Diaphorina citri psyllid: psy4924


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MKFSHSKVKSNIISWNRVVLLHGPPGTGKTSLCKAVAQKLSIRLQTPQAIFFKKYPNVLIFTTSNLTGAIDLAFLDRADIKQYIGFPSAAAIFNIFSSCVEELKR
cccccccccccEEEcccEEEECccccccccHHHHHHHHHHHHHcccccHHHHHccccEEEEEEcccccHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHc
*******VKSNIISWNRVVLLHGPPGTGKTSLCKAVAQKLSIRLQTPQAIFFKKYPNVLIFTTSNLTGAIDLAFLDRADIKQYIGFPSAAAIFNIFSSCVEELKR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFSHSKVKSNIISWNRVVLLHGPPGTGKTSLCKAVAQKLSIRLQTPQAIFFKKYPNVLIFTTSNLTGAIDLAFLDRADIKQYIGFPSAAAIFNIFSSCVEELKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pachytene checkpoint protein 2 homolog Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways.confidentE1C6Q1
Pachytene checkpoint protein 2 homolog Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways. Also required for development of higher-order chromosome structures and is needed for synaptonemal-complex formation. In males, required for efficient synapsis of the sex chromosomes and for sex body formation. Promotes early steps of the DNA double-strand breaks (DSBs) repair process upstream of the assembly of RAD51 complexes. Required for depletion of HORMAD1 and HORMAD2 from synapsed chromosomes.confidentE2R222
Pachytene checkpoint protein 2 homolog Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways. Also required for development of higher-order chromosome structures and is needed for synaptonemal-complex formation. In males, required for efficient synapsis of the sex chromosomes and for sex body formation. Promotes early steps of the DNA double-strand breaks (DSBs) repair process upstream of the assembly of RAD51 complexes. Required for depletion of HORMAD1 and HORMAD2 from synapsed chromosomes.confidentD3K5L7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0006302 [BP]double-strand break repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0007131 [BP]reciprocal meiotic recombinationprobableGO:0048610, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0044699, GO:0006139, GO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0035825, GO:0046483, GO:0006310, GO:0044238, GO:0007049, GO:0044237, GO:0043170, GO:0006259, GO:0044763
GO:0007130 [BP]synaptonemal complex assemblyprobableGO:0006996, GO:0007126, GO:0022607, GO:0070193, GO:0070192, GO:0044699, GO:0051321, GO:0007127, GO:0009987, GO:0048610, GO:0007129, GO:0016043, GO:0008150, GO:0044085, GO:0022402, GO:0071840, GO:0044763, GO:0000003, GO:0007049, GO:0051276
GO:0017111 [MF]nucleoside-triphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0001673 [CC]male germ cell nucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007141 [BP]male meiosis IprobableGO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0044699, GO:0009987, GO:0008150, GO:0048610, GO:0022402, GO:0007049, GO:0044763, GO:0007140
GO:0001556 [BP]oocyte maturationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0010259, GO:0007276, GO:0000003, GO:0048869, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0044767, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0007144 [BP]female meiosis IprobableGO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0048610, GO:0022402, GO:0044699, GO:0044763, GO:0007143, GO:0007049

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 13-102
View the alignment between query and template
View the model in PyMOL