Query         psy4920
Match_columns 111
No_of_seqs    55 out of 57
Neff          3.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:14:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4920.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4920hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2390|consensus               98.8 7.3E-09 1.6E-13   92.7   4.9   64   40-109   192-256 (669)
  2 cd00928 Cyt_c_Oxidase_VIIa Cyt  64.4      11 0.00024   24.7   3.3   32   48-84     21-52  (55)
  3 PF06812 ImpA-rel_N:  ImpA-rela  40.3      61  0.0013   20.3   3.8   41   60-100    21-61  (62)
  4 PF05476 PET122:  PET122;  Inte  27.3      48   0.001   27.9   2.1   43   45-89     29-73  (267)
  5 PF00178 Ets:  Ets-domain;  Int  25.7   1E+02  0.0022   21.1   3.2   18   83-100    55-72  (85)
  6 PRK04358 hypothetical protein;  24.2      71  0.0015   26.1   2.5   24   76-99     91-114 (217)
  7 TIGR03875 RNA_lig_partner RNA   23.4      76  0.0017   25.8   2.5   24   76-99     87-110 (206)
  8 PF04214 DUF411:  Protein of un  21.3      46 0.00099   22.7   0.8   15   94-108    55-69  (70)
  9 COG5215 KAP95 Karyopherin (imp  21.2      19 0.00042   34.1  -1.4   67   28-101    75-150 (858)
 10 PHA02046 hypothetical protein   21.2      77  0.0017   23.2   2.0   19   83-101    19-37  (99)

No 1  
>KOG2390|consensus
Probab=98.77  E-value=7.3e-09  Score=92.71  Aligned_cols=64  Identities=17%  Similarity=0.167  Sum_probs=57.7

Q ss_pred             ccchhhcccCcCCCCCchHHHHHHHHHhhhccccchHHHHHHHHHHHHHHHHHHhcCccccCC-CCCCccc
Q psy4920          40 DVTQEGLSGLKSCPPDGLVWRLAICSSHALYSMGGAKSFAHVWFEFVQELRYRWENSLRIPGV-KKKSLEA  109 (111)
Q Consensus        40 ~~~~e~~~~iKSAP~dSL~~RLAl~~~~c~~~~GGlravAhLW~EFV~ELRyrWEn~~~IPgl-~~~~p~~  109 (111)
                      +.+++.+.+.++||++|      .|++..+.+++|++.+|++|.+||.|+||+|+++..||+. ..++||.
T Consensus       192 ~~~~n~~n~~~~ap~~s------~~Ll~~~~~~~t~~~~a~~w~a~v~e~r~~w~~~s~ipw~~a~~~PDl  256 (669)
T KOG2390|consen  192 AHELNMLNAASMAPNQS------DDLLVNNVKLDTLFNYANPWSANVFEARYKWAKKSTIPWRLAIALPDL  256 (669)
T ss_pred             chhhhhhhHhhcCCCch------hHHHHHhhhccchhhhhhHHHHHHHHHHHHHhhcCcCCcccccCCCcc
Confidence            34588889999999999      6677778899999999999999999999999999999987 8899986


No 2  
>cd00928 Cyt_c_Oxidase_VIIa Cytochrome c oxidase subunit VIIa. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit VIIa has two tissue-specific isoforms that are expressed in a developmental manner. VIIa-H is expressed in heart and skeletal muscle but not smooth muscle. VIIa-L is expressed in liver and non-muscle tissues.
Probab=64.38  E-value=11  Score=24.71  Aligned_cols=32  Identities=19%  Similarity=0.262  Sum_probs=26.6

Q ss_pred             cCcCCCCCchHHHHHHHHHhhhccccchHHHHHHHHH
Q psy4920          48 GLKSCPPDGLVWRLAICSSHALYSMGGAKSFAHVWFE   84 (111)
Q Consensus        48 ~iKSAP~dSL~~RLAl~~~~c~~~~GGlravAhLW~E   84 (111)
                      ++|.-|.|.+.+|+.+.+|.+     |+-+...+|..
T Consensus        21 ~LKGG~~D~~LYr~Tm~L~~v-----G~~~~~~~l~~   52 (55)
T cd00928          21 HLKGGVVDRILYRLTMALTVV-----GTGYSLYLLYM   52 (55)
T ss_pred             EecCCchhHHHHHHHHHHHHH-----hHHHHHHHHHH
Confidence            499999999999999988875     77777766654


No 3  
>PF06812 ImpA-rel_N:  ImpA-related N-terminal;  InterPro: IPR010657 This entry represents a conserved region located towards the N-terminal end of ImpA and related proteins. ImpA is an inner membrane protein, which has been suggested to be involved with proteins that are exported and associated with colony variations in Actinobacillus actinomycetemcomitans []. Note that many members are hypothetical proteins.
Probab=40.27  E-value=61  Score=20.34  Aligned_cols=41  Identities=20%  Similarity=0.234  Sum_probs=30.4

Q ss_pred             HHHHHHHhhhccccchHHHHHHHHHHHHHHHHHHhcCcccc
Q psy4920          60 RLAICSSHALYSMGGAKSFAHVWFEFVQELRYRWENSLRIP  100 (111)
Q Consensus        60 RLAl~~~~c~~~~GGlravAhLW~EFV~ELRyrWEn~~~IP  100 (111)
                      |++..++.+....+|+.|++.==.-+..=+..+||...|-|
T Consensus        21 rv~~~l~~a~~~~~g~~gl~~gl~ll~~ll~~~W~~l~P~~   61 (62)
T PF06812_consen   21 RVAVWLTEALLRLEGLAGLAEGLELLADLLENYWDSLHPQL   61 (62)
T ss_pred             HHHHHHHHHHHHccChhHHHHHHHHHHHHHHHCCcccCCCC
Confidence            56666666666788999888877777777788998877644


No 4  
>PF05476 PET122:  PET122;  InterPro: IPR008732 The nuclear PET122 gene of Saccharomyces cerevisiae encodes a mitochondrial-localised protein that activates initiation of translation of the mitochondrial mRNA from the COX3 gene, which encodes subunit III of cytochrome c oxidase [].; GO: 0003743 translation initiation factor activity, 0006413 translational initiation, 0005740 mitochondrial envelope
Probab=27.30  E-value=48  Score=27.92  Aligned_cols=43  Identities=19%  Similarity=0.403  Sum_probs=30.9

Q ss_pred             hcccCcCCCCCchHHHHHHHH-Hh-hhccccchHHHHHHHHHHHHHH
Q psy4920          45 GLSGLKSCPPDGLVWRLAICS-SH-ALYSMGGAKSFAHVWFEFVQEL   89 (111)
Q Consensus        45 ~~~~iKSAP~dSL~~RLAl~~-~~-c~~~~GGlravAhLW~EFV~EL   89 (111)
                      .++.+++-|.++.-+.|--.. +. |  ..|-+..|+.+|+.||+-.
T Consensus        29 vL~~~R~~p~~emd~~fLq~yL~~S~--qwgHv~Si~yIW~k~Vmr~   73 (267)
T PF05476_consen   29 VLAELRQIPVDEMDYSFLQLYLARSC--QWGHVPSIDYIWYKYVMRR   73 (267)
T ss_pred             HHHHHHcCcHhHhhHHHHHHHHHHHH--HHhcchHHHHHHHHHHhhc
Confidence            345677788888877764322 22 4  5677899999999999754


No 5  
>PF00178 Ets:  Ets-domain;  InterPro: IPR000418 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription []. The ets oncogene is such a factor, possessing a region of 85-90 amino acids known as the ETS (erythroblast transformation specific) domain [, , ]. This domain is rich in positively-charged and aromatic residues, and binds to purine-rich segments of DNA. The ETS domain has been identified in other transcription factors such as PU.1, human erg, human elf-1, human elk-1, GA binding protein, and a number of others [, , ]. It is generally localized at the C terminus of the protein, with the exception of ELF-1, ELK-1, ELK-3, ELK-4 and ERF where it is found at the N terminus.  NMR-analysis of the structure of the Ets domains revealed that it contains three alpha-helixes (1-3) and four-stranded beta-sheets (1-4) arranged in the order alpha1-beta1-beta2-alpha2-alpha3-beta3-beta4 forming a winged helix-turn-helix (wHTH) topology []. The third alpha-helix is responsive to contact to the major groove of the DNA. Different members of the Ets family proteins display distinct DNA binding specificities. The Ets domains and the flanking amino acid sequences of the proteins influence the binding affinity, and the alteration of a single amino acid in the Ets domain can change its DNA binding specificities.  Avian leukemia virus E26 is a replication defective retrovirus that induces a mixed erythroid/myeloid leukemia in chickens.This virus carries two distinct oncogenes: v-myb and v-ets. The ets portion of this oncogene is required for the induction of erythroblastosis. V-ets and c-ets-1, its cellular progenitor, have been shown [] to be nuclear DNA-binding proteins. Ets-1 differs slightly from v-ets at its carboxy-terminal region. In most species where it has been sequenced, c-ets-1 exists in various isoforms generated by alternative splicing and differential phosphorylation.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1DUX_F 4AVP_B 1HBX_G 1BC7_C 1K6O_A 1BC8_C 1PUE_E 1FLI_A 2DAO_A 1WWX_A ....
Probab=25.70  E-value=1e+02  Score=21.15  Aligned_cols=18  Identities=17%  Similarity=0.340  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHhcCcccc
Q psy4920          83 FEFVQELRYRWENSLRIP  100 (111)
Q Consensus        83 ~EFV~ELRyrWEn~~~IP  100 (111)
                      ..+-+-||++.++++.-+
T Consensus        55 eklsR~LR~yy~k~il~k   72 (85)
T PF00178_consen   55 EKLSRALRYYYKKGILEK   72 (85)
T ss_dssp             HHHHHHHHHHHHTTSEEE
T ss_pred             HHHHHHHHHHhhCCeEEe
Confidence            568899999999998754


No 6  
>PRK04358 hypothetical protein; Provisional
Probab=24.17  E-value=71  Score=26.08  Aligned_cols=24  Identities=29%  Similarity=0.695  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhcCccc
Q psy4920          76 KSFAHVWFEFVQELRYRWENSLRI   99 (111)
Q Consensus        76 ravAhLW~EFV~ELRyrWEn~~~I   99 (111)
                      +==|.+-+|||.|||.|-+.+..|
T Consensus        91 ~IPA~i~ye~I~~mR~RInkGLRV  114 (217)
T PRK04358         91 KIPAEIFYEYIEDMRERINKGLRV  114 (217)
T ss_pred             eccHHHHHHHHHHHHHHHhcchHH
Confidence            334678899999999999988765


No 7  
>TIGR03875 RNA_lig_partner RNA ligase partner, MJ_0950 family. This uncharacterized protein family is found almost perfectly in the same set of genomes as the Pab1020 family described by model TIGR01209. These pairs are found mostly in Archaea, but also in a few bacteria (e.g. Alkalilimnicola ehrlichei MLHE-1, Aquifex aeolicus). While the partner protein has been described as homodimeric ligase that has RNA circularization activity, the function of this protein (also called UPF0278) is unknown.
Probab=23.38  E-value=76  Score=25.75  Aligned_cols=24  Identities=33%  Similarity=0.718  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhcCccc
Q psy4920          76 KSFAHVWFEFVQELRYRWENSLRI   99 (111)
Q Consensus        76 ravAhLW~EFV~ELRyrWEn~~~I   99 (111)
                      +==|.+-+|||.|||.|-+.+..|
T Consensus        87 ~IPA~i~ye~I~e~R~RInkGLRV  110 (206)
T TIGR03875        87 KIPAEIFYEYIEEVRERIDKGLRV  110 (206)
T ss_pred             eccHHHHHHHHHHHHHHHhcchhH
Confidence            334678999999999999888765


No 8  
>PF04214 DUF411:  Protein of unknown function, DUF;  InterPro: IPR007332 The function of the members of this bacterial protein family is unknown. Some members may be involved in conferring cation resistance.
Probab=21.26  E-value=46  Score=22.73  Aligned_cols=15  Identities=27%  Similarity=0.445  Sum_probs=12.5

Q ss_pred             hcCccccCCCCCCcc
Q psy4920          94 ENSLRIPGVKKKSLE  108 (111)
Q Consensus        94 En~~~IPgl~~~~p~  108 (111)
                      =.++.+|||+-+||-
T Consensus        55 ~~GlavPGMP~GSPG   69 (70)
T PF04214_consen   55 ARGLAVPGMPAGSPG   69 (70)
T ss_pred             ceEEeCCCCCCCCCC
Confidence            457899999999983


No 9  
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion]
Probab=21.16  E-value=19  Score=34.14  Aligned_cols=67  Identities=13%  Similarity=0.185  Sum_probs=43.6

Q ss_pred             ccccceeeeeccccchhhcccCcCC---CCCchHHHHHHHHHhhhccccchHHHHH------HHHHHHHHHHHHHhcCcc
Q psy4920          28 SESIGCQIIKQDDVTQEGLSGLKSC---PPDGLVWRLAICSSHALYSMGGAKSFAH------VWFEFVQELRYRWENSLR   98 (111)
Q Consensus        28 ~~~~g~~~~~~~~~~~e~~~~iKSA---P~dSL~~RLAl~~~~c~~~~GGlravAh------LW~EFV~ELRyrWEn~~~   98 (111)
                      -+++||+--|.. -.-|.-.++|+-   -..|-..|++..++.      =+.+||.      +|.+|..||+-..-...+
T Consensus        75 ~~~~~~~qrW~~-~~~E~k~qvK~~al~aL~s~epr~~~~Aaq------l~aaIA~~Elp~~~wp~lm~~mv~nvg~eqp  147 (858)
T COG5215          75 ELQKGCSQRWLG-MRHESKEQVKGMALRALKSPEPRFCTMAAQ------LLAAIARMELPNSLWPGLMEEMVRNVGDEQP  147 (858)
T ss_pred             HHHHHHHHhhcc-CCHHHHHHHHHHHHHHhcCCccHHHHHHHH------HHHHHHHhhCccccchHHHHHHHHhccccCc
Confidence            467788776765 444444455541   233445689887765      3555653      899999999987766666


Q ss_pred             ccC
Q psy4920          99 IPG  101 (111)
Q Consensus        99 IPg  101 (111)
                      .-|
T Consensus       148 ~~~  150 (858)
T COG5215         148 VSG  150 (858)
T ss_pred             hHh
Confidence            554


No 10 
>PHA02046 hypothetical protein
Probab=21.16  E-value=77  Score=23.25  Aligned_cols=19  Identities=21%  Similarity=0.494  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHhcCccccC
Q psy4920          83 FEFVQELRYRWENSLRIPG  101 (111)
Q Consensus        83 ~EFV~ELRyrWEn~~~IPg  101 (111)
                      ..+.+|++|+=||-+++|.
T Consensus        19 ~~l~~e~~~~re~eiPlpa   37 (99)
T PHA02046         19 TAIEREFKWYRENDIPLPA   37 (99)
T ss_pred             HHHHHHHHHHHhcCCCCch
Confidence            5688999999999999996


Done!