Diaphorina citri psyllid: psy4887


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MTTNSPLADFVKYVPYALVLGGISYGVYKVISPKGHINPNIQKSNSKVVNVINIEDIADTLALCRCWRSKTFPKCDGSHAQHNQCTGDNVGPVLIKRNAA
ccccccccccEEEEHHHHHHHHHEEEEEEEcccccccccccccccccEEEEEEcccccccEEEEEEcccccccccccccHHHHHccccccccEEEEEccc
****SPLADFVKYVPYALVLGGISYGVYKVISPKGHINPNIQKSNSKVVNVINIEDIADTLALCRCWRSKTFPKCDGSHAQHNQCTGDNVGPVLIKR***
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTNSPLADFVKYVPYALVLGGISYGVYKVISPKGHINPNIQKSNSKVVNVINIEDIADTLALCRCWRSKTFPKCDGSHAQHNQCTGDNVGPVLIKRNAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CDGSH iron-sulfur domain-containing protein 1 Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation. May be involved in Fe-S cluster shuttling and/or in redox reactions.confidentQ3ZBU2
CDGSH iron-sulfur domain-containing protein 2 homolog confidentQ9VAM6
CDGSH iron-sulfur domain-containing protein 2 Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.confidentQ9CQB5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0043457 [BP]regulation of cellular respirationprobableGO:0043467, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FNV, chain A
Confidence level:very confident
Coverage over the Query: 34-99
View the alignment between query and template
View the model in PyMOL