Diaphorina citri psyllid: psy4860

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--

MTCPVQQVGCDGVVGSEKSLDRCGVCGGDNSSCRLVSGLFTRPLLPGGYNLITQIPRGACNLTVSEMKHTTNFLALRYRNGSYILNGDWAINWSGDYEGAGTKFTYRRGSNNVGQYLSSPGPLTEPLDLMVVFQQTNPGIKYEYQLSMESPNEAFLPANSNLGPEIENRIGPEIENRIEGRR

cccccCCccccccccccccccccccccccccccEEEEEEECccccccccEEEEEEcccccEEEEEEEcccccEEEEEcccccEEEcccccccccccCEEccEEEEEECccccccCEECccccccccEEEEEEEccccccEEEEEEEcccccccccccccccccccccccccccEEEECcccc

*TCPVQQVGCDGVVGSEKSLDRCGVCGGDNSSCRLVSGLFTRPLLPGGYNLITQIPRGACNLTVSEMKHTTNFLALRYRNGSYILNGDWAINWSGDYEGAGTKFTYRRGSNNVGQYLSSPGPLTEPLDLMVVFQQTNPGIKYEYQL**************************EI*N**EG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTCPVQQVGCDGVVGSEKSLDRCGVCGGDNSSCRLVSGLFTRPLLPGGYNLITQIPRGACNLTVSEMKHTTNFLALRYRNGSYILNGDWAINWSGDYEGAGTKFTYRRGSNNVGQYLSSPGPLTEPLDLMVVFQQTNPGIKYEYQLSMESPNEAFLPANSNLGPEIENRIGPEIENRIEGRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030198 [BP]	extracellular matrix organization	probable	GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0043062, GO:0008150, GO:0071840
GO:0008237 [MF]	metallopeptidase activity	probable	GO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044464 [CC]	cell part	probable	GO:0005575, GO:0005623
GO:0005604 [CC]	basement membrane	probable	GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GHM, chain A
Confidence level:very confident
Coverage over the Query: 5-149
View the alignment between query and template
View the model in PyMOL