  688999999998 79999888764


No 85 
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=41.73  E-value=30  Score=18.40  Aligned_cols=23  Identities=9%  Similarity=0.177  Sum_probs=15.1

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++++++.+.++. +++..+.+.++
T Consensus         2 ~~~~~~~~~~~~-~~~~~~~~~~~   24 (106)
T cd04638           2 NVVYVTLPGTRD-DVLELLKEYKV   24 (106)
T ss_pred             CcEEECCCCCHH-HHHHHHHHcCC
Confidence            566777777776 56666665554


No 86 
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=41.40  E-value=26  Score=18.88  Aligned_cols=33  Identities=21%  Similarity=0.206  Sum_probs=23.5

Q ss_pred             cCeeecceeeecccEEEEeCC--CCCCHHHHHHHHhcC
Q psy4850          27 RRKIVGDVMTKLEDVYMLSYD--AILDFETVSEIMKSE   62 (64)
Q Consensus        27 ~~~~v~dvM~Pr~~v~~l~~~--~~~~~e~l~~i~~~g   62 (64)
                      .+.++.++|.+  .+..++.+  .++. ++++.+.+++
T Consensus        56 ~~~~i~~~~~~--~~~~v~~~~~~~l~-~a~~~~~~~~   90 (115)
T cd04620          56 SDLPIGEVMTQ--PVVTLQESEIQDIF-TALSLFRQHQ   90 (115)
T ss_pred             cccCHHHhcCC--CcEEEecccccCHH-HHHHHHHHhC
Confidence            45678899965  56667665  5676 6888888765


No 87 
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=38.53  E-value=35  Score=18.92  Aligned_cols=24  Identities=13%  Similarity=0.109  Sum_probs=18.1

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSESK   64 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~S   64 (64)
                      ++..++.+.++. ++++.+.+.+++
T Consensus         2 ~~~~v~~~~~~~-~a~~~~~~~~~~   25 (126)
T cd04642           2 KVVSIDSDERVL-DAFKLMRKNNIS   25 (126)
T ss_pred             CeEEECCCccHH-HHHHHHHHhCCC
Confidence            567788888888 688877766653


No 88 
>KOG2550|consensus
Probab=38.45  E-value=19  Score=26.43  Aligned_cols=34  Identities=24%  Similarity=0.277  Sum_probs=25.1

Q ss_pred             CCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCC
Q psy4850          12 LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILD   51 (64)
Q Consensus        12 l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~   51 (64)
                      ++..+.+.+    +=..+-+.+||+|+.  +..+.+.+++
T Consensus       158 vtsrdi~f~----~~~~~~~~~vmt~~~--~~~~~gi~l~  191 (503)
T KOG2550|consen  158 ITSRDIQFL----EDNSLLVSDVMTKNP--VTGAQGITLK  191 (503)
T ss_pred             Eehhhhhhh----hcccchhhhhccccc--ccccccccHH
Confidence            445555555    556778999999999  7777787776


No 89 
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated
Probab=38.04  E-value=22  Score=25.88  Aligned_cols=32  Identities=22%  Similarity=0.198  Sum_probs=27.2

Q ss_pred             eeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          29 KIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        29 ~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..++++|++  ++.+++.+.++. ++++.+.+++.
T Consensus       148 ~~V~diMt~--~~itV~~d~sL~-eAl~lM~~~~i  179 (479)
T PRK07807        148 TQVRDVMST--DLVTLPAGTDPR-EAFDLLEAARV  179 (479)
T ss_pred             CCHHHhccC--CceEECCCCcHH-HHHHHHHhcCC
Confidence            569999985  788999999998 79999888764


No 90 
>PF04504 DUF573:  Protein of unknown function, DUF573;  InterPro: IPR007592 This is a family of uncharacterised proteins.
Probab=37.07  E-value=16  Score=20.92  Aligned_cols=18  Identities=39%  Similarity=0.752  Sum_probs=14.9

Q ss_pred             CHHHHHHHHhhhcccCee
Q psy4850          13 EKDEVNIISGALELRRKI   30 (64)
Q Consensus        13 ~~~e~~ml~~~l~~~~~~   30 (64)
                      ++||..||+++++|...+
T Consensus         9 ~eDEi~iL~gl~~~~~~~   26 (98)
T PF04504_consen    9 EEDEIVILQGLIDFRAKT   26 (98)
T ss_pred             chHHHHHHHHHHHHHHhc
Confidence            479999999999995544


No 91 
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain. Met2 is a key enzyme in the biosynthesis of methionine.  It encodes a homoserine transacetylase involved in converting homoserine to O-acetyl homoserine. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=35.70  E-value=38  Score=18.01  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=15.6

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++..++.+.++. ++++.+.++|+
T Consensus         3 ~~~~~~~~~~~~-~~~~~~~~~~~   25 (110)
T cd04605           3 PVVTISEDASIK-EAAKLMIEENI   25 (110)
T ss_pred             CCEEECCCCCHH-HHHHHHHhCCC
Confidence            455677777777 57777766664


No 92 
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed
Probab=35.67  E-value=26  Score=25.27  Aligned_cols=34  Identities=24%  Similarity=0.323  Sum_probs=27.9

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...+.++|++ ..++.++.+.++. ++++.+.++++
T Consensus       146 ~~~V~dim~~-~~~v~v~~~~sl~-eal~~m~~~~~  179 (486)
T PRK05567        146 SQPVSEVMTK-ERLVTVPEGTTLE-EALELLHEHRI  179 (486)
T ss_pred             CCcHHHHcCC-CCCEEECCCCCHH-HHHHHHHHcCC
Confidence            4578999984 4688899999998 79999888765


No 93 
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins. Domain present in all 3 forms of cellular life. Present in two copies in inosine monophosphate dehydrogenase, of which one is disordered in the crystal structure [3]. A number of disease states are associated with CBS-containing proteins including homocystinuria, Becker's and Thomsen disease.
Probab=35.22  E-value=43  Score=14.31  Aligned_cols=21  Identities=19%  Similarity=0.216  Sum_probs=12.9

Q ss_pred             EEEeCCCCCCHHHHHHHHhcCC
Q psy4850          42 YMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        42 ~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ..++.+.++. ++++.+.+.++
T Consensus         3 ~~~~~~~~~~-~~~~~~~~~~~   23 (49)
T smart00116        3 VTVSPDTTLE-EALELLREHGI   23 (49)
T ss_pred             eEecCCCcHH-HHHHHHHHhCC
Confidence            4456666766 57776665543


No 94 
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other divalent cations into the cell via two highly conserved aspartates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=33.02  E-value=29  Score=18.60  Aligned_cols=32  Identities=28%  Similarity=0.277  Sum_probs=25.2

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      +.+++++|.|  ....++.+.++. ++++.+.+.+
T Consensus        52 ~~~v~~~~~~--~~~~i~~~~~~~-~~~~~~~~~~   83 (109)
T cd04606          52 DTPVSDIMDT--DVISVSADDDQE-EVARLFEKYD   83 (109)
T ss_pred             cchHHHHhCC--CCeEEcCCCCHH-HHHHHHHHcC
Confidence            4578899865  478899999998 6888887654


No 95 
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=32.67  E-value=31  Score=18.44  Aligned_cols=32  Identities=22%  Similarity=0.328  Sum_probs=25.1

Q ss_pred             CeeecceeeecccEEEEeCCCCCCHHHHHHHHhcC
Q psy4850          28 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSE   62 (64)
Q Consensus        28 ~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g   62 (64)
                      +..+.++|.+  ....++.+.++. ++++.+.+++
T Consensus        56 ~~~v~~~~~~--~~~~v~~~~~~~-~~~~~~~~~~   87 (112)
T cd04624          56 DTPVSEIMTR--DLVTVDPDEPVA-EAAKLMRKNN   87 (112)
T ss_pred             ccCHHHhccC--CCEEECCCCcHH-HHHHHHHHcC
Confidence            3578888864  578899999998 6888887655


No 96 
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS
Probab=29.95  E-value=59  Score=17.60  Aligned_cols=25  Identities=12%  Similarity=0.126  Sum_probs=18.0

Q ss_pred             cccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          38 LEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        38 r~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++++..++.+.++. ++.+.+.+.++
T Consensus         1 ~~~~~~~~~~~~~~-~~~~~~~~~~~   25 (105)
T cd04591           1 VPLVVLLPEGMTVE-DLESLLSTTSH   25 (105)
T ss_pred             CCceEEecccccHH-HHHHHHHhCCC
Confidence            35677788888888 67777766554


No 97 
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=29.23  E-value=56  Score=17.90  Aligned_cols=25  Identities=16%  Similarity=0.114  Sum_probs=21.0

Q ss_pred             cccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          38 LEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        38 r~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ...+.+++.+.++. ++++.+.+++.
T Consensus        75 ~~~~~~v~~~~~l~-~a~~~m~~~~~   99 (123)
T cd04627          75 TSDVISINGDQPLI-DALHLMHNEGI   99 (123)
T ss_pred             cCCceEeCCCCCHH-HHHHHHHHcCC
Confidence            45688999999998 79999988765


No 98 
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=29.09  E-value=50  Score=17.61  Aligned_cols=23  Identities=13%  Similarity=0.007  Sum_probs=16.7

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++..++.+.++. ++++.+.+.++
T Consensus         2 ~~~~v~~~~~i~-~a~~~~~~~~~   24 (96)
T cd04614           2 NVPTVWEETPLP-VAVRIMELANV   24 (96)
T ss_pred             CccEeCCCCcHH-HHHHHHHHcCC
Confidence            456778888888 68877776664


No 99 
>cd07178 terB_like_YebE tellurium resistance terB-like protein, subgroup 3. This family includes several uncharacterized bacterial proteins including an Escherichia coli protein called YebE. Protein sequence homology analysis shows they are similar to tellurium resistance protein terB, but the function of this family is unknown.
Probab=28.60  E-value=55  Score=18.44  Aligned_cols=19  Identities=21%  Similarity=0.237  Sum_probs=16.0

Q ss_pred             cccCCCCHHHHHHHHhhhc
Q psy4850           7 TEFNDLEKDEVNIISGALE   25 (64)
Q Consensus         7 ~~~g~l~~~e~~ml~~~l~   25 (64)
                      ...|.++++|++.|.+.++
T Consensus        11 kADG~id~~E~~~I~~~~~   29 (95)
T cd07178          11 KADGHIDEAERARILGELG   29 (95)
T ss_pred             HhcCCCCHHHHHHHHHHHH
Confidence            4578899999999998776


No 100
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family. This family includes metal-fist type transcriptional repressors of copper transport systems such as copYZAB of Enterococcus hirae and tcrYAZB (transferble copper resistance) of an Enterocuccus faecium plasmid. High levels of copper can displace zinc and prevent binding by the repressor, activating efflux by copper resistance transporters. The most closely related proteins excluded by this model are antibiotic resistance regulators including the methicillin resistance regulatory protein MecI.
Probab=28.53  E-value=13  Score=22.21  Aligned_cols=50  Identities=12%  Similarity=0.207  Sum_probs=31.7

Q ss_pred             CCHHHHHHHHhhhcccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          12 LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        12 l~~~e~~ml~~~l~~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      |++.|.+++.-+-+-+..++++|+--..+-..+. ..++. .++..+.+.||
T Consensus         2 Lt~~E~~VM~vlW~~~~~t~~eI~~~l~~~~~~~-~tTv~-T~L~rL~~KG~   51 (130)
T TIGR02698         2 ISDAEWEVMRVVWTLGETTSRDIIRILAEKKDWS-DSTIK-TLLGRLVDKGC   51 (130)
T ss_pred             CCHHHHHHHHHHHcCCCCCHHHHHHHHhhccCCc-HHHHH-HHHHHHHHCCc
Confidence            5678888888877888888888765443332222 23444 36666777664


No 101
>KOG0626|consensus
Probab=27.60  E-value=26  Score=26.09  Aligned_cols=27  Identities=15%  Similarity=0.423  Sum_probs=20.8

Q ss_pred             CccccccccCCCCHHHHHHHHhhhccc
Q psy4850           1 MVDLVTTEFNDLEKDEVNIISGALELR   27 (64)
Q Consensus         1 ~~~~~~~~~g~l~~~e~~ml~~~l~~~   27 (64)
                      |.+.++..--.++++|.++|+|..+|=
T Consensus       312 Mk~~vg~rLP~FT~ee~~~lKGS~DFv  338 (524)
T KOG0626|consen  312 MKERVGSRLPKFTEEESKLLKGSYDFV  338 (524)
T ss_pred             HHHHhcccCCCCCHHHHHHhcCchhhc
Confidence            445666655668899999999999874


No 102
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=26.73  E-value=38  Score=19.74  Aligned_cols=15  Identities=33%  Similarity=0.477  Sum_probs=11.0

Q ss_pred             CCCHHHHHHHHhhhc
Q psy4850          11 DLEKDEVNIISGALE   25 (64)
Q Consensus        11 ~l~~~e~~ml~~~l~   25 (64)
                      .|+++|+++|.+||.
T Consensus         2 ~Lt~eE~~~I~~Vl~   16 (118)
T PF02318_consen    2 HLTEEEREIILQVLQ   16 (118)
T ss_dssp             TS-CHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHH
Confidence            477888888888874


No 103
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generali
Probab=26.47  E-value=68  Score=16.43  Aligned_cols=23  Identities=22%  Similarity=0.281  Sum_probs=14.6

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++..++.+.++. ++++.+.+.++
T Consensus         2 ~~~~~~~~~~~~-~~~~~~~~~~~   24 (113)
T cd02205           2 DVVTVSPDDTVA-EALRLMLEHGI   24 (113)
T ss_pred             CceEecCCCCHH-HHHHHHHhcCC
Confidence            355667777777 57766665543


No 104
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=25.86  E-value=70  Score=17.32  Aligned_cols=23  Identities=22%  Similarity=0.167  Sum_probs=15.7

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++..++.+.++. ++++.+.+.++
T Consensus         2 ~~~~~~~~~~~~-~~~~~~~~~~~   24 (122)
T cd04637           2 RVVTVEMDDRLE-EVREIFEKHKF   24 (122)
T ss_pred             CceEeCCCCCHH-HHHHHHHhCCC
Confidence            456677777777 57777766654


No 105
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site.
Probab=25.21  E-value=75  Score=16.77  Aligned_cols=23  Identities=17%  Similarity=0.117  Sum_probs=14.2

Q ss_pred             cEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          40 DVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        40 ~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +++.++.+.++. ++++.+.+.++
T Consensus         2 ~~~~~~~~~~~~-~~~~~~~~~~~   24 (110)
T cd04588           2 PLITLNPNATLR-EAARLFNTHHI   24 (110)
T ss_pred             CcEEECCCCCHH-HHHHHHHHcCC
Confidence            345566677776 56666665554


No 106
>PRK04323 hypothetical protein; Provisional
Probab=25.02  E-value=71  Score=18.36  Aligned_cols=29  Identities=7%  Similarity=0.111  Sum_probs=18.4

Q ss_pred             ceeeecccEEEEeC--CCCCCHHHHHHHHhcC
Q psy4850          33 DVMTKLEDVYMLSY--DAILDFETVSEIMKSE   62 (64)
Q Consensus        33 dvM~Pr~~v~~l~~--~~~~~~e~l~~i~~~g   62 (64)
                      +.|+|..+|+++=.  +++.. .+++...+.|
T Consensus        11 gn~V~~~rIIAIv~~~Sap~K-r~~~~ak~~g   41 (91)
T PRK04323         11 GNIVSANRIIAIVSPESAPIK-RIIQEARERG   41 (91)
T ss_pred             CcEEEcccEEEEECCCcHHHH-HHHHHHHHcC
Confidence            57999999998743  33333 4555555555


No 107
>PF08934 Rb_C:  Rb C-terminal domain;  InterPro: IPR015030 The Rb C-terminal domain is required for high-affinity binding to E2F-DP complexes and for maximal repression of E2F-responsive promoters, thereby acting as a growth suppressor by blocking the G1-S transition of the cell cycle. This domain has a strand-loop-helix structure, which directly interacts with both E2F1 and DP1, followed by a tail segment that lacks regular secondary structure []. ; PDB: 1H25_E 1GUX_B 3POM_A 1GH6_B 2AZE_C 1N4M_A 1O9K_H 4ELL_B 2R7G_C 4ELJ_A ....
Probab=24.50  E-value=78  Score=19.90  Aligned_cols=18  Identities=17%  Similarity=0.086  Sum_probs=7.2

Q ss_pred             cceeeecccEEEEeCCCCC
Q psy4850          32 GDVMTKLEDVYMLSYDAIL   50 (64)
Q Consensus        32 ~dvM~Pr~~v~~l~~~~~~   50 (64)
                      ..+||||..+. +..+.++
T Consensus        51 ~~~mTPRSr~L-y~iGeS~   68 (155)
T PF08934_consen   51 PSKMTPRSRML-YSIGESF   68 (155)
T ss_dssp             --------EEE-EESS-TT
T ss_pred             CcccCccchhh-eeecCCc
Confidence            45899999998 7777776


No 108
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream.   The vitamin B6 complex comprises pyridoxine, pyridoxal, and pyridoxamine, as well as the 5'-phosphate esters of pyridoxal (PALP) and pyridoxamine, the last two being the biologically active coenzyme derivatives.  The members of the PALP family are principally involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and other amine-containing compounds.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a pote
Probab=23.88  E-value=84  Score=16.42  Aligned_cols=22  Identities=9%  Similarity=0.170  Sum_probs=14.1

Q ss_pred             EEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          41 VYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        41 v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      +..++.+.++. ++++.+.+.++
T Consensus         3 ~~~v~~~~~~~-~~~~~~~~~~~   24 (110)
T cd04609           3 VVSVAPDDTVS-QAIERMREYGV   24 (110)
T ss_pred             cEEECCCCcHH-HHHHHHHHcCC
Confidence            45566777776 57777666554


No 109
>KOG0474|consensus
Probab=23.08  E-value=44  Score=25.88  Aligned_cols=35  Identities=23%  Similarity=0.295  Sum_probs=29.1

Q ss_pred             ccCeeecceeeecccEEEEeCCCCCCHHHHHHHHhcCC
Q psy4850          26 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSES   63 (64)
Q Consensus        26 ~~~~~v~dvM~Pr~~v~~l~~~~~~~~e~l~~i~~~g~   63 (64)
                      ++..+|+|||.+  .+++++.-.... .+.+.+..+-|
T Consensus       579 mr~L~a~ev~~~--pvi~l~~~ekV~-~Iv~vLk~t~H  613 (762)
T KOG0474|consen  579 MRNLTAGEVMSK--PVICLNRVEKVA-VIVDVLKSTNH  613 (762)
T ss_pred             hhhhhHhhhccC--CeEEEechhhHH-HHHHHHHhcCc
Confidence            467889999999  999999999988 57777776655


Done!