Diaphorina citri psyllid: psy4925

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MVDRGIHAAFLTEIFRGFFVATGHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTESHEELLYNKEKLLSNGDKWESEIASNIHADHLYR
cHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHccccccEEEEECcccccccCEEEEcccccccccccccccccccccccccccccccccHHHHcccHHHHcccccccHHHHHcccccccccc
**DRGIHAAFLTEIFRGFFVATGHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTESHEELLYNKEKLLSNGDKWESEIASNI**DHLYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDRGIHAAFLTEIFRGFFVATGHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTESHEELLYNKEKLLSNGDKWESEIASNIHADHLYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH-quinone oxidoreductase subunit I NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.very confidentQ163R7
NADH-quinone oxidoreductase subunit I NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.very confidentQ2W3J2
NADH-quinone oxidoreductase subunit I NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.very confidentB0ULL2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046872 [MF]metal ion bindingconfidentGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0050136 [MF]NADH dehydrogenase (quinone) activityconfidentGO:0003824, GO:0016655, GO:0003674, GO:0016651, GO:0003954, GO:0016491
GO:0006979 [BP]response to oxidative stressconfidentGO:0006950, GO:0008150, GO:0050896
GO:0005747 [CC]mitochondrial respiratory chain complex IconfidentGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0043623 [BP]cellular protein complex assemblyconfidentGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0071840
GO:0006996 [BP]organelle organizationconfidentGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0071688 [BP]striated muscle myosin thick filament assemblyprobableGO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0051146, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0034622, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030154, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0044763, GO:0009987, GO:0042692
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0008137 [MF]NADH dehydrogenase (ubiquinone) activityprobableGO:0003824, GO:0016655, GO:0050136, GO:0016651, GO:0003674, GO:0003954, GO:0016491
GO:0006120 [BP]mitochondrial electron transport, NADH to ubiquinoneprobableGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0040007 [BP]growthprobableGO:0008150
GO:0032981 [BP]mitochondrial respiratory chain complex I assemblyprobableGO:0006996, GO:0033108, GO:0044699, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0097031, GO:0006461, GO:0010257, GO:0016043, GO:0065003, GO:0044085, GO:0044763, GO:0071840, GO:0034622, GO:0008150, GO:0009987, GO:0043623, GO:0007005
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0004174 [MF]electron-transferring-flavoprotein dehydrogenase activityprobableGO:0003824, GO:0016649, GO:0003674, GO:0016645, GO:0016491
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.99.-With other acceptors.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 9
Confidence level:very confident
Coverage over the Query: 34-149
View the alignment between query and template
View the model in PyMOL