Diaphorina citri psyllid: psy4969


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MSRTIIDPVTSVQLPDGKTGELCLKGDVFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDGTHFIW
cCEEEEcccccccccccccccEEEEccccccccccHHHHHHcccccccccccccEEEcccccEEEc
MSRTIIDPVTSVQLPDGKTGELCLKGDVFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDGTHFIW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRTIIDPVTSVQLPDGKTGELCLKGDVFLGYRNKVEATKEMLDDDGWLHTGDLAYRLPDGTHFIW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-coumarate--CoA ligase-like 9 Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors. Converts 12-oxo-phytodienoic acid (OPDA) into OPDA-CoA.confidentQ84P23
Long-chain-fatty-acid--CoA ligase 5 Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL at the villus tip of the crypt-villus axis of the small intestine (By similarity). May have a role in the survival of glioma cells (By similarity). May activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. It was suggested that it may also stimulate fatty acid oxidation. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids.confidentO88813
Long-chain-fatty-acid--CoA ligase 5 Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage (By similarity). Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids (By similarity). It was suggested that it may also stimulate fatty acid oxidation (By similarity). At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells.confidentQ9ULC5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0009695 [BP]jasmonic acid biosynthetic processprobableGO:1901576, GO:0044710, GO:0044711, GO:0006082, GO:0071704, GO:0046394, GO:0044237, GO:0009987, GO:0016053, GO:0019752, GO:0032787, GO:0009694, GO:0044249, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0044283, GO:0043436, GO:0072330
GO:0031957 [MF]very long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0000038 [BP]very long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0042178 [BP]xenobiotic catabolic processprobableGO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0044763, GO:0009410, GO:0044237, GO:0044248, GO:0006805, GO:0071466, GO:0008150, GO:0008152, GO:0042221, GO:0009056, GO:0044699
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0004321 [MF]fatty-acyl-CoA synthase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674, GO:0016408
GO:0007405 [BP]neuroblast proliferationprobableGO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0008283, GO:0009987, GO:0048869, GO:0030154, GO:0044763, GO:0007275, GO:0032501, GO:0008150, GO:0061351, GO:0048731, GO:0022008, GO:0072089, GO:0044699
GO:0008654 [BP]phospholipid biosynthetic processprobableGO:0071704, GO:1901576, GO:0006644, GO:0006629, GO:0044238, GO:0009987, GO:0006796, GO:0044237, GO:0044249, GO:0009058, GO:0044710, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255, GO:0090407, GO:0008610
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0009851 [BP]auxin biosynthetic processprobableGO:0042445, GO:0042446, GO:0009987, GO:0009850, GO:0044237, GO:0010817, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0016207 [MF]4-coumarate-CoA ligase activityprobableGO:0016878, GO:0016405, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035338 [BP]long-chain fatty-acyl-CoA biosynthetic processprobableGO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0008150, GO:0044249, GO:0009058, GO:0046949, GO:0071616, GO:0008152, GO:0006793, GO:0009108, GO:0035336, GO:0035337
GO:0046320 [BP]regulation of fatty acid oxidationprobableGO:0080090, GO:0019217, GO:0019216, GO:0031323, GO:0010565, GO:0050794, GO:0065007, GO:0008150, GO:0019222, GO:0050789
GO:0044539 [BP]long-chain fatty acid importprobableGO:0051234, GO:0015718, GO:0015908, GO:0006869, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0071702, GO:0015909, GO:0033036, GO:0010876, GO:0006820, GO:0044699, GO:0046942
GO:0044434 [CC]chloroplast partprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0010867 [BP]positive regulation of triglyceride biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0046890, GO:0050789, GO:0090208, GO:0031328, GO:0065007, GO:0048518, GO:0045834, GO:0010866, GO:0090207, GO:0019216, GO:0009889, GO:0050794, GO:0008150, GO:0046889, GO:0080090, GO:0048522
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0004467 [MF]long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019432 [BP]triglyceride biosynthetic processprobableGO:0071704, GO:0045017, GO:0044710, GO:0044238, GO:0006629, GO:0006641, GO:0009987, GO:0006639, GO:0006638, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:1901576, GO:0046486, GO:0044255, GO:0046463, GO:0046460, GO:0008610
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0010747 [BP]positive regulation of plasma membrane long-chain fatty acid transportprobableGO:0051049, GO:0034764, GO:0034765, GO:0044070, GO:0050789, GO:0034762, GO:0034767, GO:0051050, GO:0032370, GO:0065007, GO:0043269, GO:0048518, GO:0010746, GO:2000193, GO:2000191, GO:0050794, GO:0043270, GO:0008150, GO:0032890, GO:0032892, GO:0032879, GO:0032368, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D1S, chain A
Confidence level:very confident
Coverage over the Query: 1-66
View the alignment between query and template
View the model in PyMOL